Chimeric antigen receptors replacing single-domain antibodies with endogenous protein molecules

Abstract

The present application provides an endogenous chimeric antigen receptor CAR (ECAR), in which the antigen-binding domain in the endogenous chimeric antigen receptor is an endogenous protein molecule. The engineered immune cells of the present invention can specifically and selectively kill several types of cells.

Description

[Technical field]

[0001] The present invention relates to the field of immunotherapy, specifically to chimeric antigen receptors that replace single domain antibodies with endogenous protein molecules. [Background technology]

[0002] With the development of cellular immunotherapy and its successful clinical application, chimeric antigen receptor T cell (CAR T) immunotherapy is currently one of the most promising approaches to tumor immunotherapy. Chimeric antigen receptor T cells (CAR T) are T cells that, after genetic modification, can specifically recognize specific antigens in the human body and kill target cells in which the specific antigens are present. Chimeric antigen receptors (CARs) can be expressed by modifying T lymphocytes through techniques such as viral infection, and T cells modified with such chimeric antigen receptors (CARs) can specifically recognize and bind to target antigens in a non-MHC-restricted manner, and specifically kill target cells. Chimeric antigen receptors (CARs) include an extracellular antigen-binding domain, a transmembrane domain, and an intracellular signaling domain. Currently, the extracellular antigen-binding domain is mainly a single-domain antibody, and specific single-domain antibodies are designed and manufactured against specific target antigens, one of the reasons being that these target antigens are mainly tumor surface-specific markers and lack corresponding ligands in the body.

[0003] In a clinical study of CAR T targeting mesothelin (2013), it was found that a single domain of a murine antibody in a chimeric antigen receptor caused an allergic reaction, and one of the subjects died. This demonstrated that chimeric antigen receptors with a single domain antibody as the extracellular binding domain have a rejection problem in clinical practice. In addition, chimeric antigen receptors with an antibody single chain variable fragment (scFv) as the extracellular antigen binding domain have problems such as a long manufacturing process, high time costs, high economic costs, and high difficulty in antibody screening.

[0004] Therefore, there is a strong demand in this field for the development of a new chimeric antigen receptor that can avoid rejection reactions and has good tolerance. Summary of the Invention

[0005] The object of the present invention is to provide a new chimeric antigen receptor which avoids rejection reactions and is well tolerated.

[0006] In a first aspect of the present invention, there is provided an endogenous chimeric antigen receptor CAR (ECAR), which comprises an antigen-binding domain that is an endogenous protein molecule.

[0007] In another preferred embodiment, the endogenous protein molecule is selected from the group consisting of the interleukin family, the chemokine family, a colony-stimulating factor, a growth factor, a tumor necrosis factor superfamily, an interferon family, a tumor marker, a senescent cell-associated factor, or a combination thereof.

[0008] In another preferred embodiment, the interleukin family is selected from the group consisting of IL1α (interleukin 1α), IL1β (interleukin 1β), IL2 (interleukin 2), IL3 (interleukin 3), IL4 (interleukin 4), IL5 (interleukin 5), IL6 (interleukin 6), IL9 (interleukin 9), IL10 (interleukin 10), IL12 (interleukin 12), IL13 (interleukin 13), IL14 (interleukin 14), IL17A (interleukin 17A), IL17B (interleukin 17B), IL17C (interleukin 17C), IL17E (interleukin 17E), IL17F (interleukin 17F), IL33 (interleukin 33), or a combination thereof.

[0009] In another preferred embodiment, the chemokine family is selected from the group consisting of CCL1, CCL2, CCL3, CCL4, CCL5, CCL6, CCL7, CCL8, CCL9, CCL10, CCL11, CCL12, CCL13, CCL14, CCL15, CCL16, CCL17, CCL18, CCL19, CCL20, CCL21, CCL22, CCL23, CCL24, CCL25, CCL26, CCL27, CCL28, The antibody is selected from the group consisting of CXCL1, CXCL2, CXCL3, CXCL4, CXCL5, CXCL6, CXCL7, CXCL8, CXCL9, CXCL10, CXCL11, CXCL12, CXCL13, CXCL14, CXCL15, CXCL16, CXCL17, XCL1, XCL2, CX3CL1, GRO / MGSA (melanoma growth stimulating activity), PF-4 (platelet factor 4), platelet basic protein, IP-10 (inflammatory protein-10), ENA-78, MIP-1α (macrophage inflammatory protein 1α), MIP-1β, MCP-1 / MCAF (monocyte chemotactic protein-1), MCP-2, MCP-3, or a combination thereof.

[0010] In another preferred embodiment, the colony stimulating factor is selected from the group consisting of G-CSF, M-CSF, GM-CSF, or a combination thereof.

[0011] In another preferred embodiment, the growth factor is selected from the group consisting of EGF (epidermal growth factor), VEGF (vascular endothelial growth factor), FGF (fibroblast growth factor), PDGF (platelet-derived endothelial growth factor), HGF (hepatocyte growth factor), IGF-I (insulin-like growth factor), IGF-II, LIF (leukemia inhibitory factor), NGF (nerve growth factor), TGF-α (transforming growth factor), TGF-β1, TGF-β2, TGF-β3, TGFβ1β2, BMP (bone morphogenetic protein), or a combination thereof.

[0012] In another preferred embodiment, the tumor necrosis factor is selected from the group consisting of TNF-α, TNF-β, or a combination thereof.

