Universal retargeting of oncolytic HSV

Abstract

Provided herein are bispecific adapter proteins and their use to retarget oncolytic HSV to target cells, such as tumor cells.

Description

[Technical field]

[0001] (CROSS REFERENCE TO RELATED APPLICATIONS) This application claims the benefit of U.S. Provisional Patent Application No. 63 / 184,283, filed May 5, 2021, which is incorporated by reference in its entirety.

[0002] FIELD OF THEINVENTION The present disclosure provides bispecific adapter proteins and their use to retarget oncolytic HSV to target cells, such as tumor cells.

[0003] (Reference to electronically submitted sequence listing) This application contains a Sequence Listing that has been submitted electronically in ASCII format, which is incorporated herein by reference in its entirety. This ASCII copy was created on Feb. 28, 2022, is named JBI6460WOPCT1_SeqListing.txt, and is 192,512 bytes in size. [Background technology]

[0004] Oncolytic herpes simplex viruses (oHSVs) have been widely studied for the treatment of solid tumors. As a group, they offer many advantages over traditional cancer therapies (Markert JM et al., Genetically engineered HSV in the treatment of glioma: a review. Rev Med Virol. 2000 Jan-Feb; 10(1): 17-30; Russell SJ et al., Oncolytic virotherapy. Nat Biotechnol. 2012 Jul 10; 30(7): 658-70; and Shen Y et al., Herpes simplex virus 1 (HSV-1) for cancer treatment. Cancer Gene Ther. 2006 Nov; 13(11): 975-92). Specifically, oHSVs usually embody mutations that render them susceptible to inhibition by some aspects of innate immunity. As a result, they replicate in cancer cells that have one or more impaired innate immune responses to infection, but not in normal cells that have intact innate immune responses. oHSV is usually delivered directly to the tumor mass where the virus can replicate. It is believed to be delivered to the target tissue, not systemically, and therefore does not have the side effects characteristic of anticancer drugs. Viruses characteristically induce adaptive immune responses that curtail their ability to be administered multiple times. oHSV has been administered multiple times to tumors without evidence of loss of efficacy or induction of adverse reactions, such as inflammatory responses. HSVs are large DNA viruses that can incorporate foreign DNA into their genome and modulate the expression of these genes upon administration to tumors. Suitable foreign genes for use with oHSV are those that aid in the induction of adaptive immune responses to tumors.

[0005] The defect in overcoming the cellular innate immune response determines the range of tumors in which the virus exhibits its oncolytic oHSV as an anticancer agent: the more extensive the deletion, the more restricted the range of cancer cells in which oHSV is effective, depending on the function of the deleted viral gene. Most newer oHSVs incorporate at least one cellular gene to enhance their anticancer activity (Cheema TA et al., Multifaceted oncolytic virus therapy for glioblastoma in an immunocompetent cancer stem cell model. Proc Natl Acad Sci USA. 2013 Jul 16;110(29):12006-11; Goshima F et al., Oncolytic viral therapy with a combination of HF10, a herpes simplex virus type 1 variant and granulocyte-macrophage colony-stimulating factor for murine ovarian cancer. Int J Cancer. 2014 Jun 15;134(12):2865-77; Markert JM et al., Preclinical evaluation of a genetically engineered herpes simplex virus expressing interleukin-12. J. Virol. 2012 May;86(9):5304-13; and Walker JD ... herpes simplex virus 1 encoding 15-prostaglandin dehydrogenase mitigates immune suppression and reduces ectopic primary and metastatic breast cancer in mice.J.Virol.2011 Jul;85(14):7363-71).

[0006] It is convenient to consider separately the structure of oHSV, called the backbone, and the foreign gene suitable for insertion into the backbone. As mentioned above, the structure of the backbone determines the range of susceptible cancers. The foreign gene allows the host to recognize the cancer cell as a legitimate target for the adaptive immune response.

[0007] The HSV genome consists of two covalently linked components, designated L and S. Each component consists of unique sequences flanked by inverted repeats (UL for the L component and US for the S component). The inverted repeats of the L component are designated ab and b'a'. The inverted repeats of the S component are designated a'c' and ca. The inverted repeats b'a' and a'c' constitute the internal inverted repeat region. The inverted repeat regions of both the L and S components are known to contain two copies of five protein-encoding genes designated ICP0, ICP4, ICP34.5, ORF P and ORF O, respectively, as well as large stretches of transcribed but non-protein-coding DNA.

[0008] Historically, viruses tested in cancer patients fall into three different designs. The first was based on evidence that deletion of the ICP34.5 gene significantly attenuated the virus (Andreansky S et al., Evaluation of genetically engineered herpes simplex viruses as oncolytic agents for human malignant brain tumors. Cancer Res. 1997 Apr 15;57(8):1502-9; Chou J et al., Association of a M(r)90,000 phosphoprotein with protein kinase PKR in cells exhibiting enhanced phosphorylation of translation initiation factor eIF-2 alpha and premature shutoff of protein synthesis after infection with gamma 134.5-mutants of herpes simplex virus 1. Proc Natl Acad Sci USA. 1995 Nov 7;92(23):10516-20; Chou J et al., Mapping of herpes simplex virus-1 neurovirulence to gamma 134.5, a gene nonessential for growth in culture.Science.1990 Nov 30;250(4985):1262-6; and Chou J et al.,The gamma 1(34.5)gene of herpes simplex virus 1 precludes neuroblastoma cells from triggering total shutoff of protein synthesis characteristic of programmed cell death in neuronal cells.Proc Natl Acad Sci USA.1992 Apr 15;89(8):3266-70).To ensure its safety for the treatment of malignant glioblastoma, G207, the first virus tested in patients, was further attenuated by additional mutations in the gene encoding viral ribonucleotide reductase (Mineta T et al., Attenuated multi-mutated herpes simplex virus-1 for the treatment of malignant gliomas. Nat Med. 1995 Sep;1(9):938-43). G207, which has mutations in both the ICP34.5 and ribonucleotide reductase genes, was excessively attenuated and blocked in cancer cells expressing wild-type protein kinase R (Smith KD et al., Activated MEK suppresses activation of PKR and enables efficient replication and in vivo oncolysis by Deltagamma(1)34.5 mutants of herpes simplex virus 1. J. Virol. 2006 Feb;80(3):1110-20).

[0009] The second design was based on the demonstration that a viral protein called US11, when expressed early in infection, partially compensates for the absence of ICP34.5 and restores the ability to grow in cells expressing wild-type protein kinase R (Mulvey et al., A herpesvirus ribosome-associated, RNA-binding protein confers a growth advantage upon mutants deficient in a GADD34-related function, J Virol. 1999 Apr;73(4):3375-85).The design of this viral backbone follows that published by Cassady et al. in that the US12 gene and the promoter of US11 are deleted (Cassady KA et al., The herpes simplex virus US11 protein effectively compensates for the gamma1(34.5) gene if present before activation of protein kinase R by precluding its phosphorylation and that of the alpha subunit of eukaryotic translation initiation factor 2. J. Virol. 1998 Nov;72(11):8620-6; Cassady KA et al., The second-site mutation in the herpes simplex virus recombinants lacking the gamma134.5 genes precludes shutoff of protein synthesis by blocking the phosphorylation of eIF-2alpha. J. Virol. 1998 Sep;72(9):7005-11; and Mulvey M et al., A herpesvirus ribosome-associated, RNA-binding protein confers a growth advantage). upon mutants deficient in a GADD34-related function. J. Virol. 1999 Apr;73(4):3375-85). As a result, US11 is expressed as an immediate early gene rather than a late gene. FDA-approved oHSV talimogene laherparepvec (formerly OncoVex. GM-CSFThe ICP34.5 deleted herpes simplex virus (formerly known as ICP34.5) utilizes this backbone design and further encodes the human GM-CSF gene under the control of a CMV promoter (Liu et al., ICP34.5 deleted herpes simplex virus with enhanced oncolytic, immune stimulating, and anti-tumour properties, Gene Ther. 2003 Feb;10(4):292-303).

[0010] The backbone of the third virus, initially called R7020 and later renamed NV1020, was the result of modification of a naturally occurring mutant that was initially tested as an attenuated live virus vaccine (Meignier B et al., In vivo behavior of genetically engineered herpes simplex viruses R7017 and R7020: construction and evaluation in rodents. J Infect Dis. 1988 Sep;158(3):602-14 and Meignier B et al., Virulence of and establishment of latency by genetically engineered deletion mutants of herpes simplex virus 1. Virology. 1988 Jan;162(1):251-4). This mutant lacked the internal inverted repeats (consisting of b'a' and a'c', encoding one copy of the genes ICP0, ICP4, ICP34.5, ORF P and ORF 0) and the genes encoding UL56 and UL24. Moreover, it contained bacterial sequences and, since it was intended as a vaccine, also contained genes encoding several HSV-2 glycoproteins. R7020 was extensively tested in patients with liver metastases from colon cancer. In addition, it was tested in: head and neck epithelial squamous cell carcinoma and prostate cancer xenografts in athymic nude mice and in a bladder tumor model (Sze DY et al., Response to intra-arterial oncolytic virotherapy with the herpes virus NV1020 evaluated by [18F]fluorodeoxyglucose positron emission tomography and computed tomography. Hum Gene Ther. 2012 Jan;23(1):91-7; Cozzi PJ et al.,Intravesical oncolytic viral therapy using attenuated,replication-competent herpes simplex viruses G207 and Nv1020 is effective in the treatment of bladder cancer in an orthotopic syngeneic model.FASEB J.2001 May;15(7):1306-8;Currier MA et al.,Widespread intratumoral virus distribution with fractionated injection enables local control of large human rhabdomyosarcoma xenografts by oncolytic herpes simplex viruses.Cancer Gene Ther.2005 Apr;12(4):407-16;Fong Y et al.,A herpes oncolytic virus can be delivered via the vasculature to produce biologic changes in human colorectal cancer.Mol Ther.2009 Feb;17(2):389-94;Geevarghese SK et al.,Phase I / II study of oncolytic herpes simplex virus NV1020 in patients with extensively pretreated refractory colorectal cancer metastatic to the liver.Hum Gene Ther.2010 Sep;21(9):1119-28;Kelly K et al.,Attenuated multimutated herpes simplex virus-1 effectively treats prostate carcinomas with neural invasion while preserving nerve function.FASEB J.2008 Jun;22(6):1839-48;Kemeny N et al.,Phase I,open-label,dose-escalating study of a genetically engineered herpes simplex virus,NV1020,in subjects with metastatic colorectal carcinoma to the liver.Hum Gene Ther.2006 Dec;17(12):1214-24;and Wong RJ et al.,Effective treatment of head and neck squamous cell carcinoma by an oncolytic herpes simplex virus.J Am Coll Surg.2001 Jul;193(1):12-21). .

[0011] Entry of HSV into target cells is a multi-step process, requiring complex interactions and conformational changes of the viral glycoproteins gD, gH / gL, gC and gB. These glycoproteins constitute the viral envelope, which is the outermost structure of the HSV particle and consists of a membrane. For cell entry, gC and gB mediate the initial attachment of the HSV particle to the cell surface heparan sulfate. A more specific interaction of the virus with the target cell then occurs in that gD binds to at least two alternative cellular receptors, nectin-1 (human: HveC) and HVEM (also known as HveA), triggering conformational changes in gD that initiate a cascade of events leading to virion-cell membrane fusion. This activates the intermediate proteins gH / gL (heterodimers), which trigger gB to catalyze membrane fusion.

[0012] Current technology has led to the development of genetically engineered o-HSVs that exhibit highly specific tropism for tumor cells that would not otherwise be attenuated, an approach defined as retargeting HSV tropism to tumor-specific receptors.

[0013] Retargeting of HSV to cancer-specific receptors requires genetic modification of gD such that it carries a heterologous sequence encoding a specific ligand. Upon infection with the recombinant virus, progeny viruses are formed that have a chimeric gD-ligand glycoprotein in their envelope instead of wild-type gD. The ligand interacts with a molecule specifically expressed on selected cells, allowing the entry of recombinant o-HSV into the selected cells. Examples of ligands that have been successfully used for retargeting HSV are single-chain antibodies against IL13α, uPaR, HER2, and EGFR.

[0014] Although retargeting entails that the recombinant virus is targeted to selected cells, retargeting does not prevent the recombinant virus from still being able to target its natural cell receptor, resulting in the infection and death of cells of the body. In order to prevent the herpes virus from binding to its natural receptor and killing normal cells of the body, attempts have been made to reduce the binding to the natural receptor. This is called "detargeting", which means that the recombinant herpes virus has a reduced or no binding ability to the natural receptor of the unmodified herpes virus, and the term "reduced" is used in comparison with the same herpes virus without such binding-reducing modifications. This has the effect that normal cells are not infected or are infected to a reduced extent, and therefore normal cells are not killed or fewer normal cells are killed. Such detargeted herpes viruses have reduced harmful activity by infecting fewer or no normal cells at all, and increased beneficial activity by killing diseased cells. Summary of the Invention

[0015] Although methods for retargeting HSV to disease-specific receptors are known in the art, these HSV with retargeting ability need to be propagated so that they can be produced in large quantities and can be used as medicines to treat diseases. Considering the fact that for safety reasons, the cells for the growth and production of HSV should not be diseased cells, in order to avoid the introduction of substances such as DNA, RNA and / or proteins of diseased cells such as tumor cells in humans, HSV needs to contain further modifications to allow HSV to infect "safe" cells that do not produce components that are harmful to humans for the growth and production of HSV.

[0016] The invention disclosed herein provides a system by which recombinant HSV can be safely propagated, detargeted from normal cells, and effectively retargeted to diseased (eg, tumor) cells.

[0017] Provided herein is a method of retargeting a recombinant herpes simplex virus (HSV) to a tumor cell expressing a TAA, the method comprising administering to a subject having tumor cells: (a) a recombinant HSV, the recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide; and (b) an isolated bispecific adapter protein, the bispecific adapter protein comprising a first binding domain having binding specificity for a heterologous ligand peptide expressed by the recombinant HSV and a second binding domain having binding specificity for a TAA expressed by the tumor cell, wherein the first binding domain of the bispecific adapter protein binds the heterologous ligand peptide expressed by the recombinant HSV and the second binding domain of the bispecific adapter protein binds the TAA expressed by the tumor cell, thereby retargeting the recombinant HSV to the tumor cell.

[0018] In one embodiment of this method, a nucleotide sequence encoding a heterologous ligand peptide is inserted into the recombinant HSV by insertion into, or replacement of, a portion of the nucleotide sequence encoding wild-type glycoprotein D (gD).

[0019] In a further embodiment of the method, a nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6-38 of wild-type glycoprotein D (gD).

[0020] In yet a further embodiment of the method, the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a heterologous peptide expressed by a recombinant HSV.

[0021] In yet a further embodiment of the method, the antigen-binding fragment that has binding specificity for a heterologous peptide is selected from the group consisting of a single chain variable domain (scFv), a single chain antibody VHH, and a polypeptide DARPin.

[0022] In yet a further embodiment of the method, the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a TAA expressed by a tumor cell.

[0023] In still further embodiments, the antigen-binding fragment that has binding specificity for a TAA is selected from the group consisting of an scFv, a single chain antibody VHH, a polypeptide DARPin.

[0024] In yet a further embodiment of the method, the heterologous ligand peptide expressed by the recombinant HSV comprises the GCN4 transcription factor, or a fragment thereof.

[0025] In yet a further embodiment of the method, the GCN4 transcription factor, or a fragment thereof, comprises the amino acid sequence of SEQ ID NO:4.

[0026] In yet a further embodiment of the method, the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a GCN4 transcription factor, or a fragment thereof.

[0027] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for the GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a heavy chain variable region (VH) consisting of HCDR1 (SEQ ID NO: 16), HCDR2 (SEQ ID NO: 17) and HCDR3 (SEQ ID NO: 18), and / or a light chain variable region (VL) consisting of LCDR1 (SEQ ID NO: 19), LCDR2 (SEQ ID NO: 20) and LCDR3 (SEQ ID NO: 21).

[0028] In yet further embodiments of the method, the antigen-binding fragment having binding specificity for GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:22, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:23.

[0029] In yet a further embodiment of the method, the heterologous ligand peptide expressed by the recombinant HSV comprises a La protein or a fragment thereof.

[0030] In yet a further embodiment of the method, the La protein or fragment thereof comprises the amino acid sequence of SEQ ID NO:12.

[0031] In yet a further embodiment of the method, the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a La protein, or a fragment thereof.

[0032] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for a La protein or a fragment thereof is an anti-La scFv comprising a VH consisting of HCDR1 (SEQ ID NO:26), HCDR2 (SEQ ID NO:27) and HCDR3 (SEQ ID NO:28), and / or a VL consisting of LCDR1 (SEQ ID NO:29), LCDR2 (SEQ ID NO:30) and LCDR3 (SEQ ID NO:31).

[0033] In still further embodiments of the method, the antigen-binding fragment that has binding specificity for a La protein or fragment thereof is an anti-La scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:32, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:33.

[0034] In yet a further embodiment of the method, the heterologous ligand peptide expressed by the recombinant HSV comprises a first leucine zipper portion and the first binding domain of the bispecific adapter protein comprises a second leucine zipper portion, and the first and second leucine zipper portions are capable of forming a leucine zipper dimer.

[0035] In yet a further embodiment of the method, the first leucine zipper moiety is the synthetic leucine zipper moiety RE (SEQ ID NO: 6) and the second leucine zipper moiety is the synthetic leucine zipper moiety ER (SEQ ID NO: 10), or the first leucine zipper moiety is the synthetic leucine zipper moiety ER (SEQ ID NO: 10) and the second leucine zipper moiety is the synthetic leucine zipper moiety RE (SEQ ID NO: 6).

[0036] In still further embodiments of the method, the TAA expressed by the tumor cell is selected from the group consisting of PSMA, TMEFF2, ROR1, KLK2, and HLA-G.

[0037] In yet a further embodiment of the method, the TAA expressed by the tumor cell is PSMA, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for PSMA.

[0038] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 35), HCDR2 (SEQ ID NO: 36) and HCDR3 (SEQ ID NO: 37).

[0039] In still further embodiments of the method, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH that comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:38.

[0040] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 39), HCDR2 (SEQ ID NO: 40) and HCDR3 (SEQ ID NO: 41).

[0041] In still further embodiments of the method, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH that comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:42.