[0013] In another preferred embodiment, the interferon family is selected from the group consisting of IFN-α (interferon α), IFN-β (interferon β), IFN-γ (interferon γ), or a combination thereof.

[0014] In another preferred embodiment, the tumor marker is selected from the group consisting of CEA (serum carcinoembryonic antigen), AFP (alpha-fetoprotein), PSA (prostate specific antigen), or a combination thereof.

[0015] In another preferred embodiment, the senescent cell-associated factor comprises Plau (urokinase-type plasminogen activator).

[0016] In another preferred embodiment, the endogenous protein molecule includes a wild-type endogenous protein molecule and a mutant endogenous protein molecule.

[0017] In another preferred embodiment, the mutant forms include mutations in which the function of the encoded protein after mutation is unchanged (i.e., the function is the same or nearly the same as that of the protein encoded by the wild type) and mutations in which the function is enhanced.

[0018] In another preferred embodiment, the endogenous protein molecule comprises a full-length protein or a fragment of a protein.

[0019] In another preferred embodiment, the endogenous protein molecule is from a mammal, preferably a rodent (eg, mouse, rat), a primate, or a human. In another preferred embodiment, the endogenous protein molecule further comprises a derivative of the endogenous protein molecule.

[0020] In another preferred embodiment, the endogenous protein molecule includes a modified endogenous protein molecule, a protein molecule whose amino acid sequence is homologous to a naturally occurring endogenous protein molecule, a dimer or multimer of an endogenous protein molecule, or a fusion protein containing the amino acid sequence of an endogenous protein molecule.

[0021] In another preferred embodiment, the modified endogenous protein molecule is a PEGylated endogenous protein molecule.

[0022] In another preferred embodiment, the "protein molecule whose amino acid sequence is homologous to a natural endogenous protein molecule and has the peptide activity of the natural endogenous protein" refers to a protein molecule whose amino acid sequence has ≧85% homology, preferably ≧90% homology, more preferably ≧95% homology, and most preferably 98% homology, compared to the endogenous protein molecule, and has the peptide activity of the natural endogenous protein.

[0023] In another preferred embodiment, the polypeptide encoded by the gene for said mutant endogenous protein molecule is similar or substantially similar to the polypeptide encoded by the gene for the wild-type endogenous protein molecule.

[0024] In another preferred embodiment, the gene of the mutant endogenous protein molecule comprises a polynucleotide having a homology of ≧80% (preferably ≧90%, more preferably ≧95%, and even more preferably ≧98% or 99%) compared to the gene of the wild-type endogenous protein molecule.

[0025] In another preferred embodiment, the gene of the mutant endogenous protein molecule comprises a polynucleotide in which the 5' end and / or the 3' end of the gene of the wild-type endogenous protein molecule has been shortened or 1 to 60 nucleotides (preferably 1 to 30 nucleotides, more preferably 1 to 10 nucleotides) have been added.

[0026] In another preferred embodiment, the amino acid sequence of the endogenous protein molecule is selected from the group consisting of: (i) an amino acid sequence represented by any one of SEQ ID NOs: 1 to 5; (ii) a polypeptide derived from (i), which has the peptide activity of the endogenous protein and has an amino acid sequence represented by any one of SEQ ID NOs: 1 to 5 through the substitution, deletion or addition of one or more (e.g., 1 to 10) amino acid residues; or (iii) A polypeptide derived from (i), whose amino acid sequence has a homology of ≥80% (preferably ≥90%, more preferably ≥95% or ≥98%) with an amino acid sequence shown in any one of SEQ ID NOs: 1 to 5, and has the peptide activity of the endogenous protein.

[0027] In another preferred embodiment, the structure of the endogenous chimeric antigen receptor CAR (ECAR) is represented by formula I:

[0028] [Formula 1] L-Z1-Z2-TM-C-CD3ζ (I)

[0029] (In the formula, Each "-" is independently a linking peptide or a peptide bond. L is optionally a signal peptide sequence. Z1 is an antigen-binding domain that is an endogenous protein molecule. Z2 is absent or is the hinge region. TM is the transmembrane domain. C is a costimulatory signal molecule. CD3ζ is an intracellular signaling sequence derived from CD3ζ.

[0030] In another preferred embodiment, L is a signal peptide of a protein selected from the group consisting of CD8, CD8α, CD28, GM-CSF, CD4, CD137, FcRγ, FcRβ, CD3ζ, CD3γ, CD3δ, CD3ε, CD5, CD22, CD20, CD79a, CD79b, CD278 (ICOS), FcERI, CD66d, DAP10, DAP12, or a combination thereof.

[0031] In another preferred embodiment, the signal peptide of L is the signal peptide of human CD8, and has the amino acid sequence MALPVTALLLPLALLLHAARP (SEQ ID NO: 16).

[0032] In another preferred embodiment, the signal peptide of L is the signal peptide of murine CD8, the amino acid sequence of which is MASPLTRFLSLNLLLLGESIILGSGEA (SEQ ID NO: 17).

[0033] In another preferred embodiment, Z2 is a hinge region of a protein selected from the group consisting of CD8, CD8α, CD28, CD137, Ig (immunoglobulin) hinge, or a combination thereof.

[0034] In another preferred embodiment, Z2 comprises a wild-type hinge region and a mutant hinge region.

[0035] In another preferred embodiment, the mutant comprises a fused hinge region in which one or more amino acids are deleted, added or substituted in the hinge region of the protein, or a combination thereof.

[0036] In another preferred embodiment, Z2 is a human CD28 hinge region having the amino acid sequence IEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKP (SEQ ID NO: 18).

[0037] In another preferred embodiment, Z2 is a human CD8α hinge region having the amino acid sequence TTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD (SEQ ID NO: 19).

[0038] In another preferred embodiment, Z2 is a murine CD8α hinge region having the amino acid sequence STTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDFACDIY (SEQ ID NO: 20).

[0039] In another preferred embodiment, the TM is a transmembrane region of a protein selected from the group consisting of CD28, CD3ε, CD45, CD4, CD5, CD8, CD9, CD16, CD22, CD33, CD37, CD64, CD80, CD86, CD134, CD137, CD154, CD8α, ICOS, CD19, CD45, or a combination thereof.

[0040] In another preferred embodiment, the TM transmembrane domain comprises a wild-type protein transmembrane domain and a mutant protein transmembrane domain.

[0041] In another preferred embodiment, the mutant comprises a fusion protein transmembrane domain in which one or more amino acids are deleted, added or substituted in the transmembrane domain of said protein, or a combination thereof.

[0042] In another preferred embodiment, the TM is a transmembrane domain selected from human CD28 protein, and has the amino acid sequence FWVLVVVGGVLACYSLLVTVAFIIFWV (SEQ ID NO: 21).

[0043] In another preferred embodiment, the TM is a transmembrane domain selected from human CD8 protein, and has the amino acid sequence IYIWAPLAGTCGVLLLSLVIT (SEQ ID NO: 22).

[0044] In another preferred embodiment, the TM is a transmembrane domain selected from the murine CD8 protein and has the amino acid sequence IWAPLAGICVALLLSLIITLI (SEQ ID NO:23).

[0045] In another preferred embodiment, C is selected from the group consisting of CD28, CD27, CD3ζ, CD3γ, CD3δ, CD3ε, CD5, CD22, CD79a, CD79b, CD66d, CD2, CD4, CD5, CD30, CD40, CD134, CD137, ICOS, CD154, 4-1BB, OX40, CD7, LIGHT, NKG2C, B7-H3, OX40, activating NK cell receptor, BTLA, Toll ligand receptor, CD2, CD7, CD27, CD30, CD40, CDS, ICAM-L LFA-1 (CD11a / CD18), B7-H3, CDS, ICAM-1, ICOS (CD278), GITR, BAFFR, HVEM (LIGHTR), KIRDS2, SLAMF7, NKp8 0(KLRF1), NKp44, NKp30, NKp46, CD19, CD4, CD8α, CD8β, IL2Rβ, IL2Rγ, IL7Rα, ITGA4, VLA1, CD49a, ITGA 4, IA4, CD49D, ITGA6, VLA-6, CD49f, ITGAD, CD11d, ITGAE, CD103, ITGAL, CD11a, LFA-1, ITGAM, CD11b, ITGAX, CD11c, ITGB1, CD29, ITGB2, CD18, LFA-1, ITGB7, NKG2D, NKG2C, TNFR2, TRANCE / RANKL, DNAM1(CD 226), SLAMF4 (CD244, 2B4), CD84, CD96 (tactile), CEACAM1, CRTAM, Ly9 (CD229), CD160 (BY55), PSGL1, CD100 (SEMA4D), CD69, SLAMF6 (NTBA, Ly108), SLAM (SLAMF1, CD150, IPO-3), BLAME (SLAMF8), SELPLG (CD162), LTBR, ​​LAT, GADS, SLP-76, PAG / Cbp, CD19a, DAP10, DAP12, a ligand for CD83, an MHC class I molecule, a TNF receptor protein, an immunoglobulin-like protein, a cytokine receptor, an integrin, a signaling lymphocyte activation molecule, or a combination thereof.

[0046] In another preferred embodiment, C is a costimulatory signal molecule from human CD28, and has the amino acid sequence RSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRS (SEQ ID NO: 24).

[0047] In another preferred embodiment, C is a costimulatory signal molecule from human 4-1BB, the amino acid sequence of which is KRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCEL (SEQ ID NO: 25).

[0048] In another preferred embodiment, C is a costimulatory signal molecule from murine CD28, the amino acid sequence of which is NSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRP (SEQ ID NO: 26).

[0049] In another preferred embodiment, said CD3ζ is the intracellular domain of the CD3ζ protein molecule.

[0050] In another preferred embodiment, the CD3 ζ comprises an intracellular domain of a wild-type CD3 ζ protein molecule and an intracellular domain of a mutant CD3 ζ protein molecule. In another preferred embodiment, the mutant amino acid sequence includes a fusion amino acid sequence in which one or more amino acids are deleted, added or substituted in the amino acid sequence of the intracellular region of the CD3ζ protein molecule, or a combination thereof.

[0051] In another preferred embodiment, the CD3ζ is an intracellular domain of a human-derived CD3ζ protein molecule, and the amino acid sequence is RVKFSRSADAPAYKQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 27).

[0052] In another preferred embodiment, the CD3ζ is an intracellular domain of a murine-derived CD3ζ protein molecule, the amino acid sequence of which is RAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPR (SEQ ID NO: 28).

[0053] In another preferred embodiment, the amino acid sequence of the endogenous chimeric antigen receptor CAR (ECAR) is represented by any one of SEQ ID NOs: 6 to 10.