[0042] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 43), HCDR2 (SEQ ID NO: 44) and HCDR3 (SEQ ID NO: 45), and / or a VL consisting of LCDR1 (SEQ ID NO: 46), LCDR2 (SEQ ID NO: 47) and LCDR3 (SEQ ID NO: 48).

[0043] In still further embodiments of the method, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:49, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:50.

[0044] In yet a further embodiment of the method, the TAA expressed by the tumor cell is TMEFF2, and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for TMEFF2.

[0045] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (sequence number 53), HCDR2 (sequence number 54) and HCDR3 (sequence number 55), and / or a VL consisting of LCDR1 (sequence number 56), LCDR2 (sequence number 57) and LCDR3 (sequence number 58).

[0046] In yet further embodiments of the method, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:59, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:60.

[0047] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (sequence number 61), HCDR2 (sequence number 62) and HCDR3 (sequence number 63), and / or a VL consisting of LCDR1 (sequence number 64), LCDR2 (sequence number 65) and LCDR3 (sequence number 66).

[0048] In yet further embodiments of the method, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:67, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:68.

[0049] In yet a further embodiment of the method, the TAA expressed by the tumor cell is KLK2 and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for KLK2.

[0050] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH consisting of HCDR1 (sequence number 72), HCDR2 (sequence number 73) and HCDR3 (sequence number 74), and / or a VL consisting of LCDR1 (sequence number 75), LCDR2 (sequence number 76) and LCDR3 (sequence number 77).

[0051] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:78, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:79.

[0052] In yet a further embodiment of the method, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 80, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 81.

[0053] In yet a further embodiment of the method, the TAA expressed by the tumor cell is HLA-G and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for HLA-G.

[0054] In yet a further embodiment of the method, the TAA expressed by the tumor cell is ROR1, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for ROR1.

[0055] In still further embodiments of the method, the antigen-binding fragment that has binding specificity for ROR1 is a polypeptide DARPin having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:86.

[0056] Further provided herein is a method of treating cancer in a subject, wherein a TAA is expressed by a cancer cell, the method comprising administering to the subject (a) a recombinant HSV, the recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide; and (b) an isolated bispecific adaptor protein, the bispecific adaptor protein comprising a first binding domain having binding specificity for a heterologous ligand peptide expressed by the recombinant HSV and a second binding domain having binding specificity for a TAA expressed by the cancer cell, wherein the first binding domain of the bispecific adaptor protein binds the heterologous ligand peptide expressed by the recombinant HSV and the second binding domain of the bispecific adaptor protein binds the TAA expressed by the cancer cell, thereby causing oncolysis of the cancer cell.

[0057] In one embodiment of this method of treatment, a nucleotide sequence encoding a heterologous ligand peptide is inserted into the recombinant HSV by insertion into, or replacement of, a portion of the nucleotide sequence encoding wild-type glycoprotein D (gD).

[0058] In a further embodiment of the method of treatment, a nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6-38 of wild-type gD.

[0059] Still further provided herein is a bispecific adapter protein for retargeting recombinant HSV to a tumor cell, the bispecific adapter protein comprising a first binding domain that has binding specificity for a heterologous ligand peptide expressed by the recombinant HSV, and a second binding domain that has binding specificity for a TAA expressed by the tumor cell.

[0060] In one embodiment of the bispecific adapter protein, each of the first and second binding domains of the bispecific adapter protein comprises an antigen-binding fragment.

[0061] In further embodiments of the bispecific adapter protein, the antigen-binding fragment is selected from the group consisting of an scFv, a single chain antibody VHH, and a polypeptide DARPin.

[0062] In still further embodiments of the bispecific adapter protein, the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a GCN4 transcription factor, or a fragment thereof.

[0063] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for GCN4 transcription factor, or a fragment thereof, is an anti-GCN4 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 16), HCDR2 (SEQ ID NO: 17) and HCDR3 (SEQ ID NO: 18), and / or a VL consisting of LCDR1 (SEQ ID NO: 19), LCDR2 (SEQ ID NO: 20) and LCDR3 (SEQ ID NO: 21).

[0064] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:22, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:23.

[0065] In still further embodiments of the bispecific adapter protein, a first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for a La protein, or a fragment thereof.

[0066] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for a La protein, or a fragment thereof, is an anti-La scFv comprising a VH consisting of HCDR1 (SEQ ID NO:26), HCDR2 (SEQ ID NO:27) and HCDR3 (SEQ ID NO:28), and / or a VL consisting of LCDR1 (SEQ ID NO:29), LCDR2 (SEQ ID NO:30) and LCDR3 (SEQ ID NO:31).

[0067] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for a La protein or a fragment thereof is an anti-La scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:32, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:33.

[0068] In still further embodiments of the bispecific adapter protein, the first binding domain of the bispecific adapter protein comprises a leucine zipper portion.

[0069] In still further embodiments of the bispecific adapter protein, the leucine zipper moiety is the synthetic leucine zipper moiety RE (SEQ ID NO: 6) or the synthetic leucine zipper moiety ER (SEQ ID NO: 10).

[0070] In still further embodiments of the bispecific adapter protein, the TAA expressed by the tumor cell is PSMA, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for PSMA.

[0071] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 35), HCDR2 (SEQ ID NO: 36) and HCDR3 (SEQ ID NO: 37).

[0072] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH that comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:38.

[0073] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 39), HCDR2 (SEQ ID NO: 40) and HCDR3 (SEQ ID NO: 41).

[0074] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH that comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:42.

[0075] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 43), HCDR2 (SEQ ID NO: 44) and HCDR3 (SEQ ID NO: 45), and / or a VL consisting of LCDR1 (SEQ ID NO: 46), LCDR2 (SEQ ID NO: 47) and LCDR3 (SEQ ID NO: 48).

[0076] In still further embodiments of the bispecific adaptor protein, the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:49, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:50.

[0077] In still further embodiments of the bispecific adaptor protein, the TAA expressed by the tumor cell is TMEFF2, and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for TMEFF2.

[0078] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 53), HCDR2 (SEQ ID NO: 54) and HCDR3 (SEQ ID NO: 55), and / or a VL consisting of LCDR1 (SEQ ID NO: 56), LCDR2 (SEQ ID NO: 57) and LCDR3 (SEQ ID NO: 58).

[0079] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:59, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:60.

[0080] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 61), HCDR2 (SEQ ID NO: 62) and HCDR3 (SEQ ID NO: 63), and / or a VL consisting of LCDR1 (SEQ ID NO: 64), LCDR2 (SEQ ID NO: 65) and LCDR3 (SEQ ID NO: 66).

[0081] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment that has binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:67, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:68.

[0082] In still further embodiments of the bispecific adapter protein, the TAA expressed by the tumor cell is KLK2 and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for KLK2.

[0083] In yet a further embodiment of the bispecific adapter protein, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 72), HCDR2 (SEQ ID NO: 73) and HCDR3 (SEQ ID NO: 74), and / or a VL consisting of LCDR1 (SEQ ID NO: 75), LCDR2 (SEQ ID NO: 76) and LCDR3 (SEQ ID NO: 77).

[0084] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:78, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:79.

[0085] In still further embodiments of the bispecific adapter protein, the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 80, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 81.

[0086] In still further embodiments of the bispecific adapter protein, the TAA expressed by the tumor cell is HLA-G and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for HLA-G.

[0087] In still further embodiments of the bispecific adaptor protein, the TAA expressed by the tumor cell is ROR1, and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for ROR1.

[0088] In still further embodiments of the bispecific adaptor protein, the antigen-binding fragment that has binding specificity for ROR1 is a polypeptide DARPin having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:86.

[0089] Still further provided herein is an isolated nucleic acid molecule comprising a polynucleotide sequence encoding the isolated bispecific adapter protein described above.

[0090] Still further provided herein is an isolated vector comprising the above-described isolated nucleic acid sequence.

[0091] Still further provided herein is a recombinant host cell comprising the above-described isolated vector.

[0092] Still further provided herein is a kit comprising the recombinant HSV described above and instructions for use of the recombinant HSV.

[0093] Still further provided herein is a kit comprising the isolated bispecific adapter protein described above and instructions for use of the bispecific adapter protein.

[0094] Still further provided herein is a kit comprising the recombinant HSV described above, the isolated adapter protein described above, and instructions for use.

[0095] Still further provided herein is a recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide, the heterologous ligand peptide comprising a La protein or a fragment thereof, wherein the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV by insertion into or replacement of a portion that replaces wild-type gD. In one embodiment, the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6-38 of wild-type gD. In a further embodiment, the La protein or fragment thereof comprises the amino acid sequence of SEQ ID NO: 12.

[0096] Still further provided herein is a recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide, the heterologous ligand peptide comprising a leucine zipper moiety, and the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV by insertion into or replacement of a portion of wild-type gD. In one embodiment, the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6-38 of wild-type gD. In a further embodiment, the leucine zipper moiety is the synthetic leucine zipper moiety RE (SEQ ID NO: 6) or the synthetic leucine zipper moiety ER (SEQ ID NO: 10). [Brief description of the drawings]

[0097] The above summary, as well as the following detailed description of preferred embodiments of the present application, will be better understood when read in conjunction with the appended drawings. It should be understood, however, that the present application is not limited to the precise embodiments shown in the drawings. [Figure 1] Due to its dual specificity, the bispecific adapter protein disclosed herein is shown to retarget recombinant HSV to tumor cells. [Diagram 2]

[0023] Figure 2 shows various embodiments of bispecific adapter proteins disclosed herein. Figure 2 discloses "(GGGGS)4" as SEQ ID NO: 15, and "GGGGS" as SEQ ID NO: 124. [Diagram 3] Figure 3 discloses SEQ ID NO:5, which shows the genomic structure of GCN4-retargeted recombinant HSV. [Figure 4] We show RE / ER-retargeted recombinant HSV, which is retargeted to tumor cells by a bispecific adapter protein. [Diagram 5] 5 shows the structures of RR12EE345L-(G4S)3-d6-38gD (ER / RE retargeted gD) and EE12RR345L-(G4S)3-hNectin1 (ER / RE-Nectin1) used for HSV1 retargeting using an ER / RE leucine zipper pair. ER / RE retargeted gD was obtained by replacing AA6-38 of gD with RR12EE345L-leucine zipper and (G4S)3 linker (SEQ ID NO: 126). ER / RE-Nectin1 was obtained by replacing the first Ig-like domain of hNectin1 (AA31-145 of UniProtKB-Q15223 (NECT1_HUMAN)) with EE12RR345L leucine zipper and (G4S)3 linker (SEQ ID NO: 126). FIG. 5 discloses SEQ ID NOs: 8 and 134, respectively, in order of appearance. [Figure 6] Infection of Vero-H6-nectin1 and B16-F10-H6-nectin1 cells with GCN4-retargeted viruses (MOI=1) is shown. Parental Vero and B16-F10 cells were used as negative controls for retargeting. GFP-expressing oHSV1 was used as a positive control for infection of Vero cells (left panel). [Figure 7A] Figure 1 shows the expression of PSMA-H6 bispecific adapter protein in the supernatant of transiently transfected HEK293T cells 48 hours after transfection. The bispecific adapter protein was detected with an anti-myc tag antibody. Supernatant from untransfected HEK293T cells was used as a negative control (mock). [Figure 7B]1 shows the expression of PSMA on the surface of HEK293T-PSMA stable cell lines analyzed by FACS. Parental HEK293T cells were used as a negative control. [Figure 7C] Infection of HEK293T-PSMA and LNCaP cells (PSMA+) with GCN4-retargeted virus (MOI=0.1) in the presence of PSMA-H6 bispecific adapter protein. Parental HEK293T and DU145 cells (PSMA-) were used as negative controls for retargeting. GFP-expressing oHSV1 was used as a positive control for infection (lower panel). [Figure 8A] Figure 1 shows the expression of TMEFF2-H6 bispecific adaptor protein in the supernatant of transiently transfected HEK293T cells 48 hours after transfection. The bispecific adaptor protein was detected with an anti-myc tag antibody. Supernatant from untransfected HEK293T cells was used as a control (mock). [Figure 8B] 1 shows the expression of TMEFF2 on the surface of Vero-TMEFF2 stable cell lines analyzed by FACS (before and after cell sorting for TMEFF2 expression). Parental Vero cells were used as a negative control. [Figure 8C] Infection of Vero-TMEFF2 and 22Rv1 cells (TMEFF2+) with GCN4-retargeted virus (MOI=0.1) in the presence of TMEFF2-H6 bispecific adapter protein is shown. Parental Vero was used as a negative control for retargeting. oHSV1 expressing GFP was used as a positive control for infection. 22Rv1 cells are shown at 24 and 72 hours post-infection to confirm growth of retargeted virus in the presence of bispecific adapter protein. [Figure 9A] Figure 1 shows the expression of KLK2-H6 bispecific adapter protein in the supernatant of transiently transfected HEK293T cells 48 hours after transfection. The bispecific adapter protein was detected with an anti-myc tag antibody. Supernatant from untransfected HEK293T cells was used as a negative control (mock). [Figure 9B] Figure 1 shows the expression of KLK2 on the surface of a Vero-KLK2-nectin1 stable cell line analyzed by FACS (before and after cell sorting for FLAG tag expression). Parental Vero cells were used as a control. [Figure 9C] Infection of Vero-KLK2-nectin1 cells with GCN4-retargeted virus (MOI=0.1) in the presence of KLK2-H6 bispecific adaptor protein. Parental Vero is used as a negative control for retargeting. GFP-expressing oHSV1 was used as a positive control for infection (lower panel). [Figure 10A] Figure 1 shows the expression of H6w-H6 bispecific adapter protein in the supernatant of transiently transfected HEK293T cells 48 hours after transfection. The bispecific adapter protein was detected with an anti-myc tag antibody. Supernatant of untransfected HEK293T cells was used as a negative control (mock). [Figure 10B] Expression of ROR1 on the surface of HEK293T cells analyzed by FACS is shown (solid line: isotype, light grey: anti-ROR1). [Figure 10C] Figure 1 shows infection of HEK293T cells with GCN4-retargeted virus (MOI=0.1) in the presence of H6w-H6 bispecific adapter protein. Parental 293T cells were used as a negative control for retargeting. GFP-expressing oHSV1 was used as a positive control for infection (upper panel). [Figure 11A]Retargeting of RR12EE345L-(G4S)3-d6-38gD to EE12RR345L-(G4S)3-nectin1, measured by in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion (Kondo et al. JBC 2010, Ishikawa et al. Protein Eng Des Sel 2012). Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and RR12EE345L-(G4S)3-d6-38gD and cDSP, while target cells (HEK293T) were transfected with EE12RR345L-(G4S)3-nectin1 and nDSP (lane 2). The negative control (lane 1) is identical to lane 2 except that the plasmid expressing EE12RR345L-(G4S)3-nectin1 was omitted. [Figure 11B] Figure 2 shows retargeting of RR12EE345L-(G4S)3-d6-38gD to PSMA using the B588LH-EE12RR345L bispecific adapter, measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB, and RR12EE345L-(G4S)3-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing PSMA, B588LH-EE12RR345L, and nDSP (lane 5). The positive control (lane 3) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB, and B588LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing PSMA and nDSP as target cells. The negative control (lane 4) is identical to lane 5, except that the plasmid expressing the bispecific adapter B588LH-EE12RR345L was omitted. [Figure 11C]Figure 1 shows retargeting of RR12EE345L-(G4S)3-d6-38gD to KLK2 using the KL2B359LH-EE12RR345L bispecific adaptor, measured by in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and RR12EE345L-(G4S)3-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing KLK2-nectin1, KL2B359LH-EE12RR345L and nDSP (lane 8). The positive control (lane 6) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB and KL2B359LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing KLK2-nectin1 and nDSP as target cells. The negative control (lane 7) is identical to lane 8, except that the plasmid expressing the bispecific adapter KL2B359LH-EE12RR345L was omitted. [Figure 11D]Figure 1 shows retargeting of RR12EE345L-(G4S)3-d6-38gD to TMEFF2 using the TMEF9LH-EE12RR345L bispecific adaptor, measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB, and RR12EE345L-(G4S)3-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing TMEFF2, TMEF9LH-EE12RR345L, and nDSP (lane 11). The positive control (lane 9) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB and TMEF9LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing TMEFF2 and nDSP as target cells. The negative control (lane 10) is identical to lane 11, except that the plasmid expressing the bispecific adaptor TMEF9LH-EE12RR345L was omitted. [Figure 12A] Retargeting of La-d6-38gD to 5B9HL-nectin1 measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion (Kondo et al. JBC 2010, Ishikawa et al. Protein Eng Des Sel 2012). Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and La-d6-38gD and cDSP, while target cells (HEK293T) were transfected with 5B9HL-nectin1 and nDSP (lane 2). The negative control (lane 1) is identical to lane 2, except that the plasmid expressing 5B9HL-nectin1 was omitted. [Figure 12B]Figure 1 shows retargeting of La-d6-38gD to PSMA using the B588LH-5B9HL bispecific adapter, measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and La-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing PSMA, B588LH-5B9HL and nDSP (lane 5). The positive control (lane 3) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB, and B588LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing PSMA and nDSP as target cells. The negative control (lane 4) is identical to lane 5, except that the plasmid expressing the bispecific adaptor B588LH-5B9HL was omitted. [Figure 12C] Figure 1 shows retargeting of La-d6-38gD to KLK2 using the KL2B359LH-5B9HL bispecific adapter, measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and La-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing KLK2-nectin1, KL2B359LH-5B9HL and nDSP (lane 8). The positive control (lane 6) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB and KL2B359LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing KLK2-nectin1 and nDSP as target cells. The negative control (lane 7) is identical to lane 8, except that the plasmid expressing the bispecific adaptor KL2B359LH-5B9HL was omitted. [Figure 12D] Figure 1 shows retargeting of La-d6-38gD to TMEFF2 using the TMEF9LH-5B9HL bispecific adapter, measured by an in vitro fusion assay using a dual split reporter protein system, where luciferase reporter activity is a measure of cell-cell fusion. Effector cells (HEK293T) were transfected with plasmids expressing HSV1 gH, gL, gB and La-d6-38gD and cDSP. Target cells (HEK293T) were transfected with plasmids expressing TMEFF2, TMEF9LH-5B9HL and nDSP (lane 11). The positive control (lane 9) used HEK293T cells transfected with plasmids expressing HSV1 gH, gL, gB and TMEF9LH-d6-38gD and cDSP as effector cells, and HEK293T cells transfected with plasmids expressing TMEFF2 and nDSP as target cells. The negative control (lane 10) is identical to lane 11, except that the plasmid expressing the bispecific adaptor TMEF9LH-5B9HL was omitted. Detailed Description of the Invention

[0098] Various publications, articles and patents are cited or described in the "Background" and throughout the specification, and each of these references is incorporated herein by reference in its entirety. The discussion of documents, operations, materials, devices, articles and the like which is included in the specification is for the purpose of providing a context for the present invention. Such discussion is not an admission that any or all of these items constitute part of the prior art to any invention disclosed or claimed.