[0054] In a second aspect of the invention, there is provided a nucleic acid molecule encoding an endogenous chimeric antigen receptor CAR (ECAR) according to the first aspect of the invention.

[0055] In another preferred embodiment, the nucleic acid molecule is selected from the group consisting of: (a) a polynucleotide encoding a polypeptide shown in any one of SEQ ID NOs: 1 to 5; (b) a polynucleotide having a sequence represented by any one of SEQ ID NOs: 11 to 15; (c) a polynucleotide having a nucleotide sequence identity of ≥75% (preferably ≥80%, more preferably ≥90%, more preferably ≥95%, more preferably ≥98%, and even more preferably ≥99%) with the sequence shown in (b); (d) a polynucleotide in which the 5'-terminus and / or the 3'-terminus of the polynucleotide (b) has been shortened or 1 to 60 nucleotides (preferably 1 to 30 nucleotides, more preferably 1 to 10 nucleotides) have been added; (e) A polynucleotide complementary to any one of the polynucleotides (a) to (d).

[0056] In another preferred embodiment, the nucleotide sequence of the nucleic acid molecule is shown in any one of SEQ ID NOs: 11 to 15.

[0057] In another preferred embodiment, the nucleic acid molecule is a polynucleotide.

[0058] In a third aspect of the invention there is provided a vector comprising a nucleic acid molecule according to the second aspect of the invention.

[0059] In another preferred embodiment, the vector is selected from the group consisting of a plasmid, a lentiviral vector, an adenoviral vector, a retroviral vector, or a combination thereof.

[0060] In another preferred embodiment, the vector is a lentiviral vector.

[0061] In another preferred embodiment, the vector is a retroviral vector.

[0062] In a fourth aspect of the invention, there is provided a host cell which contains a vector according to the third aspect of the invention or has chromosomally integrated an exogenous nucleic acid molecule according to the second aspect of the invention or which expresses an ECAR according to the first aspect of the invention.

[0063] In another preferred embodiment, the cell is an isolated cell and / or the cell is a genetically engineered cell.

[0064] In another preferred embodiment, the cell is a mammalian cell.

[0065] In another preferred embodiment, the cell is a macrophage, a T cell or a NK cell.

[0066] In another preferred embodiment, the host cell is an engineered immune cell.

[0067] In another preferred embodiment, the engineered immune cells comprise macrophages, T cells or NK cells, preferably (i) endogenous chimeric antigen receptor T cells (ECAR-T cells), (ii) endogenous chimeric antigen receptor NK cells (ECAR-NK cells), (iii) exogenous T cell receptor (TCR) T cells (TCR-T cells) or (iv) endogenous chimeric antigen receptor macrophages (ECAR-macrophages).

[0068] In another preferred embodiment, the immune cells are autologous.

[0069] In another preferred embodiment, the immune cells are non-autologous.

[0070] In another preferred embodiment, the immune cells target target cells that express a receptor corresponding to an endogenous protein molecule.

[0071] In a fifth aspect of the invention there is provided a method of producing an engineered immune cell expressing ECAR as defined in the first aspect of the invention, the method comprising the step of obtaining said engineered immune cell by transducing a nucleic acid molecule as defined in the second aspect of the invention or a vector as defined in the third aspect of the invention into a macrophage, a T cell or a NK cell.

[0072] In another preferred embodiment, the introducing includes introducing simultaneously, one after the other, or sequentially.

[0073] In another preferred embodiment, the cells are ECAR-macrophages, ECAR-T cells or ECAR-NK cells.

[0074] In another preferred embodiment, the method further comprises the step of performing functional and efficacy detection on the resulting engineered immune cells.

[0075] In a sixth aspect of the invention there is provided a pharmaceutical composition comprising an ECAR according to the first aspect of the invention, a nucleic acid molecule according to the second aspect of the invention, a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, together with a pharma- ceutically acceptable carrier, diluent or excipient.

[0076] In another preferred embodiment, the pharmaceutical composition is a liquid formulation.

[0077] In another preferred embodiment, the pharmaceutical composition is in the form of an injection.

[0078] In another preferred embodiment, the pharmaceutical composition has a cell concentration of 1×10 5 ~1×10 8 cells / mL, preferably 1 x 10 6 ~1×10 7 cells / mL, more preferably 1×10 6 ~5×10 6 Cells / mL.

[0079] In another preferred embodiment, the pharmaceutical composition further comprises another drug that kills cells (e.g., an antibody drug, another CAR-T drug, or a chemotherapy drug).

[0080] In another preferred embodiment, the pharmaceutical composition further comprises a drug that regulates the expression of ECAR described in the first aspect of the present invention, a drug that regulates the killing function and cellular activity of a host cell described in the fourth aspect of the present invention, a drug that regulates an immune response in the host body, and a drug that regulates a side reaction (e.g., a T cell apoptosis signal pathway inhibitor, a neutralizing antibody that resists cytokine storm).

[0081] In a seventh aspect of the invention, there is provided the use of an ECAR according to the first aspect of the invention, a nucleic acid molecule according to the second aspect of the invention, a vector according to the third aspect of the invention, a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the sixth aspect of the invention, for the manufacture of a drug or formulation for use in (a) selectively killing cells, and / or (b) treating a disease.

[0082] In another preferred embodiment, the cell contains a receptor that corresponds to an endogenous protein molecule.

[0083] In another preferred embodiment, the cells are selected from the group consisting of inflammatory cells, senescent cells, tumor cells, autoimmune cells, or combinations thereof.

[0084] In another preferred embodiment, the disease is selected from the group consisting of a tumor disease, an allergic disease, an autoimmune disease, a senescence cell-associated disease, or a combination thereof.

[0085] In another preferred embodiment, the tumor disease is selected from the group consisting of malignant / benign tumors derived from epithelial cells, malignant / benign tumors derived from mesenchymal cells, malignant / benign tumors derived from blood stem cells, and malignant / benign tumors derived from neuroepithelial cells.

[0086] In another preferred embodiment, the allergic disease is selected from the group consisting of skin allergic disease, airway allergic disease, gastrointestinal allergic disease, allergic shock, or a combination thereof.

[0087] In another preferred embodiment, the autoimmune disease is selected from the group consisting of rheumatoid arthritis, systemic lupus erythematosus, psoriasis, type 1 diabetes, inflammatory bowel disease, celiac disease, multiple sclerosis, aplastic anemia, Graves' disease, or a combination thereof.

[0088] In another preferred embodiment, the aging-related disease is selected from the group consisting of aging-related liver fibrosis, aging-related pulmonary fibrosis, aging-related atherosclerosis, aging-related diabetes, aging-related osteoarthritis, aging-related sarcopenia, aging-related obesity, and aging-related glaucoma.

[0089] In an eighth aspect of the present invention there is provided a kit for selectively killing cells comprising a container and, located within the container, an ECAR according to the first aspect of the invention, a nucleic acid molecule according to the second aspect of the invention, a vector according to the third aspect of the invention, a host cell according to the fourth aspect of the invention or a pharmaceutical composition according to the sixth aspect of the invention.

[0090] In another preferred embodiment, the kit further comprises a tag or instruction manual.

[0091] In a ninth aspect of the present invention, there is provided a method of selectively killing cells, the method comprising the steps of: A safe and effective amount of an ECAR according to the first aspect of the invention, a host cell according to the fourth aspect of the invention, or a pharmaceutical composition according to the sixth aspect of the invention is administered to a subject in need of treatment.

[0092] In another preferred embodiment, the subject comprises a human or non-human mammal.

[0093] In another preferred embodiment, the non-human mammals include rodents (eg, mice, rats, rabbits), primates (eg, monkeys), and boars.

[0094] In another preferred embodiment, the method is non-therapeutic and non-diagnostic.

[0095] In a tenth aspect of the invention, there is provided a method of treating a disease, the method comprising administering to a subject in need of treatment a safe and effective amount of an ECAR according to the first aspect of the invention, a host cell according to the fourth aspect of the invention or a pharmaceutical composition according to the sixth aspect of the invention.

[0096] In another preferred embodiment, the method further comprises administering to the subject in need of treatment another drug for treating a tumor disease, an allergic disease, an autoimmune disease, or a senescence cell-associated disease.

[0097] In another preferred embodiment, the other drugs include other drugs that kill cells (e.g., antibody drugs, other CAR-T drugs, and chemotherapy drugs), drugs that regulate the expression of endogenous chimeric antigen receptors, drugs that regulate the killing ability and cellular activity of host cells, drugs that regulate immune responses in the host body, drugs that regulate side effects, and CAR-T drugs.

[0098] In another preferred embodiment, the disease is selected from the group consisting of a tumor disease, an allergic disease, an autoimmune disease, a senescence cell-associated disease, or a combination thereof.

[0099] In another preferred embodiment, the tumor disease is selected from the group consisting of malignant / benign tumors derived from epithelial cells, malignant / benign tumors derived from mesenchymal cells, malignant / benign tumors derived from blood stem cells, and malignant / benign tumors derived from neuroepithelial cells.

[0100] In another preferred embodiment, the allergic disease is selected from the group consisting of skin allergic disease, airway allergic disease, gastrointestinal allergic disease, allergic shock, or a combination thereof.

[0101] In another preferred embodiment, the autoimmune disease is selected from the group consisting of rheumatoid arthritis, systemic lupus erythematosus, psoriasis, type 1 diabetes, inflammatory bowel disease, celiac disease, multiple sclerosis, aplastic anemia, Graves' disease, or a combination thereof.

[0102] In another preferred embodiment, the aging-related disease is selected from the group consisting of aging-related liver fibrosis, aging-related pulmonary fibrosis, aging-related atherosclerosis, aging-related diabetes, aging-related osteoarthritis, aging-related sarcopenia, aging-related obesity, and aging-related glaucoma.

[0103] Of course, it is understood that within the scope of the present invention, new or preferred technical solutions may be constituted between the above technical features of the present invention and the technical features specifically described below (for example, in the Examples), which will not be described one by one here due to space limitations. [Brief description of the drawings]