[0099] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Unless otherwise defined, certain terms used herein have the meanings set forth herein.

[0100] It should be noted that as used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly indicates otherwise.

[0101] Unless otherwise stated, any numerical values, such as concentrations or concentration ranges, described herein should be understood in all cases as being modified by the term "about." Thus, numerical values ​​typically include ±10% of the described value. For example, a concentration of 1 mg / mL includes 0.9 mg / mL to 1.1 mg / mL. Similarly, a concentration range of 1% to 10% (w / v) includes 0.9% (w / v) to 11% (w / v). As used herein, the use of numerical ranges expressly includes all possible subranges, all individual numerical values ​​within the range, including integers and fractions of values ​​within the range, unless the context clearly indicates otherwise.

[0102] Unless otherwise indicated, the term "at least" preceding a series of elements should be understood to refer to every element in the series. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific embodiments of the invention described herein. Such equivalents are intended to be encompassed by the present invention.

[0103] As used herein, it will be understood that the terms "comprises," "comprising," "includes," "including," "has," "having," "contains," or "containing," or any other variation thereof, are intended to include a stated integer or group of integers, but not to exclude other integers or groups of integers, and are intended to be non-exclusive or non-limiting. For example, a composition, mixture, process, method, article, or device that includes a list of elements is not necessarily limited to only those elements, but may include other elements not expressly listed or not inherently present in such composition, mixture, process, method, article, or device. Further, unless expressly stated to the contrary, "or" refers to an inclusive "or" and not an exclusive "or." For example, condition A or B is satisfied by one of the following: A is true (or exists) and B is false (or does not exist), A is false (or does not exist) and B is true (or exists), and both A and B are true (or exist).

[0104] As used herein, the connective term "and / or" between multiple listed elements is understood to encompass both individual and combined options. For example, when two elements are connected by "and / or", the first option refers to the first element being applicable without the second element. The second option refers to the second element being applicable without the first element. The third option refers to the first and second elements being applicable together. Any one of these options is understood to be included within the meaning and thus meets the requirements of the term "and / or" as used herein. The simultaneous applicability of two or more of the options is also understood to be included within the meaning and thus meets the requirements of the term "and / or".

[0105] As used herein, the term "consists of," or variations such as "consist of" or "consisting of," as used throughout the specification and claims, includes any recited integer or group of integers, but indicates that no additional integer or group of integers is added to the specified method, structure, or composition.

[0106] As used herein, the term "consists essentially of," or variations such as "consist essentially of" or "consisting essentially of," as used throughout the specification and claims, refers to the inclusion of any recited integer or group of integers, optionally including any recited integer or group of integers that do not materially change the basic or novel characteristics of the specified method, structure, or composition. See MPEP §2111.03.

[0107] As used herein, "subject" refers to any animal, preferably a mammal, most preferably a human. As used herein, the term "mammal" includes any mammal. Examples of mammals include, but are not limited to, cows, horses, sheep, pigs, cats, dogs, mice, rats, rabbits, guinea pigs, monkeys, humans, etc., more preferably humans.

[0108] The words "right", "left", "lower" and "upper" designate directions in the drawings to which reference is made.

[0109] It should also be understood that terms such as "about," "approximately," "generally," and "substantially," used herein when referring to dimensions or features of preferred inventive components, indicate that the described dimensions / features are not precise boundaries or parameters, but do not exclude minor variations therefrom that are functionally the same or similar, as would be understood by one of ordinary skill in the art. At a minimum, such references involving numerical parameters will include variations that do not change the least significant digit using mathematical and industrial principles accepted in the art (e.g., rounding, measurement or other systematic errors, manufacturing tolerances, etc.).

[0110] The term "identical" or percent "identity" in the context of two or more nucleic acid or polypeptide sequences (e.g., chimeric antigen receptors (CARs) and isolated polynucleotides encoding them; isolated monoclonal or bispecific antibodies and antigen-binding fragments thereof, and nucleic acids encoding them) refers to two or more sequences or subsequences that are the same or have a certain percentage of amino acid residues or nucleotides that are the same when compared and aligned for maximum correspondence, as measured using one of the following sequence comparison algorithms or by visual inspection.

[0111] For sequence comparison, typically one sequence serves as a reference sequence to which test sequence is compared.When using sequence comparison algorithm, test and reference sequences are input into computer, subsequence coordinates are designated as necessary, and sequence algorithm program parameters are designated.Then, sequence comparison algorithm calculates the percent sequence identity of test sequence to reference sequence based on designated program parameters.

[0112] Optimal alignment of sequences for comparison can be determined, for example, by the local homology algorithm of Smith & Waterman, Adv. Appl. Math. 2:482 (1981), the homology alignment algorithm of Needleman & Wunsch, J. Mol. Biol. 48:443 (1970), the similarity search method of Pearson & Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444 (1988), computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by visual inspection (see generally Current Protocols in Molecular Biology, FMAusubel et al. eds. and Current Protocols, a joint venture between Greene Publishing Associates, Inc. and John Wiley & Sons, Inc., (1995 This can be done by the method of the Supplement (Ausubel).

[0113] Examples of suitable algorithms for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms described in Altschul et al., (1990) J. Mol. Biol. 215:403-410 and Altschul et al., (1997) Nucleic Acids Res. 25:3389-3402, respectively. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information. This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence that either match when aligned with words of the same length in database sequences or meet some positive threshold score T. T is referred to as the neighborhood word score threshold (Altschul et al., supra). These initial neighborhood word hits act as seeds to initiate searches to find longer HSPs that contain them. The word hits are then extended in both directions along each sequence for as far as the cumulative alignment score can be increased.

[0114] For nucleotide sequences, the parameters M (reward score for a pair of matching residues, always >0) and N (penalty score for mismatching residues, always <0) are used to calculate the cumulative score. For amino acid sequences, a scoring matrix is ​​used to calculate the cumulative score. Extension of the word hits in each direction is stopped when the cumulative alignment score falls off its maximum achieved value by an amount X, when the accumulation of one or more alignments of negative scoring residues causes the cumulative score to fall below zero, or when the end of either sequence is reached. The BLAST algorithm parameters W, T, and X determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults wordlength (W)=11, expectation (E)=10, M=5, N=-4, and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength (W) of 3, an expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)).

[0115] In addition to calculating the percent sequence identity, the BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Karlin & Altschul, Proc. Nat'l. Acad. Sci. USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the minimum sum probability (P(N)), which provides an indication of the probability that a match between two nucleotide sequences or two amino acid sequences would occur by chance. For example, a nucleic acid is considered to be similar to a reference sequence if the minimum sum probability in the comparison of the test nucleic acid to the reference nucleic acid is less than about 0.1, more preferably less than about 0.01, and most preferably less than about 0.001.

[0116] A further indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross-reactive with the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, e.g., the two peptides differ only by conservative substitutions. Another indication that two nucleic acid sequences are substantially identical is that the two molecules hybridize to each other under stringent conditions.

[0117] As used herein, the term "isolated" means that a biological component (e.g., a nucleic acid, a peptide, or a protein) has been substantially separated from, produced separately from, or purified from other biological components of the organism in which it naturally occurs (i.e., other chromosomal and extrachromosomal DNA and RNA, and proteins). Thus, "isolated" nucleic acids, peptides, and proteins include nucleic acids and proteins purified by standard purification methods. "Isolated" nucleic acids, peptides, and proteins can be part of a composition and are isolated even if the composition is not part of the original environment of the nucleic acid, peptide, or protein. The term also encompasses nucleic acids, peptides, and proteins prepared by recombinant expression in a host cell, as well as chemically synthesized nucleic acids.

[0118] As used herein, the term "polynucleotide" is also referred to interchangeably as "nucleic acid molecule," "nucleotide," or "nucleic acid," and refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA or modified RNA or DNA. "Polynucleotide" includes, but is not limited to, single-stranded and double-stranded DNA, DNA that is a mixture of single-stranded and double-stranded regions, single-stranded and double-stranded RNA, and RNA that is a mixture of single-stranded and double-stranded regions, hybrid molecules containing DNA and RNA that may be single-stranded or, more typically, double-stranded or a mixture of single-stranded and double-stranded regions. In addition, "polynucleotide" refers to triple-stranded regions that include RNA or DNA or both RNA and DNA. The term polynucleotide also includes DNA or RNA that contain one or more modified bases, and DNA or RNA with backbones modified for stability or other reasons. "Modified" bases include, for example, tritylated bases and unusual bases, such as inosine. A variety of modifications can be made to DNA and RNA. Thus, "polynucleotide" includes chemically, enzymatically, or metabolically modified forms of polynucleotides typically found in nature, as well as chemical forms having characteristics of viral and cellular DNA and RNA. "Polynucleotide" also includes relatively short nucleic acid strands, often referred to as oligonucleotides.

[0119] The term "vector" refers to a polynucleotide that can be replicated within a biological system or can be moved between such systems. Vector polynucleotides typically contain elements such as an origin of replication, a polyadenylation signal, or a selection marker that function to facilitate the replication or maintenance of these polynucleotides in a biological system. Examples of such biological systems can include cells, viruses, animals, plants, and reconstituted biological systems that utilize biological components capable of replicating the vector. Vector polynucleotides can be DNA or RNA molecules or hybrids thereof. Exemplary vectors include, but are not limited to, plasmids, cosmids, phage vectors, and viral vectors. The term "expression vector" refers to a vector that can be utilized in a biological system or reconstituted biological system to direct the translation of a polypeptide encoded by a polynucleotide sequence present in the expression vector.

[0120] As used herein, the term "host cell" refers to a cell that contains a nucleic acid molecule of the invention. A "host cell" can be any type of cell, for example, a primary cell, a cell in culture, or a cell from a cell line. In one embodiment, a "host cell" is a cell that has been transfected or transduced with a nucleic acid molecule of the invention. In another embodiment, a "host cell" is the progeny or potential progeny of such a transfected or transduced cell. The progeny of a cell may not have the same identity as the parent cell, for example, due to mutations or environmental influences that may occur in subsequent generations, or due to integration of the nucleic acid molecule into the host cell genome.

[0121] As used herein, the term "expression" refers to the biosynthesis of a gene product. The term includes transcription of a gene into RNA. The term also includes translation of RNA into one or more polypeptides, and further includes all naturally occurring post-transcriptional and post-translational modifications.

[0122] "Heterologous," as used herein, refers to a nucleotide sequence or polypeptide sequence that is not found in the native nucleic acid or protein, respectively, of a given organism. For example, in the context of the recombinant HSV of the present disclosure, a nucleic acid that includes a nucleotide sequence encoding a "heterologous" GCN4 transcription factor or fragment thereof is a nucleic acid that is not naturally found in HSV, i.e., the encoded GCN4 transcription factor or fragment thereof is not encoded by naturally occurring HSV.

[0123] "Antigen-binding fragment" or "antigen-binding domain" refers to a portion of a protein that binds an antigen, e.g., an antibody or an epitope-binding peptide. Antigen-binding fragments may be synthetic, enzymatically obtainable, or genetically engineered polypeptides, including portions of immunoglobulins that bind antigen, such as VH, VL, VH and VL, Fab, Fab', F(ab')2, Fd and Fv fragments, domain antibodies (dAbs) consisting of one VH domain or one VL domain, shark variable IgNAR domains, camelized VH domains, VHH domains, minimal recognition units consisting of amino acid residues mimicking the CDRs of an antibody, such as the FR3-CDR3-FR4 portion, HCDR1, HCDR2, and / or HCDR3, and LCDR1, LCDR2, and / or LCDR3, alternative scaffolds that bind antigen, and multispecific proteins that contain antigen-binding fragments. Antigen-binding fragments (such as VH and VL) can be linked together via synthetic linkers to form various types of single-chain antibody designs, where the VH / VL domains can pair intramolecularly or intermolecularly to form monovalent antigen-binding domains, such as single chain Fvs (scFvs) or diabodies, when the VH and VL domains are expressed as separate single chains. Antigen-binding fragments can also be conjugated to other antibodies, proteins, antigen-binding fragments, or alternative scaffolds, which may be monospecific or multispecific, to engineer bispecific and multispecific proteins. Exemplary antigen-binding fragments also include engineered antibody-mimetic proteins, such as DARPins.

[0124] Recombinant (retargeted) herpes simplex virus (HSV) Herpes simplex virus (HSV) is one of many human and animal viruses that have been modified or adapted for oncolytic purposes. Several unique properties of HSV make it an attractive candidate as an oncolytic agent. First, lytic infection by HSV usually kills target cells much more rapidly than infection by other DNA viruses. Rapid replication and spread among target cells is a key property that allows the virus to exert its full oncolytic potential in vivo, because the body's immune mechanisms are more likely to limit the spread of slower-growing viruses. Second, HSV has a broad tropism, and oncolytic viruses derived from it can be therapeutically applied to many different types of tumors. In principle, this property should prevent the rapid development of resistance to virotherapy using HSV, as opposed to other oncolytic viruses (e.g., those derived from adenoviruses). Finally, effective anti-HSV drugs, such as acyclovir and famciclovir, are readily available as a safety measure in case of unwanted infection or toxicity from the virus.

[0125] The terms "herpes simplex virus (HSV)" and "oncolytic herpes simplex virus (oHSV)" are used interchangeably herein. HSV as used herein is capable of selectively replicating within tumor cells, resulting in their destruction and the production of progeny virions that can spread to neighboring tumor cells. Both serotypes of HSV, HSV-1 and HSV-2, can be used herein. In one embodiment, the HSV as used herein is HSV-1. In further embodiments, the HSV as used herein is HSV1716 (also known as Seprehvir), G207, G47Delta, Talimogene laherparepvec (also known as OncoVex GM-CSF), NV1020, NV1023, NV1034, NV1042, rQNestin34.5, RP1, RP2, RP3, ONCR-148, ONCR-177, ONCR-152, ONCR-153, VG161, and other known HSVs, including those disclosed and taught in WO / 2013 / 036795 (BeneVir Pharm, Inc.).

[0126] Glycoprotein D (gD) is a 55 kDa virion envelope glycoprotein that is essential for HSV entry into host cells and plays an essential role in herpesvirus infectivity. Upon HSV entry into a cell, the interaction of gD with the heterodimer gH / gL is a key event in an activation cascade involving the four glycoproteins gD, gH, gL and gB involved in HSV entry into cells. The activation cascade begins with gD binding to one of its receptors, nectin-1, HVEM and modified heparan sulfate, which is transmitted to gH / gL and finally to gB. gB performs the fusion of HSV with the target cell membrane. The heterodimer gH / gL interacts with the profusion domain of gD, which is removed upon interaction of gD with one of its receptors during cell entry. gD contains several specific regions that are responsible for targeting HSV to its natural receptors (e.g., nectin-1 and HVEM).

[0127] Disclosed herein is a recombinant HSV in which the nucleotide sequences encoding all or part of the HVEM binding site and all or part of the Nectin-1 binding site have been deleted.

[0128] In one embodiment, the recombinant HSV has the nucleotide sequences encoding all or part of the HVEM binding site and all or part of the Nectin-1 binding site deleted and replaced by a heterologous nucleotide sequence encoding a ligand peptide.

[0129] The full sequence of gD with its signal peptide (underlined) is as follows: MGGTAARLGAVILFVVIVGLHGVRGKYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQPSSHQPLFY (SEQ ID NO: 1)

[0130] The mature protein of gD is as follows: KYALADASLKMADPNRFRGKDLPVLDQLTDPPGVRRVYHIQAGLPDPFQPPSLPITVYYAVLERACRSVLLNAPSEAPQIVRGASEDVRKQPYNLTIAWFRMGGNCAIPITVMEYTECSYNKSLGACPIRTQPRWNYYDSFSAVSEDNLGFLMHAPAFETAGTYLRLVKINDWTEITQFILEHRAKGSKYALPLRIPPSACLSPQAYQQGVTVDSIGMLPRFIPENQRTVAVYSLKIAGWHGPKAPYTSTLLPELSETPNATQPELAPEDPEDSALLEDPVGTVAPQIPPNWHIPSIQDAATPYHPPATPNNMGLIAGAVGGSLLAALVICGIVYWMHRRTRKAPKRIRLPHIREDDQPSSHQPLFY (SEQ ID NO: 2)

[0131] In one embodiment, the recombinant HSV is derived from an oncolytic HSV in which the nucleotide sequence encoding amino acids 6-38 of wild-type gD (DASLKMADPNRFRGKDLPVLDQLTDPPGVRRVY (SEQ ID NO: 3)) is deleted.

[0132] In one embodiment, the recombinant HSV is derived from an oncolytic HSV in which the nucleotide sequence encoding amino acids 6 to 38 of wild-type gD (SEQ ID NO: 3) has been deleted and replaced by a nucleotide sequence encoding a heterologous ligand peptide having a length of 5 to 150 amino acids, or 5 to 120 amino acids, or 5 to 100 amino acids, or 5 to 80 amino acids, or 5 to 60 amino acids, or 5 to 50 amino acids, or 5 to 45 amino acids, or 5 to 40 amino acids, or 10 to 40 amino acids, or 10 to 35 amino acids.

[0133] In one embodiment, the recombinant HSV disclosed herein is a GCN4-retargeted recombinant HSV, and the heterologous ligand peptide is a GCN4 transcription factor or a fragment or epitope thereof. In such a GCN4-retargeted recombinant HSV, the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) is deleted and replaced by a heterologous nucleotide sequence encoding a peptide sequence comprising a GCN4 transcription factor or a fragment or epitope thereof. In one aspect, the heterologous nucleotide sequence encodes a peptide sequence comprising a GCN4 epitope (KNYHLENEVARLKKLV, SEQ ID NO: 4). In another aspect, the heterologous nucleotide sequence encodes a peptide sequence comprising a GCN4-derived peptide (TSGSKNYHLENEVARLKKLVGSGGGGSGNS, SEQ ID NO: 5) consisting of the GCN4 epitope (SEQ ID NO: 4) adjacent to a linker.

[0134] In one embodiment, the recombinant HSV disclosed herein is a leucine zipper retargeted recombinant HSV, and the heterologous ligand peptide is a leucine zipper moiety. In such a leucine zipper retargeted recombinant HSV, the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) is deleted and replaced by a heterologous nucleotide sequence encoding a peptide sequence comprising a leucine zipper moiety (such as those disclosed in Moll JR et al., Designed heterodimerizing leucine zippers with a range of pI and stabilities up to 10(-15) M. Protein Sci. 2001 Mar;10(3):649-55) or a fragment thereof. In one aspect, the recombinant HSV disclosed herein has the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) deleted and replaced with a nucleotide sequence encoding a peptide sequence comprising a synthetic leucine zipper moiety RE (LEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGPL, SEQ ID NO: 6; CTGGAAATCAGAGCCGCTTTCCTGAGACAGCGGAACACCGCCCTGCGGACCGAGGTGGCCGAGCTGGAACAGGAGGTGCAGAGACTGGAAAACGAGGTGTCCCAATACGAGACAAGATACGGCCCTCTG, SEQ ID NO: 7).In a further embodiment, the recombinant HSV disclosed herein has a deletion of the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO:3) and replaced with a nucleotide sequence encoding a peptide sequence comprising a RE-derived peptide (GTLEIRAAFLRQRNTALRTEVAELEQEVQRLENEVSQYETRYGPLGGGGSGGGGSGGGGSGNS, SEQ ID NO:8; GGTACCCTGGAAATCAGAGCCGCTTTCCTGAGACAGCGGAACACCGCCCTGCGGACCGAGGTGGCCGAGCTGGAACAGGAGGTGCAGAGACTGGAAAACGAGGTGTCCCAATACGAGACAAGATACGGCCCTCTGGGCGGCGGCGGAAGCGGCGGAGGCGGCAGCGGCGGCGGCGGATCTGGGAATTCT, SEQ ID NO:9). The RE-derived peptide is comprised of a synthetic leucine zipper moiety RE (SEQ ID NO:6) flanked by a linker. In yet a further aspect, the recombinant HSV disclosed herein has the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) deleted and replaced by a nucleotide sequence encoding a peptide sequence comprising the synthetic leucine zipper moiety ER (LEIEAAFLERENTALETRVAELRQRVQRLRNRVSQYRTRYGPL, SEQ ID NO: 10; CTGGAAATCGAGGCCGCCTTCCTGGAACGGGAAAACACCGCCCTGGAGACAAGAGTCGCCGAGCTGAGACAGCGGGTGCAGAGACTGCGGAATAGAGTGTCCCAATACCGCACCAGATACGGCCCTCTG, SEQ ID NO: 11). In yet a further aspect, the recombinant HSV disclosed herein has the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) deleted and replaced by a nucleotide sequence encoding a peptide sequence comprising an ER-derived peptide comprised of the synthetic leucine zipper moiety ER (SEQ ID NO: 10) adjacent to a linker.

[0135] In one embodiment, the recombinant HSV disclosed herein is a La-retargeted recombinant HSV, and the heterologous ligand peptide is a La protein or a fragment or epitope thereof. In such a La-retargeted recombinant HSV, the nucleic acid sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) is deleted and replaced by a heterologous nucleotide sequence encoding a peptide sequence comprising the nuclear autoantigen La protein or a fragment or epitope thereof (Kohsaka et al, Fine epitope mapping of the human SS-B / La protein. Identification of a distinct autoepitope homologous to a viral gag polyprotein, J Clin Invest. 1990 May; 85(5): 1566-74). In one aspect, the recombinant HSV disclosed herein has a deletion of the nucleotide sequence encoding amino acids 6-38 of wild-type gD (SEQ ID NO: 3) and replaced by a heterologous nucleotide sequence encoding a peptide sequence comprising the La epitope (SKPLPEVTDEY, SEQ ID NO: 12) (see, e.g., Koristka, S et al, Retargeting of Regulatory T Cells to Surface-inducible Autoantigen La / SS-B, Journal of Autoimmunity 42 (2013) 105-116). In a further aspect, the recombinant HSV disclosed herein has the nucleotide sequence encoding amino acids 6 to 38 of wild-type gD (SEQ ID NO: 3) deleted and replaced with a nucleotide sequence encoding a peptide sequence comprising a La-derived peptide (GTGSKPLPEVTDEYGGGGSGNS, SEQ ID NO: 13; ACCGGCAGCAAGCCCCTGCCCGAGGTGACCGACGAGTACGGCGGCGGCGGCTCCGGGAATTCT, SEQ ID NO: 14) comprised of the La epitope (SEQ ID NO: 12) flanked by linkers.

[0136] Through such modifications, recombinant HSV can be detargeted from normal cells and, in combination with the bispecific adapter proteins disclosed below, retargeted to diseased cells (eg, tumor cells).

[0137] Specifically, in order for the recombinant HSV disclosed herein to be efficiently retargeted to cells present in cell culture and possibly diseased cells, it is advantageous to inactivate the binding sites of the recombinant HSV to the natural receptors of gD present on normal cells. This allows efficient targeting to cells intended to be infected, while reducing infection of normal cells naturally infected by herpesviruses. gD is essential for virus entry into host cells and plays an essential role in herpesvirus infectivity. Inactivation of the binding sites of gD to their natural receptors favors retargeting to cells bearing the ligand's target molecule. According to the present disclosure, by deleting the nucleotide sequence encoding amino acids 6-38 of gD (SEQ ID NO: 3), both the natural HVEM binding site (amino acids 6-34 of gD (SEQ ID NO: 3)) and the natural nectin-1 binding site (amino acids 35-39 of gD (SEQ ID NO: 3)) of the recombinant HSV are inactivated, resulting in reduced binding to cells bearing these receptors. This results in efficient detargeting of the recombinant HSV from the natural receptor for gD and therefore detargeting of the recombinant HSV of the present disclosure from normal cells.

[0138] Additionally, recombinant HSV can also be bound to bispecific adapter proteins (as described below) and, in combination with bispecific adapter proteins, can be used as effective therapeutic agents in treating diseases such as cancer, an embodiment of which is described in more detail below.

[0139] Moreover, the recombinant HSV disclosed herein can be propagated safely. Suitable techniques and conditions for growing HSV are well known in the art (Florence et al., 1992; Peterson and Goyal, 1988) and include incubating HSV with cells and recovering HSV from the medium of infected cell cultures.

[0140] "Cultured" cells are cells that are present in an in vitro cell culture that are maintained and propagated, as known in the art. Cultured cells are grown under controlled conditions, generally outside their natural environment. Usually, cultured cells are derived from multicellular eukaryotes, particularly animal cells. "Approved cell line for growth of HSV" is meant to include any cell line that has already been shown to be capable of being infected by HSV (i.e., that the virus can enter the cell, propagate, and produce virus). A cell line is a population of cells that are derived from a single cell and contain the same genetic makeup. In one embodiment, the cells for the growth and production of recombinant herpesvirus are Vero, 293, 293T, HEp-2, HeLa, BHK, MRC5, or RS cells.

[0141] According to the present disclosure, the cell line for growth and production is modified to carry a target molecule capable of binding to the recombinant HSV disclosed herein. For example, in the case of a recombinant HSV having a nucleotide sequence encoding all or part of the HVEM binding site and all or part of the Nectin-1 binding site deleted, the cell line for growth and production can be modified to carry a target molecule (e.g., an antigen-binding fragment) having binding specificity for the recombinant HSV. In a particular embodiment, the cell line can be modified to carry an antigen-binding fragment having binding specificity for truncated gD on the recombinant HSV. Alternatively, for a recombinant HSV in which the nucleotide sequence encoding all or part of the HVEM binding site and all or part of the Nectin-1 binding site has been deleted and replaced by a heterologous nucleotide sequence encoding a ligand peptide, the cell line for growth and production can be modified to carry a target molecule (e.g., an antigen-binding fragment) having binding specificity for the ligand peptide.

[0142] In one embodiment, the cell line carries a target molecule capable of binding the GCN4 transcription factor or a fragment thereof, or an epitope thereof, and can be used to propagate the GCN4 retargeted recombinant HSV. In one embodiment, the cell line carries a target molecule that is an antigen-binding fragment or domain capable of binding the GCN4 transcription factor or a fragment thereof, or an epitope thereof. In one embodiment, the cell line used herein carries a target molecule that is an antigen-binding fragment capable of binding the GCN4 epitope identified by SEQ ID NO:4, or a peptide derived from the GCN4 epitope identified by SEQ ID NO:5. In one aspect, the cell line is a Vero cell line modified to express the GCN4 transcription factor or a fragment thereof, or an antigen-binding fragment capable of binding the epitope thereof. In another aspect, the Vero cell line is modified to express an antigen-binding fragment capable of binding the GCN4 epitope identified by SEQ ID NO:4, or a peptide derived from the GCN4 epitope identified by SEQ ID NO:5.

[0143] In one embodiment, the cell line harbors a target molecule capable of binding a leucine zipper moiety encoded by the recombinant HSV and can be used to propagate the leucine zipper retargeted recombinant HSV. In one aspect, the cell line harbors a target molecule that is a synthetic leucine zipper moiety ER (SEQ ID NO: 10) or a fragment thereof capable of binding the leucine zipper moiety RE (SEQ ID NO: 6). In a further aspect, the cell line is a Vero cell line modified to express a peptide comprising a leucine zipper moiety ER (SEQ ID NO: 10) or a fragment thereof capable of binding the leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof. In a still further aspect, the cell line harbors a target molecule that is a synthetic leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof capable of binding the leucine zipper moiety ER (SEQ ID NO: 10). In a still further aspect, the cell line is a Vero cell line modified to express a peptide comprising a leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof capable of binding the leucine zipper moiety ER (SEQ ID NO: 10).

[0144] In one embodiment, the cell line carries a target molecule capable of binding the La protein or a fragment or epitope thereof and can be used to propagate La retargeted recombinant HSV. In one embodiment, the cell line carries a target molecule that is an antigen-binding fragment capable of binding the La protein or a fragment or epitope thereof. In one embodiment, the cell line used herein carries a target molecule that is an antigen-binding fragment capable of binding the La epitope identified by SEQ ID NO: 12 or a peptide derived from the La protein identified by SEQ ID NO: 13. In one aspect, the cell line is a Vero cell line modified to express the La protein or a fragment thereof or an antigen-binding fragment capable of binding the epitope thereof. In another aspect, the Vero cell line is modified to express an antigen-binding fragment capable of binding the La protein identified by SEQ ID NO: 12 or a peptide derived from the La protein identified by SEQ ID NO: 13.

[0145] Bispecific Adaptor Proteins Further disclosed herein is an isolated bispecific adapter protein engineered to contain a first binding domain that specifically binds a ligand peptide encoded by a heterologous nucleotide sequence of recombinant HSV (as described above), and a second binding domain that specifically binds a target, such as a tumor-associated antigen (TAA) or a human TAA.

[0146] As disclosed herein, a bispecific adapter protein can comprise a first binding domain and a second binding domain linked by a peptide linker. Also, within the scope of this disclosure, a bispecific adapter protein can comprise a first and a second binding domain conjugated via an intermolecular bond, such as a disulfide bond.

[0147] In one embodiment, the ligand peptide is a GCN4 transcription factor or a fragment thereof, or an epitope thereof. The first binding domain of the bispecific adaptor protein specifically binds a GCN4 transcription factor or a fragment thereof, or an epitope of GCN4, or an epitope of GCN4 identified by SEQ ID NO:4, or an epitope of GCN4 adjacent to the linker identified by SEQ ID NO:5.

[0148] In one embodiment, the ligand peptide is a leucine zipper moiety or a fragment thereof, and the first binding domain of the bispecific adaptor protein comprises a paired leucine zipper moiety that specifically binds the ligand peptide. In one aspect, the first binding domain of the bispecific adaptor protein specifically binds the leucine zipper moiety RE or a fragment thereof, or an epitope of the leucine zipper moiety RE, or the leucine zipper moiety RE identified by SEQ ID NO:6, or the leucine zipper moiety RE adjacent to a linker identified by SEQ ID NO:8. In yet another embodiment, the first binding domain of the bispecific adaptor protein specifically binds the leucine zipper moiety ER or a fragment thereof, or an epitope of the leucine zipper moiety ER, or the leucine zipper moiety ER identified by SEQ ID NO:10, or the leucine zipper moiety ER adjacent to a linker.

[0149] In one embodiment, the ligand peptide is an La protein or a fragment thereof, or an epitope thereof. The first binding domain of the bispecific adaptor protein specifically binds an La protein or a fragment thereof, or an epitope of La, or an epitope of La identified by SEQ ID NO: 12, or an epitope of La adjacent to the linker identified by SEQ ID NO: 13.

[0150] As used herein, a binding domain that "specifically binds a ligand peptide or a fragment thereof, or an epitope thereof" is defined as a binding domain having a molecular weight of 1×10 -7 M or less, or 1 x 10 -8 M or less, or 5 x 10 -9 M or less, or 1 x 10 -9 M or less, or 5 x 10 -10 M or less, or 1 x 10 -10It refers to an antigen-binding domain that binds a ligand peptide or a fragment thereof, or an epitope thereof, with a KD of less than or equal to M. The term "KD" refers to the dissociation constant, which is obtained from the ratio of Kd to Ka (i.e., Kd / Ka) and is expressed as a molar concentration (M). The KD value of an antibody can be determined using methods in the art in light of the present disclosure. For example, the KD of an antibody can be determined by using surface plasmon resonance, such as by using a biosensor system, such as a Biacore® system, or by using biolayer interferometry technology, such as an Octet RED96 system. The smaller the KD value, the higher the affinity and binding specificity.

[0151] As used herein, the term "tumor associated antigen (TAA)" refers to any antigen that can be expressed and recognized by an antibody that can bind to the TAA. Examples of TAAs include prostate specific membrane antigen (PSMA), TMEFF2, ROR1, KLK2, HLA-G, CD70, PD-1, PD-L1, CTLA-4, EGFR, HER-2, CD19, CD20, CD3, mesothelin (MSLN), prostate stem cell antigen (PCSA), B cell maturation antigen (BCMA or BCM), G-protein coupled receptor family C group 5 member D (GPRC5D), Interleukin-1 receptor accessory protein (IL1RAP), delta-like 3 (DLL3), carbonic anhydrase IX (CAIX), carcinoembryonic antigen (CAR), and HER-2. antigen, CEA), CD5, CD7, CD10, CD22, CD30, CD33, CD34, CD38, CD41, CD44, CD49f, CD56, CD74, CD123, CD133, CD138, epithelial glycoprotein-2 (EGP2), epithelial glycoprotein-40 (EGP-40), epithelial adhesion molecule (EpCAM), folate-binding protein (FBP), fetal acetylcholine receptor (AChR), folate receptor a and b (FRa and FRb), ganglioside G2 (GD2), ganglioside G3 (GD3), epidermal growth factor receptor (EGFR),receptor (EGFR), epidermal growth factor receptor vIII (EGFRvIII), ERB3, ERB4, interleukin-13 receptor subunit alpha-2 (IL-13Ra2), k-light chain, kinase insert domain receptor (KDR), Lewis A (CA19.9), Lewis Y (LeY), L1 cell adhesion molecule (LICAM), melanoma-associated antigen 1 (melanoma antigen family A1, MAGE-A1), mucin-16 (Muc-16), mucin 1 (Muc-1), NKG2D ligand, cancer-testis antigen NY-ESO-1, oncofetal antigen (h5T4), tumor-associated glycoprotein 72 (TAG-72), vascular endothelial growth factor receptor (vascular endothelial growth factor receptor) These may include, but are not limited to, vascular endothelial growth factor (VEGFR), vascular endothelial growth factor R2 (VEGF-R2), type 1 tyrosine protein kinase transmembrane receptor (ROR1), B7-H3 (CD276), B7-H6 (Nkp30), chondroitin sulfate proteoglycan-4 (CSPG4), DNAX accessory molecule (DNAM-1), ephrin type A receptor 2 (EpHA2), fibroblast associated protein (FAP), Gp100 / HLA-A2, glypican 3 (GPC3), HA-1H, HERK-V, IL-11Ra, latent membrane protein (LMP1), neural cell-adhesion molecule (N-CAM / CD56), and trail receptor (TRAIL R).

[0152] As used herein, a binding domain that "specifically binds" or "has binding specificity for" is greater than or equal to 1×10-7 M or less, or 1 x 10 -8 M or less, or 5 x 10 -9 M or less, or 1 x 10 -9 M or less, or 5 x 10 -10 M or less, or 1 x 10 -10 This refers to a binding domain that binds a target with a KD equal to or less than M.

[0153] As used herein, the term "antibody" is used in a broad sense and includes immunoglobulin or antibody molecules, including human, humanized, composite, and chimeric antibodies, as well as antibody fragments that are monoclonal or polyclonal. In general, antibodies are proteins or peptide chains that exhibit binding specificity to a specific antigen. The structure of antibodies is well known. Immunoglobulins can be assigned to five major classes (i.e., IgA, IgD, IgE, IgG, and IgM) depending on the amino acid sequence of the heavy chain constant domain. IgA and IgG are further subdivided into isotypes IgA1, IgA2, IgG1, IgG2, IgG3, and IgG4. Thus, the antibodies disclosed herein can be of any of the five major classes or corresponding subclasses. In one embodiment, the antibodies disclosed herein are IgG1, IgG2, IgG3, or IgG4. The antibody light chains of vertebrate species can be assigned to one of two clearly distinct types, kappa and lambda, based on the amino acid sequence of their constant domains. Thus, the antibodies of the invention can contain a kappa or lambda light chain constant domain. According to certain embodiments, the antibodies disclosed herein comprise heavy and / or light chain constant regions derived from a rat or human antibody. In addition to the heavy and light constant domains, the antibodies contain an antigen-binding region consisting of a light chain variable region and a heavy chain variable region, each of which contains three domains (i.e., complementarity determining regions 1-3; CDR1, CDR2, and CDR3). The light chain variable region domains are alternatively referred to as LCDR1, LCDR2, and LCDR3, and the heavy chain variable region domains are alternatively referred to as HCDR1, HCDR2, and HCDR3.