[0104] [Figure 1] FIG. 1 is a diagram of the hIL5-ECAR plasmid. [Diagram 2] FIG. 2. Detection of activation after co-cultivation of the hIL5-ECAR Jurkat cell line with target cells expressing hIL5Ra. [Diagram 3] Figure 3: CAR expression efficiency 72 hours after rotational infection of human T cells with lentivirus of hIL5-ECAR T cells. [Figure 4] FIG. 4 shows the specific killing effect after co-culturing hIL5-ECAR T with target cells expressing hIL5Ra. [Diagram 5] FIG. 5 shows IFN-γ secretion after co-culture of hIL5-ECAR T and target cells expressing hIL5Ra. [Figure 6] FIG. 6 is a diagram of the mIL5-ECAR plasmid. [Figure 7] FIG. 7 shows the CAR expression efficiency 48 hours after rotational infection of mouse T cells with mIL5-ECAR retrovirus. [Figure 8] FIG. 8 shows the killing effect of mIL5-ECAR T on eosinophils after administration back into a mouse asthma model. [Figure 9] FIG. 9 shows the alleviating effect on inflammatory factors after mIL5-ECAR T was added back into a mouse asthma model. [Figure 10] FIG. 10 shows the alleviating effect on inflammation after mIL5-ECAR T was added back into a mouse asthma model. [Figure 11] FIG. 11 is a diagram of the hPlau-ECAR plasmid. [Figure 12]FIG. 12 shows the specific killing effect after co-culturing hPlau-ECAR T with target cells expressing hPlauR. [Figure 13] FIG. 13 is a diagram of the hCCL11-ECAR plasmid. [Figure 14] FIG. 14 shows the specific killing effect after co-culturing hCCL11-ECAR T with target cells expressing hCCR3. [Figure 15] FIG. 15 is a diagram of the hCCL24-ECAR plasmid. [Figure 16] FIG. 16 shows the specific killing effect after co-culturing hCCL24-ECAR T with target cells expressing hCCR3. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0105] Specific embodiments The present inventors have conducted extensive and in-depth research and extensive screening, and have unexpectedly found for the first time that an endogenous chimeric antigen receptor (ECAR) designed by using an endogenous protein molecule instead of an antibody single domain fragment as the extracellular antigen-binding domain of the CAR can specifically and selectively kill cells in T cells, NK cells, macrophages, etc., when expressed on the membrane, and can have a significant killing effect, and can treat diseases such as tumor diseases, allergic diseases, autoimmune diseases, and senescent cell-related diseases. Based on this, the present inventors have completed the present invention.

[0106] In the present invention, the engineered immune cells of the present invention are representatively described in detail by taking ECAR-T cells as an example. The engineered immune cells of the present invention are not limited to the ECAR-cells described above and below, but have the same or similar technical characteristics and beneficial effects as the ECAR-cells described above and below. Specifically, when the immune cells express endogenous chimeric antigen receptor ECAR, macrophages and NK cells are equivalent to T cells (or T cells can replace NK cells and macrophages), and when the immune cells are T cells, TCR is equivalent to ECAR (or ECAR can replace TCR).

[0107] Endogenous protein molecules In the present invention, an endogenous protein molecule is a peptide chain or protein molecule composed of amino acids in the form of "dehydration condensation" that can be transcribed and translated in the human body using the human genome as a translation template. Such a protein molecule is a polymer composed of 20 different types of amino acids linked together, and has a three-dimensional spatial structure. In a physiological state, many protein molecules have the ability to specifically bind to other protein molecules, which plays an important role in the process of protein interaction. Meanwhile, in a pathological state, cells that promote the occurrence of pathological processes express specific protein receptors on their surface. Based on this, a chimeric antigen receptor (ECAR) linked to an endogenous protein molecule is designed and expressed in killer cells, such as T cells, so that the ECAR killer cells play a role in specifically killing and eliminating harmful cells that promote the occurrence of these pathological processes.

[0108] In a preferred embodiment of the present invention, the endogenous protein molecule of the present invention is preferably a member of the interleukin family, chemokine family, colony stimulating factor, growth factor, tumor necrosis factor superfamily, interferon family, tumor marker, senescent cell-associated factor, or the like.

[0109] The present invention relates to endogenous protein molecules and variants thereof.

[0110] In one preferred embodiment of the present invention, the amino acid sequence of the endogenous protein molecule of the present invention is represented by any of SEQ ID NOs: 1 to 5. IPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIIES (SEQ ID NO: 1, from human interleukin 5 (IL5)); MEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEG (SEQ ID NO: 2, from mouse interleukin 5 (IL5)) SNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPW CYVQVGLKLLVQECMVHDCADGKKPSSPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLN SNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENSTDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLAL (SEQ ID NO: 3, from human urokinase-type plasminogen activator Plau) GPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKP (SEQ ID NO: 4, from human-derived CCL11 factor); VVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTC (SEQ ID NO: 5, from human-derived CCL24 factor)

[0111] The present invention further includes polypeptides or proteins having a homology of 50% or more (preferably 60% or more, 70% or more, 80% or more, more preferably 90% or more, even more preferably 95% or more, and most preferably 98% or more, for example 99%) to the sequence shown in any of SEQ ID NOs: 1 to 5 of the present invention and having the same or similar function.

[0112] The proteins of the invention may be recombinant, natural or synthetic. They may be the product of natural purification, or the product of chemical synthesis, or may be produced by recombinant techniques from prokaryotic or eukaryotic hosts (e.g., bacteria, yeast, higher plants, insect or mammalian cells). Depending on the host used in a recombinant production process, the proteins of the invention may be glycosylated or non-glycosylated. Additionally, the proteins of the invention may or may not contain an initial methionine residue.

[0113] The proteins of the present invention further include fragments and analogs of endogenous protein molecules that have the activity of the endogenous protein molecule. As used herein, the terms "fragment" and "analog" are proteins that maintain essentially the same biological function or activity as the native endogenous protein molecule of the present invention.