[0154] As used herein, the term "isolated antibody" refers to an antibody that is substantially free of other antibodies having different antigenic specificity (e.g., an isolated antibody that specifically binds a ligand peptide (e.g., GCN4 or La protein) or an epitope of a TAA is substantially free of antibodies that do not bind the ligand peptide or epitope of a TAA). In addition, an isolated antibody is substantially free of other cellular material and / or chemicals.

[0155] As used herein, the term "monoclonal antibody" refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e., the individual antibodies that make up the population are identical except for naturally occurring mutations that may be present in minor amounts. The monoclonal antibodies of the invention can be produced by hybridoma methods, phage display techniques, single lymphocyte gene cloning techniques, or recombinant DNA methods. For example, monoclonal antibodies can be produced by hybridomas that contain B cells obtained from a transgenic non-human animal, e.g., a transgenic mouse or rat, and have a genome that includes a human heavy chain transgene and a light chain transgene.

[0156] As used herein, the term "single chain antibody" refers to a conventional single chain antibody in the art. One exemplary single chain antibody is a single chain variable fragment (scFv) comprising a heavy chain variable region and a light chain variable region connected by a short peptide (e.g., a peptide of about 5 to about 20 amino acids). Another exemplary single chain antibody is a single chain antigen binding fragment (scFab) comprising one constant domain and one variable domain of each of the heavy and light chains. Yet another exemplary single chain antibody is a VHH (or a so-called nanobody) corresponding to the variable region of the heavy chain of a camelid antibody.

[0157] As used herein, the term "human antibody" refers to an antibody produced by a human or an antibody having an amino acid sequence corresponding to an antibody produced by a human, made using any technique known in the art. This definition of a human antibody includes intact or full-length antibodies, fragments thereof, and / or antibodies that comprise at least one human heavy and / or light chain polypeptide.

[0158] As used herein, the term "humanized antibody" refers to a non-human antibody that has been modified to increase sequence homology to that of a human antibody such that the antigen-binding properties of the antibody are retained but the antigenicity of the antibody in the human body is reduced.

[0159] As used herein, the term "chimeric antibody" refers to an antibody in which the amino acid sequence of the immunoglobulin molecule is derived from two or more species. The variable regions of both the light and heavy chains often correspond to the variable region of the antigen-binding domain derived from one species of mammal (e.g., mouse, rat, rabbit, etc.) having the desired specificity, affinity, and capacity, while the constant region corresponds to the sequence of the antigen-binding domain derived from another species of mammal (e.g., human) to avoid eliciting an immune response in that species.

[0160] As used herein, the term "DARPin" (Designed Ankyrin Repeat Protein; see Chapter 5, "Designed Ankyrin Repeat Proteins (DARPins): From Research to Therapy", Methods in Enzymology, vol 503:101 ~134 (2012); and "Efficient Selection of DARPins with Sub-nanomolar Affinities using SRP Phage Display", J.Mol.Biol. (2008) 382, ​​1211-1227 (the disclosures of which are incorporated herein by reference in their entirety) refer to antibody mimetic proteins with high specificity and high binding affinity to target proteins, which are prepared by genetic engineering. DARPins are derived from natural ankyrin proteins and have a structure containing at least two ankyrin repeat motifs, for example, at least three, four or five ankyrin repeat motifs. DARPins can have any suitable molecular weight depending on the number of repeat motifs. For example, DARPins containing three, four or five ankyrin repeat motifs can have a molecular weight of about 10 kDa, about 14 kDa, or about 18 kDa, respectively.

[0161] DARPins comprise a core portion that provides structure and a target binding portion that is outside the core and binds to a target. The structural core comprises a conserved amino acid sequence, while the target binding portion comprises an amino acid sequence that varies depending on the target.

[0162] In one embodiment, the isolated bispecific adapter protein disclosed herein is an isolated bispecific antibody, wherein each of the first and second binding domains comprises a single chain antibody, such as an scFv, scFab or VHH.

[0163] In a further embodiment, one or both of the first and second binding domains comprises an antigen-binding fragment, such as a DARPin.

[0164] In yet a further embodiment, the isolated bispecific adapter protein comprises, from N-terminus to C-terminus, a first binding domain, a linker (e.g., (G4S) nA polypeptide linker (where n is an integer of at least 2) (SEQ ID NO: 128)), and a second binding domain. Alternatively, the isolated bispecific adapter protein comprises, from N-terminus to C-terminus, a second binding domain, a linker ((G4S) n a polypeptide linker, where n is an integer of at least 2 (SEQ ID NO: 128), and a first binding domain.

[0165] In still further embodiments, the isolated bispecific adapter protein may comprise a first binding domain and a second binding domain conjugated via an intermolecular bond, such as a disulfide bond.

[0166] Figure 2 shows an exemplary configuration of a bispecific adapter protein useful herein. For example, the first binding domain is formed from an anti-GCN4 polypeptide ligand (H6 scFv), which consists of a light chain variable region (VL) and a heavy chain variable region (HL) linked from the N-terminus to the C-terminus by a (GGGGS)4 linker (SEQ ID NO: 15). The second binding domain is formed from a single chain variable fragment scFv, a single chain antibody VHH, or a polypeptide Darpin with specificity for a target (e.g., a tumor cell).

[0167] In accordance with the present invention, the bispecific adapter proteins disclosed herein can be used as adapters to drive recombinant HSV infection into target cells, such as tumor cells. For example, as shown in Figures 1 and 4, the bispecific adapter proteins disclosed herein can deliver recombinant HSV virions into target cells for target infection by specifically binding recombinant HSV with its first binding domain and specifically binding a target cell, such as a tumor cell, with its second binding domain.

[0168] First Binding Domain The first binding domain of the bispecific adapter protein is a ligand binding domain that specifically binds a ligand peptide encoded by the heterologous nucleotide sequence of the recombinant HSV.

[0169] In one embodiment, the first binding domain of the bispecific adaptor protein is a GCN4 binding domain that specifically binds the GCN4 transcription factor or a fragment thereof, or an epitope thereof, or an epitope thereof identified by SEQ ID NO: 4. The GCN4 binding domain may be an antigen binding fragment. The GCN4 binding domain may comprise a single chain antibody such as an scFv, scFab, or VHH.

[0170] In one embodiment, the GCN4 binding domain comprises a heavy chain variable region (VH) comprising heavy chain complementarity determining region 1 (HCDR1), HCDR2 and HCDR3, and / or a light chain variable region VL comprising light chain complementarity determining region 1 (LCDR1), LCDR2 and LCDR3, the sequences of which are as follows: HCDR1: GFSLTDYG (SEQ ID NO: 16); HCDR2: IWGDGIT (SEQ ID NO: 17); HCDR3: VTGLFDY (SEQ ID NO: 18); LCDR1: TGAVTTSNY (SEQ ID NO: 19); LCDR2:GTN (SEQ ID NO:20); LCDR3:ALWYSNHWV (sequence number 21).

[0171] In one embodiment, the GCN4 binding domain of the bispecific adaptor protein is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 22 (DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVSS). and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 23 (DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL).

[0172] In a further embodiment, the GCN4 binding domain of the bispecific adapter protein is a single chain variable fragment (scFv). The anti-GCN4 scFv is (G4S) nIt may be composed of a VH domain separated from a VL domain by a polypeptide linker, where n is an integer of at least 2 (SEQ ID NO: 128). The VH domain has a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 22. The VL domain has a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 23. The anti-GCN4 scFv may be in a VH-VL or VL-VH orientation, from the N-terminus to the C-terminus. One exemplary anti-GCN4 scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 24 (DVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVSSGGGGSGGGGSGGGGSGGGGSDAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVL).Another exemplary anti-GCN4 scFv has, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 25 (DAVVTQESALTTSPGETVTLTCRSSTGAVTTSNYASWVQEKPDHLFTGLIGGTNNRAPGVPARFSGSLIGDKAALTITGAQTEDEAIYFCALWYSNHWVFGGGTKLTVLGGGGSGGGGSGGGGSGGGGSDVQLQQSGPGLVAPSQSLSITCTVSGFSLTDYGVNWVRQSPGKGLEWLGVIWGDGITDYNSALKSRLSVTKDNSKSQVFLKMNSLQSGDSARYYCVTGLFDYWGQGTTLTVSS) (H6 scFv).

[0173] In one embodiment, the first binding domain of the bispecific adapter protein is an RE binding domain that specifically binds the synthetic leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof. In one aspect, the RE binding domain comprises an antigen binding fragment capable of binding the leucine zipper moiety RE. In another aspect, the RE binding domain comprises the leucine zipper moiety ER (SEQ ID NO: 10) or a fragment thereof capable of specifically binding the leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof.

[0174] In one embodiment, the first binding domain of the bispecific adapter protein is an ER binding domain that specifically binds the synthetic leucine zipper moiety ER (SEQ ID NO: 10) or a fragment thereof. In one aspect, the ER binding domain comprises an antigen binding fragment capable of binding the leucine zipper moiety ER. In another aspect, the ER binding domain comprises the leucine zipper moiety RE (SEQ ID NO: 6) or a fragment thereof capable of specifically binding the leucine zipper moiety ER (SEQ ID NO: 10) or a fragment thereof.

[0175] In one embodiment, the first binding domain of the bispecific adapter protein is a La binding domain that specifically binds the La protein or a fragment thereof, or an epitope thereof, or an epitope thereof identified by SEQ ID NO: 12. The La binding domain may be an antigen-binding fragment. The La binding domain may comprise a single chain antibody such as a scFv, scFab or VHH.

[0176] In one embodiment, the La-binding domain comprises a VH comprising HCDR1, HCDR2 and HCDR3, and / or a VL comprising LCDR1, LCDR2 and LCDR3, the sequences of which are as follows: HCDR1: GYTFTHYYIY (SEQ ID NO: 26); HCDR2:WMGGVNPSNGGTHF (SEQ ID NO:27); HCDR3: RSEYDYGLGFAY (SEQ ID NO:28); LCDR1: QSLLNSRTPKNYLA (SEQ ID NO:29); LCDR2:LLIYWASTRKS (SEQ ID NO:30); LCDR3: KQSYNLL (sequence number 31).

[0177] According to one embodiment, the La binding domain of the bispecific adaptor protein has a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 32 (QVQLVQSGAEVKKPGASVKVSCKASGYTFTHYYIYWVRQAPGQGLEWMGGVNPSNGGTHFNEKFKSRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSEYDYGLGFAYWGQGTLVTVSS). and / or a light chain variable region (VL) having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 33 (DIVMTQSPDSLAVSLGERATINCKSSQSLLNSRTPKNYLAWYQQKPGQPPKLLIYWASTRKSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLLTFGGGTKVEIK).

[0178] In a further embodiment, the La binding domain of the bispecific adapter protein is a single chain variable fragment (scFv). The anti-La scFv is (G4S) nIt may be composed of a VH domain separated from a VL domain by a polypeptide linker, where n is an integer of at least 2 (SEQ ID NO: 128). The VH domain has a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 30. The VL domain has a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 31. The anti-La scFv may be in a VH-VL or VL-VH orientation, from the N-terminus to the C-terminus. One exemplary anti-La scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 34 (QVQLVQSGAEVKKPGASVKVSCKASGYTFTHYYIYWVRQAPGQGLEWMGGVNPSNGGTHFNEKFKSRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSEYDYGLGFAYWGQGTLVTVSSGGSEGKSSGSGSESKSTGGSDIVMTQSPDSLAVSLGERATINCKSSQSLLNSRTPKNYLAWYQQKPGQPPKLLIYWASTRKSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLLTFGGGTKVEIK) (5B9HL).

[0179] Second Binding Domain The second binding domain of the bispecific adaptor protein is a TAA binding domain that specifically binds a TAA, such as PSMA, TMEFF2, KLK2, HLA-G or ROR1. In one embodiment, the TAA binding domain may comprise a single chain antibody, such as a scFv, scFab or VHH. In another embodiment, the TAA binding domain may comprise an antibody mimetic protein, such as a DARPin.

[0180] In one embodiment, the second binding domain specifically binds PSMA, such as an anti-PSMA VHH or an anti-PSMA scFv.

[0181] In one embodiment, the second binding domain comprises an anti-PSMA VHH. One exemplary anti-PSMA VHH comprises HCDR1 (GSTFSINA, SEQ ID NO: 35), HCDR2 (LSSGGSK, SEQ ID NO: 36), and HCDR3 (NAEIYYSDGVDDGYRGMDY, SEQ ID NO: 37). Or, an exemplary anti-PSMA VHH comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 38 (QLQLVESGGGLVHAGGSLRLSCAASGSTFSINAIGWYRQAPGKQRELVAALSSGGSKNYADSVKGRFTISRDNAKNTVYLQMNRLKPEDTAVYYCNAEIYYSDGVDDGYRGMDYWGKGTQVTVSS (B116)). Another exemplary anti-PSMA VHH comprises HCDR1 (GPPLSSYA, SEQ ID NO:39), HCDR2 (ISWSGSNT, SEQ ID NO:40), and HCDR3 (AADRRGGPLSDYEWEDEYAD, SEQ ID NO:41). Or, an exemplary anti-PSMA VHH comprises a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:42 (EVQVVESGGGLVQTGGSLRLSCAASGPPLSSYAVAWFRQTPGKEREFVAAISWSGSNTYYADSVKGRFTISKDNAKNTVLVYLQMNSLKPEDTAVYYCAADRRGGPLSDYEWEDEYADWGQGTQVTVSS(B110)).

[0182] In one embodiment, the second binding domain comprises an anti-PSMA scFv. The anti-PSMA scFv disclosed herein may be in a VH-VL or VL-VH orientation, from N-terminus to C-terminus. In one aspect, the anti-PSMA scFv comprises a VH comprising HCDR1 (GFTFSFYN, SEQ ID NO: 43), HCDR2 (ISTSSSTI, SEQ ID NO: 44), and HCDR3 (AREGSYYDSSGYPYYYYDMDV, SEQ ID NO: 45), and / or a VL comprising LCDR1 (SSNIGAGYD, SEQ ID NO: 46), LCDR2 (GNT, SEQ ID NO: 47), and LCDR3 (QSYDSSLSGTPYVV, SEQ ID NO: 48). In another aspect, the anti-PSMA The scFv has a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 49 (EVQLVESGGGLVQPGGSLRLSCAASGFTFSFYNMNWVRQAPGKGLEWISYISTSSSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAREGSYYDSSGYPYYYYDMDVWGQGTTVTVSS). and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 50 (QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNTNRPSGVPDRFSGSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGTPYVVFGGGTKLTVL).

[0183] One exemplary anti-PSMA scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:51 (EVQLVESGGGLVQPGGSLRLSCAASGFTFSFYNMNWVRQAPGKGLEWISYISTSSSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAREGSYYDSSGYPYYYYDMDVWGQGTTVTVSSGGSEGKSSGSGSESKSTGGSQSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNTNRPSGVPDRFSGSSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGTPYVVFGGGTKLTVL (B588HL)). Another exemplary anti-PSMA scFv has, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 52 (QSVLTQPPSVSGAPGQRVTISCTGSSSNIGAGYDVHWYQQLPGTAPKLLIYGNTNRPSGVPDRFSGSSKSGTSASLAITGLQAEDEADYYCQSYDSSLSGTPYVVFGGGTKLTVLGGSEGKSSGSGSESKSTGGSEVQLVESGGGLVQPGGSLRLSCAASGFTFSFYNMNWVRQAPGKGLEWISYISTSSSTIYYADSVKGRFTISRDNAKNSLYLQMNSLRDEDTAVYYCAREGSYYDSSGYPYYYYDMDVWGQGTTVTVSS (B588LH)).

[0184] In further embodiments, the second binding domain specifically binds TMEFF2, such as an anti-TMEFF2 scFv. The anti-TMEFF2 scFv disclosed herein may be in a VH-VL or VL-VH orientation, from N-terminus to C-terminus. In one aspect, the anti-TMEFF2 scFv comprises a VH comprising HCDR1 (GFTFSSYS, SEQ ID NO: 53), HCDR2 (ISGSGGFT, SEQ ID NO: 54), and HCDR3 (ARMPLNSPHDY, SEQ ID NO: 55), and / or a VL comprising LCDR1 (QGIRND, SEQ ID NO: 56), LCDR2 (AAS, SEQ ID NO: 57), and LCDR3 (LQDYNYPLT, SEQ ID NO: 58). In one aspect, the anti-TMEFF2 scFv comprises a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 59 (EVQLLESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSVISGSGGFTDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMPLNSPHDYWGQGTLVTVSS), and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 60 (DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPLTFGGGTKVEIK). In one aspect, the anti-TMEFF2 scFv comprises a VH comprising HCDR1 (GVSISSYF, SEQ ID NO: 61), HCDR2 (ISTSGST, SEQ ID NO: 62), and HCDR3 (VRDWTGFDY, SEQ ID NO: 63), and / or a VL comprising LCDR1 (SSDVGSYNL, SEQ ID NO: 64), LCDR2 (EGS, SEQ ID NO: 65), and LCDR3 (SSYAGSSTYV, SEQ ID NO: 66).In one embodiment, anti-TMEFF2 The scFv comprises a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 67 (QVQLQESGPGLVKPSETLSLTCTVSGVSISSYFWSWLRQPAGKGLQWIGRISTSGSTNHNPSLKSRVIMSVDTSKNQFSLKLSSVTAADTAVYYCVRDWTGFDYWGQGTLVTVSS), and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 68 (SYELTQPASVSGSPGQSITISCIGTSSDVGSYNLVSWYQQHPGKVPKLMIYEGSKRPSGVSNRFSGSSKSGNTASLTISGLQAEDEADYYCSSYAGSSTYVFGTGTKVTVL).

[0185] One exemplary anti-TMEFF2 scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 69 (QVQLQESGPGLVKPSETLSLTCTVSGVSISSYFWSWLRQPAGKGLQWIGRISTSGSTNHNPSLKSRVIMSVDTSKNQFSLKLSSVTAADTAVYYCVRDWTGFDYWGQGTLVTVSSGGSEGKSSGSGSESKSTGGSSYELTQPASVSGSPGQSITISCIGTSSDVGSYNLVSWYQQHPGKVPKLMIYEGSKRPSGVSNRFSGSSKSGNTASLTISGLQAEDEADYYCSSYAGSSTYVFGTGTKVTVL (TMEF9HL)). Another exemplary anti-TMEFF2 scFv has, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 70 (DIQMTQSPSSLSASVGDRVTITCRASQGIRNDLGWYQQKPGKAPKLLIYAASSLQSGVPSRFSGSGSGTDFTLTISSLQPEDFATYYCLQDYNYPLTFGGGTKVEIKGGSEGKSSGSGSESKSTGGSEVQLLESGGGLVQPGGSLRLSCAASGFTFSSYSMSWVRQAPGKGLEWVSVISGSGGFTDYADSVKGRFTISRDNSKNTLYLQMNSLRAEDTAVYYCARMPLNSPHDYWGQGTLVTVSS (TMEF847LH)).Yet another exemplary anti-TMEFF2 scFv has, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 71 (SYELTQPASVSGSPGQSITISCIGTSSDVGSYNLVSWYQQHPGKVPKLMIYEGSKRPSGVSNRFSGSSKSGNTASLTISGLQAEDEADYYCSSYAGSSTYVFGTGTKVTVLGGSEGKSSGSGSESKSTGGSQVQLQESGPGLVKPSETLSLTCTVSGVSISSYFWSWLRQPAGKGLQWIGRISTSGSTNHNPSLKSRVIMSVDTSKNQFSLKLSSVTAADTAVYYCVRDWTGFDYWGQGTLVTVSS (TMEF9LH)).

[0186] In yet further embodiments, the second binding domain specifically binds KLK2, such as an anti-KLK2 scFv. The anti-KLK2 scFv disclosed herein may be in a VH-VL or VL-VH orientation, from N-terminus to C-terminus. In one aspect, the anti-KLK 2 scFv comprises HCDR1 (GNSITSDYA, SEQ ID NO: 72), HCDR2 (ISYSGST, SEQ ID NO: 73), HCDR3 (ATGYYYGSGF, SEQ ID NO: 74), LCDR1 (ESVEYFGTSL, SEQ ID NO: 75), LCDR2 (AAS, SEQ ID NO: 76), and LCDR3 (QQTRKVPYT, SEQ ID NO: 77). In another aspect, the anti-KLK2 The scFv comprises a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 78 (QVQLQESGPGLVKPSDTLSLTCAVSGNSITSDYAWNWIRQPPGKGLEWIGYISYSGSTTYNPSLKSRVTMSRDTSKNQFSLKLSSVTAVDTAVYYCATGYYYGSGFWGQGTLVTVSS), and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 79 (DIVLTQSPDSLAVSLGERATINCKASESVEYFGTSLMHWYQQKPGQPPKLLIYAASNRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQTRKVPYTFGQGTK).In yet another embodiment, anti-KLK2 The scFv comprises a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 80 (QVQLQESGPGLVKPSQTLSLTCTVSGNSITSDYAWNWIRQFPGKRLEWIGYISYSGSTTYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCATGYYYGSGFWGQGTLVTVSS), and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 81 (EIVLTQSPATLSLSPGERATLSCRASESVEYFGTSLMHWYQQKPGQPPRLLIYAASNVESGIPARFSGSGSGTDFTLTISSVEPEDFAVYFCQQTRKVPYTFGGGTKVEIK).

[0187] One exemplary anti-KLK2 scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 82 (QVQLQESGPGLVKPSDTLSLTCAVSGNSITSDYAWNWIRQPPGKGLEWIGYISYSGSTTYNPSLKSRVTMSRDTSKNQFSLKLSSVTAVDTAVYYCATGYYYGSGFWGQGTLVTVSSGTEGKSSGSGSESKSTDIVLTQSPDSLAVSLGERATINCKASESVEYFGTSLMHWYQQKPGQPPKLLIYAASNRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQTRKVPYTFGQGTKLEIK (11B6HL)). Another exemplary anti-KLK2 scFv has, from N-terminus to C-terminus, a VH-VL orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 83 (QVQLQESGPGLVKPSQTLSLTCTVSGNSITSDYAWNWIRQFPGKRLEWIGYISYSGSTTYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCATGYYYGSGFWGQGTLVTVSSGGSEGKSSGSGSESKSTGGSEIVLTQSPATLSLSPGERATLSCRASESVEYFGTSLMHWYQQKPGQPPRLLIYAASNVESGIPARFSGSGSGTDFTLTISSVEPEDFAVYFCQQTRKVPYTFGGGTKVEIK (KL2B359HL)).Further exemplary anti-KLK2 scFvs have, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 84 (DIVLTQSPDSLAVSLGERATINCKASESVEYFGTSLMHWYQQKPGQPPKLLIYAASNRESGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCQQTRKVPYTFGQGTKLEIKGTEGKSSGSGSESKSTQVQLQESGPGLVKPSDTLSLTCAVSGNSITSDYAWNWIRQPPGKGLEWIGYISYSGSTTYNPSLKSRVTMSRDTSKNQFSLKLSSVTAVDTAVYYCATGYYYGSGFWGQGTLVTVSS (11B6LH)). Further exemplary anti-KLK2 scFvs have, from N-terminus to C-terminus, a VL-VH orientation and a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 85 (EIVLTQSPATLSLSPGERATLSCRASESVEYFGTSLMHWYQQKPGQPPRLLIYAASNVESGIPARFSGSGSGTDFTLTISSVEPEDFAVYFCQQTRKVPYTFGGGTKVEIKGGSEGKSSGSGSESKSTGGSQVQLQESGPGLVKPSQTLSLTCTVSGNSITSDYAWNWIRQFPGKRLEWIGYISYSGSTTYNPSLKSRVTISRDTSKNQFSLKLSSVTAADTAVYYCATGYYYGSGFWGQGTLVTVSS (KL2B359LH)).

[0188] In yet further embodiments, the second binding domain specifically binds HLA-G, such as an anti-HLA-G scFv. The anti-HLA-G scFv disclosed herein may be in a VH-VL or VL-VH orientation from N-terminus to C-terminus.

[0189] In yet further embodiments, the second binding domain specifically binds ROR1, such as a polypeptide ligand DARPin. Exemplary DARPins with specificity for ROR1 have a polypeptide sequence that is 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 86 (GSDLGKKLLEAARAGQDDEVRILMANGADVNASDRYGRTPLHLAAFNGHLEIVEVLLKNGADVNAKDKIGNTPLHLAANHGHLEIVEVLLKYGAVVNATDWLGVTPLHLAAVFGHLEIVEVLLKYGADVNAQDKFGKTAFDISIDNGNEDLAEILQKL (H6w, see e.g. Koch, Characterisation and affinity maturation of DARPins binding human ROR1, Master's Thesis, Submitted at Department of Biotechnology, University of Natural Resources and Life Sciences, Vienna)).

[0190] In yet a further embodiment, the present invention relates to an isolated polynucleotide comprising a nucleic acid encoding a bispecific adapter protein or a fragment thereof. It will be understood by those skilled in the art that the coding sequence of a protein can be altered (e.g., substituted, deleted, inserted, etc.) without changing the amino acid sequence of the protein. Thus, it will be understood by those skilled in the art that the nucleic acid sequence encoding the bispecific adapter protein or a fragment thereof of the present invention can be altered without changing the amino acid sequence of the protein.

[0191] In yet further embodiments of the present disclosure, the present invention relates to a vector comprising an isolated polynucleotide comprising a nucleic acid encoding the bispecific adapter protein or a fragment thereof disclosed herein. In view of the present disclosure, any vector known to those skilled in the art can be used, such as a plasmid, cosmid, phage vector, or viral vector. In some embodiments, the vector is a recombinant expression vector, such as a plasmid. The vector can include any element for establishing the conventional functions of an expression vector, such as a promoter, a ribosome binding element, a terminator, an enhancer, a selection marker, and an origin of replication. The promoter can be a constitutive, inducible, or repressible promoter. Numerous expression vectors capable of delivering a nucleic acid to a cell are known in the art and can be used herein to generate the antigen-binding domain thereof in the cell. Conventional cloning techniques or artificial gene synthesis methods can be used to generate the recombinant expression vector according to embodiments of the present invention.

[0192] In still further embodiments, the present invention relates to a cell transduced with a vector comprising an isolated polynucleotide comprising a nucleic acid encoding a bispecific adapter protein or fragment thereof disclosed herein. The term "transduced" or "transduction" refers to the process by which exogenous nucleic acid is transferred or introduced into a host cell. A "transduced" cell is one that has been transduced with exogenous nucleic acid. Such cells include the primary cell of a subject and its progeny.

[0193] In another general aspect, the invention relates to a method of preparing a transformed cell by transducing the cell with a vector comprising an isolated nucleic acid molecule encoding a bispecific adapter protein, or a fragment thereof, disclosed herein.

[0194] In another general aspect, the present invention relates to a host cell comprising an isolated nucleic acid molecule encoding a bispecific adapter protein or a fragment thereof disclosed herein. In view of the present disclosure, any host cell known to the skilled artisan can be used for recombinant expression of the antibodies or antigen-binding fragments thereof of the present invention. In some embodiments, the host cell is an E. coli TG1 or BL21 cell (e.g., for expression of scFv or Fab antibodies), a CHO-DG44 or CHO-K1 cell, or a HEK293 cell (e.g., for expression of full-length IgG antibodies). According to certain embodiments, the recombinant expression vector is transformed into the host cell by conventional methods such as chemical transfection, heat shock, or electroporation, whereby the recombinant nucleic acid is stably integrated into the host cell genome for efficient expression.

[0195] In still further embodiments of the present disclosure, the present invention relates to a method of producing an isolated bispecific adapter protein as disclosed herein, comprising culturing a cell comprising a nucleic acid encoding the bispecific adapter protein as disclosed herein, and recovering the bispecific adapter protein from the cell or cell culture (e.g., from the supernatant). The expressed bispecific adapter protein can be harvested and purified from the cells according to conventional techniques known in the art and as described herein.

[0196] Pharmaceutical Compositions Still further disclosed herein is a pharmaceutical composition comprising the recombinant HSV disclosed above, the isolated bispecific adapter protein disclosed above, and a pharma- ceutical acceptable carrier. As used herein, the term "pharmaceutical composition" refers to a product comprising the recombinant HSV disclosed above, and the isolated bispecific adapter protein disclosed above, together with one or more pharma- ceutical acceptable carriers.

[0197] As used herein, the term "carrier" refers to any excipient, diluent, filler, salt, buffer, stabilizer, solubilizer, oil, lipid, lipid-containing vesicle, microsphere, liposomal encapsulation, or other material known in the art for use in pharmaceutical formulations. It will be understood that the characteristics of the carrier, excipient, or diluent will depend on the route of administration for a particular application. As used herein, the term "pharmaceutical acceptable carrier" refers to a non-toxic material that does not interfere with the efficacy of the composition according to the invention or the biological activity of the composition according to the invention. According to certain embodiments, in view of the present disclosure, any pharmaceutical acceptable carrier suitable for use in pharmaceutical compositions of polynucleotides, polypeptides, host cells, viruses and / or genetically engineered immune cells can be used in the present invention.

[0198] How to use In another general aspect, the present invention relates to a method of retargeting a recombinant HSV as disclosed above to a tumor cell using a bispecific adapter protein as disclosed above. The method comprises administering to a subject a recombinant HSV and a bispecific adapter protein, where a first binding domain of the bispecific adapter protein specifically binds the recombinant HSV and a second binding domain of the bispecific adapter protein specifically binds a TAA of the tumor cell, thereby retargeting the recombinant HSV to the tumor cell.

[0199] In this method, the recombinant HSV and the bispecific adapter protein are selected such that the first domain of the bispecific adapter protein specifically binds the heterologous ligand peptide expressed by the recombinant HSV and the second domain of the bispecific adapter protein specifically binds the TAA on the surface of the selected tumor cell. For example, to retarget the recombinant HSV to prostate cancer cells, a GCN4-retargeted recombinant HSV and a bispecific adapter protein having a first binding domain comprising an anti-GCN4 scFv and a second binding domain comprising an anti-PSMA scFv can be selected.

[0200] In another general aspect, the invention relates to a method of treating cancer in a subject in need thereof, comprising administering to the subject a pharmaceutical composition comprising a recombinant HSV with a matching bispecific adapter protein as disclosed herein, whereby the recombinant HSV is retargeted to cancer cells in the subject by the matching bispecific adapter protein, thereby causing oncolysis of the cancer cells. As used herein, "oncolysis" refers to a reduction in the viability of targeted cancer cells. Viability can be determined by viable cell count of treated cells, and the extent of reduction can be determined by comparing the number of viable cells in treated cells to the number of viable cells in untreated cells, or by comparing the viable cell count before and after treatment.

[0201] The cancer may be selected from, for example, but is not limited to, prostate cancer, lung cancer, gastric cancer, esophageal cancer, bile duct cancer, cholangiocarcinoma, colon cancer, hepatocellular carcinoma, renal cell carcinoma, bladder urothelial carcinoma, metastatic melanoma, breast cancer, ovarian cancer, cervical cancer, head and neck cancer, pancreatic cancer, glioma, glioblastoma, and other solid tumors, as well as non-Hodgkin's lymphoma (NHL), acute lymphocytic leukemia (ALL), chronic lymphocytic leukemia (CLL), chronic myelogenous leukemia (CML), multiple myeloma (MM), acute myeloid leukemia (AML), and other liquid tumors.

[0202] According to an embodiment of the present invention, a pharmaceutical composition comprising recombinant HSV and a bispecific adapter protein comprises a therapeutically effective amount of the recombinant HSV and bispecific adapter protein disclosed herein. As used herein, the term "therapeutically effective amount" refers to an amount of an active ingredient or component that elicits a desired biological or pharmacological response in a subject. Therapeutically effective amounts can be determined empirically and in a routine manner for the stated purpose.

[0203] As used herein with respect to recombinant HSV and bispecific adapter proteins, a therapeutically effective amount refers to an amount of recombinant HSV in combination with a bispecific adapter protein that modulates an immune response in a subject in need thereof, and as used herein with respect to recombinant HSV, a therapeutically effective amount refers to an amount of recombinant HSV with a bispecific adapter protein that results in treatment of a disease, disorder, or condition, prevents or slows the progression of a disease, disorder, or condition, or reduces or completely alleviates symptoms associated with a disease, disorder, or condition.

[0204] According to certain embodiments, a therapeutically effective amount refers to an amount of treatment sufficient to achieve one, two, three, four or more of the following effects: (i) reducing or ameliorating the severity of the disease, disorder or condition being treated or symptoms associated therewith; (ii) shortening the duration of the disease, disorder or condition being treated or symptoms associated therewith; (iii) preventing the progression of the disease, disorder or condition being treated or symptoms associated therewith; (iv) causing regression of the disease, disorder or condition being treated or symptoms associated therewith; (v) preventing the progression or onset of the disease, disorder or condition being treated or symptoms associated therewith. (vi) preventing the recurrence of the disease, disorder or condition being treated, or symptoms associated therewith; (vii) reducing hospitalization of a subject having the disease, disorder or condition being treated, or symptoms associated therewith; (viii) shortening the length of hospitalization of a subject having the disease, disorder or condition being treated, or symptoms associated therewith; (ix) increasing the survival rate of a subject having the disease, disorder or condition being treated, or symptoms associated therewith; (xi) inhibiting or alleviating the disease, disorder or condition being treated, or symptoms associated therewith in a subject; and / or (xii) enhancing or improving the prophylactic or therapeutic efficacy of another therapy.

[0205] The therapeutically effective amount or dose can vary depending on a variety of factors, such as the disease, disorder or condition being treated, the means of administration, the target site, the physiological state of the subject (including, for example, age, weight, health status), whether the subject is human or animal, other agents being administered, and whether the treatment is prophylactic or therapeutic. Treatment dosages are optimally titrated to optimize safety and efficacy.

[0206] According to certain embodiments, the pharmaceutical compositions described herein are formulated to be suitable for the intended route of administration to a subject. For example, the pharmaceutical compositions described herein can be formulated to be suitable for intravenous, subcutaneous, or intramuscular administration.

[0207] The pharmaceutical composition of the present invention can be administered in any convenient manner known to those skilled in the art. For example, the pharmaceutical composition of the present invention can be administered to a subject by aerosol inhalation, injection, ingestion, transfusion, placement, and / or implantation. The pharmaceutical composition comprising the recombinant HSV of the present invention and the corresponding bispecific adapter protein can be administered intraarterially, subcutaneously, intradermally, intratumorally, intraaneurysmally, intramuscularly, intrapleurally, by intravenous (iv) injection, or intraperitoneally. In certain embodiments, the pharmaceutical composition of the present invention can be administered with or without lymphodepletion of the subject.

[0208] Pharmaceutical compositions comprising the recombinant HSV and bispecific adapter proteins disclosed herein may be provided as sterile liquid preparations, typically isotonic aqueous solutions containing cell suspensions, or optionally as emulsions, dispersions, etc., buffered to a selected pH. The pharmaceutical composition may comprise a carrier suitable for the integrity and viability of the recombinant HSV and bispecific adapter protein, as well as administration of the pharmaceutical composition, e.g., water, saline, phosphate buffered saline, etc.

[0209] As used herein, the terms "treat", "treating" and "treatment" all refer to an improvement or amelioration of at least one measurable physical parameter associated with cancer, which may, but is not necessarily discernible in the subject. The terms "treat", "treating" and "treatment" may also refer to causing regression, preventing the progression or at least slowing the progression of a disease, disorder or condition. In certain embodiments, "treat", "treating" and "treatment" refer to alleviating, preventing the progression or onset of, or shortening the duration of, one or more symptoms associated with a disease, disorder or condition, such as a tumor or cancer. In certain embodiments, "treat", "treating" and "treatment" refer to preventing the recurrence of a disease, disorder or condition. In certain embodiments, "treat", "treating" and "treatment" refer to improving the survival rate of a subject having a disease, disorder or condition. In certain embodiments, "treat", "treating", and "treatment" refer to the elimination of a disease, disorder, or condition in a subject.

[0210] According to certain embodiments, a pharmaceutical composition is provided that includes a recombinant HSV and a corresponding bispecific adapter protein for use in the treatment of cancer. For cancer therapy, the provided pharmaceutical composition may be combined with another treatment, including, but not limited to, chemotherapy, anti-CD20mAb, anti-TIM-3mAb, anti-LAG-3mAb, anti-EGFRmAb, anti-HER-2mAb, anti-CD19mAb, anti-CD33mAb, anti-CD47mAb, anti-CD73mAb, anti-DLL-3mAb, anti-apelinmAb, anti-TIP-1mAb, anti-FOLR1mAb, anti-CTLA-4mAb, anti-PD-L1mAb, anti-PD-1mAb, other immuno-oncology drugs, anti-angiogenesis drugs, radiation therapy, antibody-drug conjugates (ADC), targeted therapy, or other anti-cancer drugs.