[0114] Fragments, derivatives and analogs of the muteins of the present invention may be (i) muteins with one or more conservative or non-conservative amino acid residues (preferably conservative amino acid residues) substituted, whether or not the substituted amino acid residues are encoded by the genetic code, or (ii) muteins with substitutions at one or more amino acid residues, or (iii) muteins in which the mature mutein is fused to another compound (e.g., a compound that extends the half-life of the mutein, such as polyethylene glycol), or (iv) muteins in which an additional amino acid sequence is fused to the mutein (e.g., a leader sequence or a secretory sequence or a sequence for purifying the mutein or a protein precursor sequence, or a fusion protein formed with an antigen IgG fragment). Based on the disclosure of this specification, these fragments, derivatives and analogs are within the scope of the art. In the present invention, the conservatively substituted amino acids are preferably generated by amino acid replacement as shown in Table I.

[0115] [Table 1]

[0116] The present invention further includes polypeptides or proteins having 50% or more (preferably 60% or more, 70% or more, 80% or more, more preferably 90% or more, even more preferably 95% or more, most preferably 98% or more, e.g. 99%) homology with the native endogenous protein molecule of the present invention and having the same or similar function. Protein variants may be derived sequences obtained through substitution, deletion or addition of at least one amino acid (usually 1 to 60, preferably 1 to 30, more preferably 1 to 20, most preferably 1 to 10), as well as sequences in which one or more amino acids (usually 20 or less, preferably 10 or less, more preferably 5 or less) are added to the C-terminus and / or N-terminus. For example, in the above proteins, substitution with amino acids having close or similar functions usually does not change the function of the protein, and addition of one or more amino acids to the C-terminus and / or N-terminus usually does not change the function of the protein. The present invention includes analogs of naturally occurring endogenous protein molecules, which may differ from the naturally occurring endogenous protein molecules by differences in amino acid sequence, by modifications that do not affect the sequence, or by both. These protein analogs include naturally occurring or induced genetic variants. Induced variants can be obtained by a variety of techniques, such as random mutations by radiation or exposure to mutagens, as well as site-directed mutagenesis or other known molecular biology techniques. Analogs further include analogs that have residues different from naturally occurring L-amino acids, such as D-amino acids, and analogs that have non-natural or synthetic amino acids, such as β, γ-amino acids. Of course, the proteins of the present invention are not limited to the representative proteins listed above.

[0117] Modified forms (which do not usually change the primary structure) include chemically derived forms of the protein in vivo or in vitro, such as acetylation or carboxylation. Modifications further include glycosylation, e.g., glycosylation modifications during protein synthesis and processing. Such modifications are accomplished by exposing the protein to glycosylating enzymes (e.g., mammalian glycosylating or deglycosylating enzymes). Modified forms further include sequences with phosphorylated amino acid residues (e.g., tyrosine phosphate, serine phosphate, threonine phosphate). The muteins of the invention may also be modified. Modified forms (which do not usually change the primary structure) include chemically derived forms of the muteins in vivo or in vitro, such as acetylation or carboxylation. Modifications further include glycosylation, e.g., glycosylation modifications during the synthesis and processing of the mutein or in further processing steps. Such modifications are accomplished by exposing the mutein to glycosylating enzymes (e.g., mammalian glycosylating or deglycosylating enzymes). Modified forms further include sequences which contain phosphorylated amino acid residues (e.g., tyrosine phosphate, serine phosphate, threonine phosphate), and further include mutant proteins which have been modified to improve resistance to proteolysis or to improve solubility.

[0118] The present invention also provides polynucleotide sequences that code for endogenous protein molecules. The polynucleotides of the present invention may be in the form of DNA or RNA. The DNA form includes DNA, genomic DNA, or artificially synthesized DNA, and the DNA may be single-stranded or double-stranded. The polynucleotides that code for mature polypeptides include coding sequences that code for only the mature polypeptide, coding sequences for the mature polypeptide and various additional coding sequences, coding sequences for the mature polypeptide (and any additional coding sequences) and non-coding sequences. The term "polynucleotides that code for a polypeptide" may be polynucleotides that code for the polypeptide, or polynucleotides that further include additional coding and / or non-coding sequences. Furthermore, the present invention relates to variants of the above polynucleotides that code for fragments, analogs, and derivatives of the polypeptides having the same amino acid sequence as the present invention. The variants of the polynucleotides may be naturally occurring allelic variants or non-naturally occurring variants. These nucleotide variants include substitution variants, deletion variants, and insertion variants. As known in the art, allelic variants are alternative forms of polynucleotides that may be substitutions, deletions, or insertions of one or more nucleotides, but do not substantially alter the function of the encoded polypeptide.

[0119] Based on the nucleotide sequence described herein, those skilled in the art can conveniently prepare the coding nucleic acid of the present invention by various known methods. These methods include, but are not limited to, for example, PCR, DNA artificial synthesis, etc., and specific methods can be referred to J. Sambrook's "Molecular Cloning: A Laboratory Manual." In one embodiment of the present invention, the nucleotide sequence can be synthesized separately, and the coding nucleic acid sequence of the present invention can be constructed by the method of overlap extension PCR.