[0211] According to certain embodiments, a method of treating cancer in a subject in need thereof comprises administering to the subject a recombinant HSV in combination with a bispecific adapter protein disclosed herein.

[0212] kit In another general aspect, provided herein are kits, unit dosages, and articles of manufacture comprising a recombinant HSV as disclosed herein, an isolated bispecific adapter protein as disclosed herein, and optionally a pharmaceutical carrier. In certain embodiments, the kit provides instructions for its use.

[0213] In another specific aspect, provided herein is a kit comprising: (1) a recombinant HSV as disclosed herein; and (2) an isolated bispecific adapter protein or fragment thereof as disclosed herein. The recombinant HSV and the isolated bispecific adapter protein may be included in the kit as separate components or as a premix.

[0214] In another specific aspect, provided herein is a kit comprising: (1) a recombinant HSV as disclosed herein; and (2) an isolated nucleic acid molecule encoding a bispecific adapter protein or fragment thereof as disclosed herein. The recombinant HSV and the isolated nucleic acid molecule may be included in the kit as separate components or as a premix. EXAMPLES

[0215] Retargeting of HSV by GCN4 / H6 scFv Materials and Methods cell culture Vero cells (Vero ATCC CCL-81) were maintained in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 4.5 g / L glucose, sodium pyruvate, Glutamax (Gibco), and penicillin / streptomycin (Lonza, 100 U / mL). Serum-free Vero (VERO-SF-ACF MCB from BioReliance cGMP Biomaterial Repository) were maintained in VP-SFM (ThermoFisher) supplemented with Glutamax (Gibco) and penicillin / streptomycin (Lonza, 100 U / mL). HEK293T were maintained in Dulbecco's Modified Eagle's Medium (DMEM) supplemented with 4.5 g / L glucose, sodium pyruvate, Glutamax (Gibco), and penicillin / streptomycin (Lonza, 100 U / mL). 22Rv1 cells were maintained in Roswell Park Memorial Institute 1460 medium (RPMI-1460) supplemented with 4.5 g / L glucose, sodium pyruvate, Glutamax (Gibco), and penicillin / streptomycin (Lonza, 100 U / mL). LNCaP were maintained in Dulbecco's Modified Eagle Medium (DMEM) without phenol red supplemented with 4.5 g / L glucose, sodium pyruvate, Glutamax (Gibco), and penicillin / streptomycin (Lonza, 100 U / mL). DU145 were maintained in Eagle's Minimum Essential Medium (EMEM) with EBSS and 25 mM Hepes supplemented with MEM non-essential amino acids (Corning Cellgro), sodium pyruvate, Glutamax (Gibco), and penicillin / streptomycin (Lonza, 100 U / mL).

[0216] GCN4 retargeting oHSV1 bacterial artificial chromosome (BAC) The GCN4 retargeted HSV1 BAC (or recombinant HSV1) contains the HSV1 Patton strain genome (see, e.g., Mulvey et al., J Virol. 2007 Apr;81(7):3377-90 for a complete description) into which the EGFP-FRT-KAN-FRT-T2A-1XGCN-d6-38gD cassette was inserted between the start and stop codons of the US6 gene (genebank MF959544.1 nucleotides 138309-139493). The cassette contains the enhanced green fluorescent protein (EGFP) amino acid sequence (Uniprot P42212, F64L and S65T mutations) and a peptide linker (AA sequence: ) that contains the OVA peptide (underlined) and an in-frame FRT site (italics bold, nucleotide sequence gaagttcctattctctagaaagtataggaacttc) (SEQ ID NO: 130).

[0217] TIFF2024517232000002.tif6128) (SEQ ID NO: 129), a T2A self-cleaving peptide (AA sequence: GSGEGRGSLLTCGDVEENPGP) (SEQ ID NO: 131), and an endogenous US6 signal peptide (AA sequence

[0218] TIFF2024517232000003.tif6128 (SEQ ID NO: 132, signal peptide is underlined) and US6 amino acids 1 to 30, including the GCN4 epitope peptide (sequence

[0219] TIFF2024517232000004.tif6128 (SEQ ID NO: 5), epitope is underlined (SEQ ID NO: 4)) and contains a 30 AA insert and an in-frame fusion with US6 AA39-369 (Uniprot P57083).

[0220] GCN4 retargeting HSV1 GCN4-retargeted virus was obtained by transfecting 1e6 cells of the gD-complementing VSF cell line eF9 with 1 μg of GCN4-retargeted HSV1 BAC with Lipofectamine 3000. Virus was subsequently amplified by passaging on Vero H6-nectin1 cells.

[0221] gD-complementing VSF cell lines Serum-free Vero cells (VERO-SF-ACF MCB from BioReliance cGMP Biomaterial Repository) were transduced with lentivirus carrying a 5.7 kb fragment of the HSV1 Patton strain genome containing an EGFP-T2A-US6 (glycoprotein D) cassette inserted in place of the endogenous US6 gene. The EGFP-T2A-US6 ORF is flanked by 1.5 kb of genomic sequence upstream of the US6 ORF and 2.2 kb of genomic sequence downstream of the US6 ORF. After selection with blasticidin (2 ug / mL), single cell clones were isolated by limiting dilution. Clones were screened for their ability to rescue the growth of a gD-deficient HSV1 BAC clone.

[0222] H6-nectin1 cell line Vero cells (ATCC CCL-81) and B16-F10 cells (ATCC, Cat. No. CRL-6475TM) were transduced with lentivirus expressing anti-GCN4 H6 scFv fused to AA146-517 of human nectin-1 (Uniprot Q15223) separated by a G4S linker (SEQ ID NO: 124). After blasticidin selection (7.5 μg / mL and 10 μg / mL, respectively), single cell clones were isolated by limiting dilution and screened for H6-nectin1 expression by Western blot.

[0223] PSMA cell line HEK-293T were transduced with lentivirus expressing human PSMA (Genecopoeia, Catalog No. LPP-G0050-Lv105-050-S). After puromycin selection (2.5 μg / mL), single cell clones were isolated by limiting dilution and screened for PSMA expression by Western blot and FACS analysis.

[0224] TMEFF2 cell line Vero cells (ATCC CCL-81) were transduced with lentivirus expressing human TMEFF2. After puromycin selection (5 μg / mL), stable populations were enriched for PSMA expression by cell sorting.

[0225] KLK2-nectin1 cell line Vero cells (ATCC CCL-81) were transduced with lentivirus expressing human KLK2 (AA25-261, Uniprot P20151) harboring an S195A mutation (catalytically dead mutant) fused to AA337-517 of human nectin-1 (Uniprot Q15223, transmembrane + cytoplasmic domains). After puromycin selection (5 μg / mL), stable populations were enriched for KLK2-nectin1 expression by cell sorting.

[0226] Transfection and expression of bispecific adapter proteins All bispecific adapter proteins used in this study (see Table 1) were cloned into the pCDNA3.1(+)-myc-HisA vector (ThermoFischer).

[0227] For transfection, HEK293T cells were seeded in 24-well plates in complete DMEM. 24 hours after seeding, cells were transfected with 500 ng of each bispecific adapter expression plasmid using Lipofectamine 3000 (ThermoFischer) according to the manufacturer's instructions. 48 hours after transfection, supernatants were harvested and used immediately for GCN4-retargeted HSV1 infection assays.

[0228] GCN4 retargeted HSV1 infection assay Target cells were seeded in 96-well plates treated with poly-L lysine (Sigma, 0.01%, 30 min at RT, washed twice with DPBS) 24 h prior to infection. On the day of infection, the medium was removed and replaced with 50 μL of conditioned supernatant containing the bispecific adapter protein. One untreated well was trypsinized and cells were counted. After 2 h incubation at 37 °C, the conditioned medium was removed, cells were washed with 100 μL of PBS (except for HEK293T cells) and 50 μL of fresh complete medium containing retargeted virus diluted at MOI = 0.1 was added. Cells were incubated for 3 h at 37 °C. Viral supernatant was removed, wells were washed with 100 μL of PBS (except for HEK293T cells) and 100 μL of fresh complete medium was added. After 24 h, GFP fluorescence and cytopathic effects were monitored by microscopy.

[0229] Western blot 75 μL of supernatant was mixed with 25 μL of 4× Laemmli buffer (Biorad + 100 mM DTT) and denatured at 95 °C for 5 min. 20 μL of each denatured supernatant was run on a 4-15% Mini-PROTEAN® TGX Stain-Free™ Protein Gel (Biorad) and transferred to a low-fluorescence PVDF membrane (Biorad, Trans-Blot Turbo Transfer System RTA Transfer kit). Intercept (PBS) blocking buffer (Li-CoR) was used as blocking buffer. Myc-tagged bispecific adapters were detected using c-Myc mouse monoclonal antibody (9E10, Invitrogen) as the primary antibody and IRDye 800 CW goat anti-mouse (Licor) as the secondary antibody. Blots were scanned with an Odyssey CLX scanner (Licor).

[0230] FACS staining Stable cell lines and their parental counterparts were stained with the following antibodies: PE-labeled anti-ROR1 (Biolegend, 357803), JF646-labeled anti-TMEFF2 (J4B6, NOVUSBIO), PE-labeled anti-PSMA antibody (abcam, ab77228), PE-labeled mouse IgG1, K Isotype Ctrl (eBioscience), PE-labeled anti-DYDDDDK (SEQ ID NO: 133) (Biolegend). Briefly, 1e6 cells were used per staining in a volume of 100 μL. After washing in PBS, cells were stained for 30 min at 4° C. in PBS+0.5% BSA (SigmaAldrich) according to the antibody manufacturer's specifications. After washing in PBS, cells were fixed with 4% PFA (Alfa Aesar) in PBS. Samples were analyzed on a MACSQuant Analyzer 10 (Miltenyi Biotec).

[0231] In vitro fusion assay The assay used a dual split protein (DSP) reporter (see, e.g., Kondo N, Miyauchi K, Meng F, Iwamoto A, Matsuda Z. Conformational changes of the HIV-1 envelope protein during membrane fusion are inhibited by the replacement of its membrane-spanning domain. J Biol Chem. 2010 May 7;285(19):14681-8). For seeding of effector cells, HEK293T cells were split 1 / 6 into 96-well clear bottom / white wall plates. For seeding of target cells, HEK293T or HEK293T-PSMA were split 1 / 4 into 12-well plates. The next day, effector cells in 96 wells were each transfected with a mixture of 180 ng of plasmids expressing HSV1 glycoproteins gB, gH, gL and gD (or corresponding gD fusions) and the split protein reporter cDSP in a mass ratio of 1:2:2:1:3 using Lipofectamine 3000 (ThermoFischer) in OptiMEM. Target cells in 12 wells were similarly transfected with 1 μg of a 1:1:1 mixture of plasmids expressing the corresponding target proteins (except for 293T-PSMA, which received the same amount of empty vector), the corresponding adapters (control samples received the same amount of empty expression vector) and the split protein reporter nDSP. The next day, the culture medium in the 96-well plate was replaced with phenol red-free culture medium containing 60 μM Enduren (a live cell permeable luciferase substrate, Promega), and the target cells were detached with Versene solution (Gibco), washed with phenol red-free culture medium, resuspended in phenol red-free culture medium containing 60 μM Enduren, and added to the effector cells. Seven hours after the addition of the target cells to the effector cells, the luciferase activity resulting from cell fusion is measured using a cytation 5 multimode plate reader (Biotek) in luminometer mode.

[0232] result Oncolytic HSV1 (oHSV1) was retargeted by replacing amino acids 6-38 of gD (SEQ ID NO:3) with a 30AA peptide (SEQ ID NO:5) containing a 16AA epitope (SEQ ID NO:4) from the GCN4 yeast transcription factor for which a picomolar affinity single chain antibody fragment (H6 scFv, referred to herein as H6) was available (see, e.g., Zahnd et al., J Biol Chem. 2004 Apr 30;279(18):18870-7). The resulting polypeptide is also referred to herein as 1XGCN-d6-38-gD. The genetic modification was obtained by recombination at the endogenous glycoprotein D locus between the oHSV1 genome in a bacterial artificial chromosome (1) and an expression cassette containing the enhanced green fluorescent protein (EGFP) sequence separated from 1XGCN-d6-38-gD by a T2A self-cleaving peptide (see Materials and Methods). Thus, the resulting virus uses the 5' and 3' UTRs of the endogenous US6 locus to control expression of the EGFP-T2A-1XGCN-d6-38-gD cassette, resulting in expression of retargeted 1XGCN-d6-38-gD on the viral surface and expression of EGFP in infected cells.

[0233] The specificity of GCN4 / H6 retargeting and the virus was first tested by infecting B16-F10 and Vero cell lines stably expressing H6-nectin1 fusion protein on their surface. As shown in Figure 6, the GCN4 / H6 retargeted virus was able to infect both Vero and B16-F10 cell lines expressing H6-nectin1, but was unable to infect their parental counterparts. Conversely, oHSV1 expressing wild-type gD glycoprotein was able to infect the parental Vero cell line expressing nectin-1 on its surface, but was unable to infect the B16-F10 parental cell line lacking nectin-1 expression. Overall, these results confirmed that the GCN4 retargeted virus had lost its ability to infect cells using nectin1 as a receptor, but was able to use the H6-nectin1 fusion as its receptor for cell entry.

[0234] For tumor marker retargeting, bispecific adapter proteins were designed by fusing anti-GCN4 H6 scFv to different single-chain binders for the following targets: PSMA (Figure 7), TMEFF2 (Figure 8), KLK2 (Figure 9) and ROR1 (Figure 10). A list of all constructs is shown in Table 1. In the case of PSMA, it was demonstrated that the supernatant of HEK293T cells transiently transfected with PSMA-H6 bispecific expression vector (Figure 7A) successfully retargeted the infection of HEK293T expressing PSMA (Figures 7B and 7C) as well as the PSMA-positive prostate cancer cell line LNCaP, as monitored by GFP expression 24 hours after infection (Figure 7C). Conversely, the bispecific adapter protein was unable to retarget the infection of the parental HEK293T cell line or the PSMA-negative prostate cancer cell line DU145. Similar results were observed for TMEFF2 (Figure 8). Supernatants from HEK293T cells transiently transfected with the bispecific expression vector (Figure 8A) were able to retarget infection to Vero cells stably expressing TMEFF2 on their surface (Figures 8B and 8C) or the TMEFF2-positive prostate cancer cell line 22Rv1 (Figure 8C). The parental Vero cell line lacking human TMEFF2 expression was resistant to infection by GCN4-retargeted viruses. Vero cell lines expressing KLK2 tethered to the cell surface by the transmembrane and cytoplasmic domains of nectin1 (Figures 9B and 9C) were rendered susceptible to infection by GCN4-retargeted HSV1 in the presence of supernatants from HEK293T cells transfected with the KLK2-H6 adaptor expression construct (Figure 9A). In contrast, the parental Vero cell line was resistant. In another example, HEK293T cells expressing ROR1 on their surface (Fig. 10B ) were susceptible to infection by GCN4-retargeted HSV1 in the presence of supernatants from HEK293T cells transfected with a ROR1-H6 adaptor expression construct (Fig. 10C ).

[0235] Taken together, these results demonstrate that retargeting of HSV1 with the GCN4 peptide / H6 scFv pair is efficient and versatile, which can be easily adapted to different formats of binders (scFv, VHH, Darpin) with minimal engineering for various tumor markers.

[0236] HSV retargeting by the leucine zipper RE / ER To demonstrate HSV1 retargeting using a leucine zipper pair (see FIG. 5), a direct in vitro fusion assay using a split protein reporter system was developed. Briefly, a population of cells (effector cells) was transfected with i) a modified gD glycoprotein (RR12EE345L-(G4S)3-d6-38gD) in which amino acids 6-36 were replaced with a leucine zipper of sequence (SEQ ID NO:6) followed by a (G4S)3 linker (SEQ ID NO:126), ii) the three other wild-type glycoprotein components of the HSV1 membrane fusion machinery (gB, gH, and gL), and iii) one of the components of the split protein reporter system pair (cDSP). A protein fusion (designated EE12RR345L-(G4S)3-nectin1) in which the EE12RR345L-leucine zipper (SEQ ID NO: 10) and (G4S)3 linker (SEQ ID NO: 126), complementary to the RR12EE345L-leucine zipper described above, replace AA 31-145 of human nectin1, and the second component of the split protein reporter system pair (nDSP) were transfected into another population (target cells). Upon contacting the target and effector cells, robust luciferase activity could be measured, indicating membrane fusion between the effector and target cells and subsequent reconstitution of the luciferase reporter (Figure 11A). In comparison, no fusion was detected when the EE12RR345L-(G4S)3-nectin1 receptor was omitted from the reaction, indicating that fusion requires the presence of EE12RR345L-(G4S)3-nectin1. Since HEK293T cells naturally express human nectin-1, control reactions also showed that RR12EE345L-(G4S)3-d6-38gD had lost its affinity for its native receptor nectin-1.

[0237] To demonstrate HSV1 retargeting to specific tumor markers using bispecific adapters, the in vitro fusion assay was then repeated in experiments in which transfection of EE12RR345L-(G4S)3-nectin1 in target cells was replaced by transfection of a secreted bispecific adapter composed of the specific tumor marker of interest (PSMA, KLK2-nectin1 fusion, and TMEFF2) and the corresponding binding protein (B588LH, KL2B359LH, and TMEF9LH, respectively) fused to the EE12RR345L-leucine zipper by a GGGGS linker (SEQ ID NO: 124) (see Table 1). As a negative control, the bispecific adapter was omitted from the target cell reaction. As a positive control, effector cells were transfected with modified gD glycoproteins in which amino acids 6-36 were replaced with the corresponding tumor marker binding proteins (B588LH-d6-38gD, KL2B359LH-d6-38gD, and TMEF9LH-d6-38gD, respectively) instead of RR12EE345L-(G4S)3-d6-38gD, and the bispecific adapter was omitted from the transfection of target cells. As shown in Figures 11B-11D, the presence of the bispecific adapter efficiently induces membrane fusion between target and effector cells in a manner comparable to their respective controls (left column), as measured by luciferase activity (right column). In contrast, in the absence of the bispecific adapter, no fusion is detectable (middle column). This confirms that the fusion is specific and mediated by the bispecific adapter.

[0238] Overall, the data in Figures 11A-11D demonstrate that membrane fusion via the HSV1 glycoprotein fusion machinery can be retargeted in the same manner as the GCN4 peptide / H6 scFv pair, instead using a pair of complementary leucine zippers, broadening the scope of HSV1 retargeting strategies using bispecific adapters.

[0239] HSV retargeting by La epitope / 5B9HL scFv To demonstrate HSV1 retargeting using different peptide / scFv pairs, a direct in vitro fusion assay using a split protein reporter system was developed. Briefly, a population of cells (effector cells) was transfected with i) a modified gD glycoprotein in which amino acids 6-36 were replaced with the La epitope (SEQ ID NO: 12) flanked by two linkers (final sequence: GTGSKPLPEVTDEYGGGGSGNS (SEQ ID NO: 13)), designated La-d6-38gD, ii) the three other wild-type glycoprotein components of the HSV1 membrane fusion machinery (gB, gH, and gL), and iii) one of the components of the split protein reporter system pair (cDSP). Another population of cells (target cells) was transfected with the 5B9HL scFv (SEQ ID NO: QVQLVQSGAEVKKPGASVKVSCKASGYTFTHYYIYWVRQAPGQGLEWMGGVNPSNGGTHFNEKFKSRVTMTRDTSISTAYMELSRLRSDDTAVYYCARSEYDYGLGFAYWGQGTLVTVSSGGSEGKSSGSGSESKSTGGSDIVMTQSPDSLAVSLGERATINCKSSQSLLNSRTPKNYLAWYQQKPGQPPKLLIYWASTRKSGVPDRFSGSGSGTDFTLTISSLQAEDVAVYYCKQSYNLLTFGGGTKVEIK (SEQ ID NO: 34)), followed by a protein fusion in which a G4S linker (SEQ ID NO: 124) replaces AA 31-145 of human nectin1 (referred to as 5B9HL-nectin1) and the second component of a split protein reporter system pair (nDSP). Upon contacting the target and effector cells, robust luciferase activity could be measured, indicating membrane fusion between the effector and target cells and subsequent reconstitution of the luciferase reporter (FIG. 12A). In comparison, no fusion was detected when the 5B9HL-nectin1 receptor was omitted from the target cell transfection, indicating that fusion requires the presence of 5B9HL-nectin1. Because HEK293T cells naturally express human nectin1, the control reaction also indicates that La-d6-38gD has lost its affinity for its native receptor nectin1.

[0240] To demonstrate HSV1 retargeting to specific tumor markers using bispecific adapters, the in vitro fusion assays were then repeated in experiments in which transfection of 5B9HL-nectin1 in target cells was replaced by transfection of a secreted bispecific adapter composed of the specific tumor marker of interest (PSMA, KLK2-nectin1 fusion, and TMEFF2) and the corresponding binding protein (B588LH, KL2B359LH, and TMEF9LH, respectively) fused to the 5B9HL scFv by a GGGGS linker (SEQ ID NO: 124) (see Table 1). As a negative control, the bispecific adapter was omitted from the target cell reaction. As a positive control, effector cells were transfected with modified gD glycoproteins in which amino acids 6-36 were substituted for La-d6-38gD with the corresponding tumor marker binding proteins (B588LH-d6-38gD, KL2B359LH-d6-38gD, and TMEF9LH-d6-38gD, respectively), and the bispecific adapter was omitted from the transfection of target cells. As shown in Figures 12B-12D, the presence of the bispecific adapter efficiently induces membrane fusion between target and effector cells in a manner comparable to their respective controls (left column), as measured by luciferase activity (right column). In contrast, in the absence of the bispecific adapter, no fusion is detectable (middle column). This confirms that the fusion is specific and mediated by the bispecific adapter.

[0241] Overall, the data in Figures 12A-12D demonstrate that membrane fusion via the HSV1 glycoprotein fusion machinery can be retargeted using a different peptide / scFv pair (here La / 5B9HL scFv) in the same manner as the GCN4 peptide / H6 scFv pair, broadening the scope of HSV1 retargeting strategies using bispecific adapters.

[0242] [Table 1-1]

[0243]

Table 1-2

[0244]

Table 1-3

[0245]

Table 1-4

[0246]

Table 1-5

[0247]

Table 1-6

[0248]

Table 1-7

[0249]

Table 1-8

[0250]

Table 1-9

[0251]

Table 1-10

[0252]

Table 1-11

[0253]

Table 1-12

[0254]

Table 1-13

[0255]

Table 1-14

[0256]

Table 1-15

[0257]

Table 1-16

[0258]

Table 1-17

[0259]

Table 1-18

[0260]

Table 1-19

[0261]

Table 1-20

[0262]

Table 1-21

Claims

1. 1. A method of retargeting a recombinant herpes simplex virus (HSV) to a tumor cell expressing a TAA, comprising administering to a subject having said tumor cell: (a) the recombinant HSV, said recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide; (b) administering an isolated bispecific adaptor protein comprising a first binding domain that has binding specificity for the heterologous ligand peptide expressed by the recombinant HSV and a second binding domain that has binding specificity for the TAA expressed by the tumor cell; wherein the first binding domain of the bispecific adapter protein binds the heterologous ligand peptide expressed by the recombinant HSV and the second binding domain of the bispecific adapter protein binds the TAA expressed by the tumor cell, thereby retargeting the recombinant HSV to the tumor cell.

2. the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV by insertion into or substitution of a portion of the nucleotide sequence encoding wild-type glycoprotein D (gD); 2. The method of claim 1, wherein optionally, the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace a nucleotide sequence encoding amino acids 6-38 of the wild-type glycoprotein D (gD).

3. (i) (a) the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for the heterologous ligand peptide expressed by the recombinant HSV; Optionally, the antigen-binding fragment having binding specificity for the heterologous ligand peptide is selected from the group consisting of a single chain variable domain (scFv), a single chain antibody VHH, and a polypeptide DARPin. (b) the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for the TAA expressed by the tumor cell; Optionally, said antigen-binding fragment having binding specificity for said TAA is selected from the group consisting of: a scFv, a single chain antibody VHH, a polypeptide DARPin, and / or (ii) (a) the heterologous ligand peptide expressed by the recombinant HSV comprises a GCN4 transcription factor or a fragment thereof; (I) the GCN4 transcription factor or a fragment thereof comprises the amino acid sequence of SEQ ID NO: 4, and / or (II) the first binding domain of the bispecific adaptor protein comprises an antigen-binding fragment having binding specificity for the GCN4 transcription factor or a fragment thereof, e.g. (i) the antigen-binding fragment having binding specificity for the GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a heavy chain variable region (VH) consisting of HCDR1 (SEQ ID NO: 16), HCDR2 (SEQ ID NO: 17) and HCDR3 (SEQ ID NO: 18), and / or a light chain variable region (VL) consisting of LCDR1 (SEQ ID NO: 19), LCDR2 (SEQ ID NO: 20) and LCDR3 (SEQ ID NO: 21); or (ii) the antigen-binding fragment having binding specificity for the GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:22, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:23; or (b) the heterologous ligand peptide expressed by the recombinant HSV comprises a La protein or a fragment thereof; Optionally, (I) the La protein or a fragment thereof comprises the amino acid sequence of SEQ ID NO: 12, and / or (II) the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment having binding specificity for the La protein or a fragment thereof, e.g. (i) the antigen-binding fragment having binding specificity for the La protein or fragment thereof is an anti-La scFv comprising a VH consisting of HCDR1 (SEQ ID NO:26), HCDR2 (SEQ ID NO:27) and HCDR3 (SEQ ID NO:28), and / or a VL consisting of LCDR1 (SEQ ID NO:29), LCDR2 (SEQ ID NO:30) and LCDR3 (SEQ ID NO:31); or 3. The method of claim 1 or 2, wherein (ii) the antigen-binding fragment that has binding specificity for the La protein or fragment thereof is an anti-La scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 32, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:

33.

4. the heterologous ligand peptide expressed by the recombinant HSV comprises a first leucine zipper portion, the first binding domain of the bispecific adapter protein comprises a second leucine zipper portion, and the first and second leucine zipper portions are capable of forming a leucine zipper dimer. Optionally, the first leucine zipper moiety is a synthetic leucine zipper moiety RE (SEQ ID NO: 6) and the second leucine zipper moiety is a synthetic leucine zipper moiety ER (SEQ ID NO: 10), or the first leucine zipper moiety is a synthetic leucine zipper moiety ER (SEQ ID NO: 10) and the second leucine zipper moiety is a synthetic leucine zipper moiety RE (SEQ ID NO: 6).

5. Optionally, the TAA expressed by the tumor cells is selected from the group consisting of PSMA, TMEFF2, ROR1, KLK2, and HLA-G; (i) wherein the TAA expressed by the tumor cell is PSMA and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for PSMA, e.g., (a) the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 35), HCDR2 (SEQ ID NO: 36) and HCDR3 (SEQ ID NO: 37); (b) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH comprising a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 38; (c) the antigen-binding fragment with binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 39), HCDR2 (SEQ ID NO: 40) and HCDR3 (SEQ ID NO: 41); (d) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH comprising a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 42; (e) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH consisting of HCDR1 (SEQ ID NO:43), HCDR2 (SEQ ID NO:44), and HCDR3 (SEQ ID NO:45), and / or a VL consisting of LCDR1 (SEQ ID NO:46), LCDR2 (SEQ ID NO:47), and LCDR3 (SEQ ID NO:48); or (f) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 49, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:

50. (ii) wherein the TAA expressed by the tumor cell is TMEFF2, and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for TMEFF2, e.g., (a) the antigen-binding fragment having binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 53), HCDR2 (SEQ ID NO: 54), and HCDR3 (SEQ ID NO: 55), and / or a VL consisting of LCDR1 (SEQ ID NO: 56), LCDR2 (SEQ ID NO: 57), and LCDR3 (SEQ ID NO: 58), for example (b) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:59, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:60; (c) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO:61), HCDR2 (SEQ ID NO:62), and HCDR3 (SEQ ID NO:63), and / or a VL consisting of LCDR1 (SEQ ID NO:64), LCDR2 (SEQ ID NO:65), and LCDR3 (SEQ ID NO:66); or (d) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:67, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:68; (iii) and wherein the TAA expressed by the tumor cell is KLK2, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment having binding specificity for KLK2, e.g., (a) the antigen-binding fragment having binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 72), HCDR2 (SEQ ID NO: 73), and HCDR3 (SEQ ID NO: 74), and / or a VL consisting of LCDR1 (SEQ ID NO: 75), LCDR2 (SEQ ID NO: 76), and LCDR3 (SEQ ID NO: 77); (b) the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:78, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:79; or (c) the antigen-binding fragment having binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 80, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 81; (iv) the TAA expressed by the tumor cell is HLA-G and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for HLA-G; or (v) wherein the TAA expressed by the tumor cell is ROR1, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for ROR1, e.g., 5. The method of any one of claims 1 to 4, wherein the antigen-binding fragment that has binding specificity for ROR1 is a polypeptide DARPin having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:

94.

6. A method of treating cancer in a subject, the method comprising administering to the subject: (a) a recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide; and (b) administering an isolated bispecific adaptor protein comprising a first binding domain that has binding specificity for the heterologous ligand peptide expressed by the recombinant HSV and a second binding domain that has binding specificity for the TAA expressed by the cancer cell; The first binding domain of the bispecific adaptor protein binds the heterologous ligand peptide expressed by the recombinant HSV, and the second binding domain of the bispecific adaptor protein binds the TAA expressed by the cancer cell, thereby causing oncolysis of the cancer cell. Optionally, the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV by insertion into or substitution of a portion of a nucleotide sequence encoding wild-type glycoprotein D (gD), e.g. the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6-38 of wild-type gD.

7. A bispecific adapter protein for retargeting recombinant HSV to a tumor cell, the bispecific adapter protein comprising a first binding domain having binding specificity for a heterologous ligand peptide expressed by the recombinant HSV, and a second binding domain having binding specificity for a TAA expressed by the tumor cell.

8. (i) Each of the first and second binding domains of the bispecific adapter protein comprises an antigen-binding fragment, e.g. the antigen-binding fragment is selected from the group consisting of an scFv, a single chain antibody VHH, and a polypeptide DARPin; and / or (ii) (a) the first binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for a GCN4 transcription factor or a fragment thereof, e.g. (I) the antigen-binding fragment having binding specificity for GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 16), HCDR2 (SEQ ID NO: 17) and HCDR3 (SEQ ID NO: 18), and / or a VL consisting of LCDR1 (SEQ ID NO: 19), LCDR2 (SEQ ID NO: 20) and LCDR3 (SEQ ID NO: 21); or (II) the antigen-binding fragment having binding specificity for GCN4 transcription factor or a fragment thereof is an anti-GCN4 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:22, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:23; or (b) the first binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for La protein or a fragment thereof, e.g. (I) The antigen-binding fragment having binding specificity for La protein or a fragment thereof is an anti-La scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 26), HCDR2 (SEQ ID NO: 27) and HCDR3 (SEQ ID NO: 28), and / or a VL consisting of LCDR1 (SEQ ID NO: 29), LCDR2 (SEQ ID NO: 30) and LCDR3 (SEQ ID NO: 31); (II) The bispecific adapter protein of claim 7, wherein the antigen-binding fragment having binding specificity for a La protein or a fragment thereof is an anti-La scFv comprising a VH having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 32, and / or a VL having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:

33.

9. the first binding domain of the bispecific adapter protein comprises a leucine zipper portion; 8. The bispecific adapter protein of claim 7, optionally wherein the leucine zipper moiety is a synthetic leucine zipper moiety RE (SEQ ID NO: 6) or a synthetic leucine zipper moiety ER (SEQ ID NO: 10). (i) the TAA expressed by the tumor cell is PSMA, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for PSMA. Optionally, (a) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 35), HCDR2 (SEQ ID NO: 36), and HCDR3 (SEQ ID NO: 37); (b) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH comprising a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 38; (c) the antigen-binding fragment having binding specificity for PSMA is an anti-PSMA VHH comprising HCDR1 (SEQ ID NO: 39), HCDR2 (SEQ ID NO: 40), and HCDR3 (SEQ ID NO: 41); (d) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA VHH comprising a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 42; (e) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH consisting of HCDR1 (SEQ ID NO:43), HCDR2 (SEQ ID NO:44), and HCDR3 (SEQ ID NO:45), and / or a VL consisting of LCDR1 (SEQ ID NO:46), LCDR2 (SEQ ID NO:47), and LCDR3 (SEQ ID NO:48); or (f) the antigen-binding fragment that has binding specificity for PSMA is an anti-PSMA scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:49, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:50; (ii) the TAA expressed by the tumor cell is TMEFF2, and the second binding domain of the bispecific adaptor protein comprises an antigen-binding fragment that has binding specificity for TMEFF2; and (a) the antigen-binding fragment having binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 53), HCDR2 (SEQ ID NO: 54), and HCDR3 (SEQ ID NO: 55), and / or a VL consisting of LCDR1 (SEQ ID NO: 56), LCDR2 (SEQ ID NO: 57), and LCDR3 (SEQ ID NO: 58); (b) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:59, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:60; (c) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO:61), HCDR2 (SEQ ID NO:62), and HCDR3 (SEQ ID NO:63), and / or a VL consisting of LCDR1 (SEQ ID NO:64), LCDR2 (SEQ ID NO:65), and LCDR3 (SEQ ID NO:66); or (d) the antigen-binding fragment with binding specificity for TMEFF2 is an anti-TMEFF2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:67, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:68; (iii) the TAA expressed by the tumor cell is KLK2, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for KLK2, e.g., (a) the antigen-binding fragment having binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH consisting of HCDR1 (SEQ ID NO: 72), HCDR2 (SEQ ID NO: 73), and HCDR3 (SEQ ID NO: 74), and / or a VL consisting of LCDR1 (SEQ ID NO: 75), LCDR2 (SEQ ID NO: 76), and LCDR3 (SEQ ID NO: 77); (b) the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:78, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:79; or (c) the antigen-binding fragment with binding specificity for KLK2 is an anti-KLK2 scFv comprising a VH having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 80, and / or a VL having a polypeptide sequence at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO: 81; (iv) the TAA expressed by the tumor cell is HLA-G and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for HLA-G; or (v) the TAA expressed by the tumor cell is ROR1, and the second binding domain of the bispecific adapter protein comprises an antigen-binding fragment that has binding specificity for ROR1; 10. The bispecific adaptor protein of any one of claims 7 to 9, wherein the antigen-binding fragment that has binding specificity for ROR1 is a polypeptide DARPin having a polypeptide sequence that is at least 95%, or at least 96%, or at least 97%, or at least 98%, or at least 99%, or 100% identical to SEQ ID NO:

94.

11. 11. An isolated nucleic acid molecule comprising a polynucleotide sequence encoding the isolated bispecific adapter protein of any one of claims 7 to 10.

12. 12. An isolated vector comprising the isolated nucleic acid sequence of claim 11.

13. A recombinant host cell comprising the isolated vector of claim 12. (i) a recombinant HSV according to any one of claims 1 to 5, and instructions for use of the recombinant HSV, (ii) an isolated bispecific adapter protein according to any one of claims 7 to 10 and instructions for use of said bispecific adapter protein; or (iii) 13. A kit comprising a recombinant HSV according to any one of claims 1 to 5, an isolated adapter protein according to any one of claims 7 to 10, and instructions for use.

15. (i) A recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide, said heterologous ligand peptide comprising a La protein or a fragment thereof, said nucleotide sequence encoding said heterologous ligand peptide being inserted into said recombinant HSV by insertion into or replacement of a portion that replaces wild-type gD, optionally (a) the nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV to replace the nucleotide sequence encoding amino acids 6 to 38 of wild-type gD; and / or (b) the La protein or a fragment thereof comprises the amino acid sequence of SEQ ID NO: 12; or (ii) a recombinant HSV comprising a nucleotide sequence encoding a heterologous ligand peptide, said heterologous ligand peptide comprising a leucine zipper portion, said nucleotide sequence encoding said heterologous ligand peptide being inserted into said recombinant HSV by insertion into or substitution of a portion of a wild-type gD; The nucleotide sequence encoding the heterologous ligand peptide is inserted into the recombinant HSV replacing the nucleotide sequence encoding amino acids 6-38 of wild-type gD, e.g. The recombinant HSV, wherein the leucine zipper portion is a synthetic leucine zipper portion RE (SEQ ID NO: 6) or a synthetic leucine zipper portion ER (SEQ ID NO: 10).

Images