[0120] The present invention further relates to polynucleotides that hybridize with the above sequences and have at least 50%, preferably at least 70%, more preferably at least 80% homology between the two sequences. The present invention particularly relates to polynucleotides that can hybridize with the polynucleotides of the present invention under stringent conditions. In the present invention, "stringent conditions" are (1) low ionic strength and high temperature, such as 0.2xSSC, 0.1% SDS, hybridization and elution at 60°C, or (2) the inclusion of a denaturing agent during hybridization, such as 50% (v / v) formamide, 0.1% fetal bovine serum / 0.1% Ficoll at 42°C, or (3) hybridization only when the homology between the two sequences is at least 90%, preferably 95%. The proteins and polynucleotides of the present invention are preferably provided in an isolated form, and more preferably are purified to homogeneity.

[0121] The full length sequence of the polynucleotide of the present invention is usually obtained by PCR amplification, recombinant methods or artificial synthesis. For PCR amplification, primers are designed according to the relevant nucleotide sequence disclosed in the present invention, particularly the reading frame, and the relevant sequence is obtained by amplifying a commercially available cDNA library or a cDNA library prepared by a conventional method known to those skilled in the art as a template. If the sequence is long, it is usually necessary to carry out two or more PCR amplifications and then join the fragments obtained from each amplification in the correct order.

[0122] Once the relevant sequence is obtained, it can be obtained in large quantities by recombinant techniques, typically by cloning the sequence into a vector, introducing it into a cell, and isolating the relevant sequence from the host cells which have been grown in the usual manner.

[0123] Alternatively, the related sequences may be synthesized by artificial synthesis methods, especially if the fragments are short in length. Typically, a large number of small fragments are first synthesized and then joined together to give a long fragment of the sequence.

[0124] At present, it is already possible to obtain the DNA sequence encoding the protein of the present invention (or a fragment or derivative thereof) entirely by chemical synthesis. Furthermore, this DNA sequence may be introduced into various known DNA molecules (or vectors, etc.) or cells well known in the art. Mutations may also be introduced into the protein sequence of the present invention by chemical synthesis.

[0125] To obtain the polynucleotide of the present invention, a method of amplifying DNA / RNA by PCR technology is preferably used. In particular, when it is difficult to obtain a full-length cDNA from a library, the RACE method (RACE-rapid amplification of cDNA ends) is preferably used, and the primers used in PCR can be appropriately selected based on the sequence information of the present invention disclosed herein and synthesized by conventional methods. The amplified DNA / RNA fragments can be isolated and purified by conventional methods, such as gel electrophoresis.

[0126] Antigen-binding domain In the present invention, the antigen-binding domain of the chimeric antigen receptor CAR specifically binds to a receptor that matches an endogenous protein molecule on the cell surface (e.g., the receptor for IL-5, IL-17).

[0127] Hinge and transmembrane domains Regarding the hinge region and transmembrane region (transmembrane domain), the CAR may be designed to include a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain associated with one of the domains in a naturally occurring CAR is used. In some instances, the transmembrane domain is selected or modified with amino acid substitutions to avoid binding of such domains to transmembrane domains of similar or different surface membrane proteins, thereby minimizing interactions with other members of the receptor complex.

[0128] The transmembrane domain may be of natural or synthetic origin. In the natural origin, the domain may be from any membrane-bound or transmembrane protein. Advantageously, the hinge region in the CAR of the present invention is the hinge region of CD8α or the hinge region of CD28, and the transmembrane region of the present invention is the transmembrane region of CD8α or the transmembrane region of CD28.

[0129] Intracellular domain The intracellular domain or other intracellular signaling domain of the CAR of the present invention is responsible for the activation of at least one normal effector function of the immune cell in which the CAR is placed. The term "effector function" refers to a proprietary function of a cell. For example, the effector function of a T cell may be a cytolytic activity or an auxiliary activity, including cytokine secretion. Thus, the term "intracellular signaling domain" refers to a protein that transmits an effector function signal to guide the cell to perform its proprietary function. Typically, the entire intracellular signaling domain may be used, but in many instances, the entire chain is not necessarily used. Regarding the use of truncated portions of the intracellular signaling domain, such truncated portions may be used in place of the complete chain, provided that they transmit the effector function signal. Thus, the term "intracellular signaling domain" includes any truncated portion of the intracellular signaling domain that is sufficient to transmit the effector function signal.

[0130] Suitable examples of intracellular signaling domains for use in the CARs of the invention include the intracellular sequences of the T cell receptor (TCR) and co-receptors that act in concert to initiate signal transduction upon binding to an antigen receptor, as well as any derivatives or variants of these sequences and any synthetic sequences capable of similar function.

[0131] In a preferred embodiment, the intracellular domain of the CAR may be designed to include a CD3ζ signaling domain by itself, or may be used in combination with any other desired intracellular domain(s) useful in the context of the CAR of the present invention. For example, the intracellular domain of the CAR may include a CD3ζ chain portion and a costimulatory signaling region. A costimulatory signaling region is a portion of the CAR that includes the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule required for an effective response of lymphocytes to antigens, but is not an antigen receptor or its ligand. Preferably, it includes CD28, 4-1BB, and the like.

[0132] The intracellular signaling sequences in the intracellular signaling portion of the CAR of the present invention may be linked to each other randomly or in a predetermined order. Optionally, short oligopeptide or polypeptide conjugates, preferably between 2 and 10 amino acids in length, may be so linked. Glycine-serine dimers provide a particularly suitable conjugate. In one embodiment, the intracellular domain in the CAR of the present invention is designed to contain the signaling domain of CD28 (costimulatory molecule) and the signaling domain of CD3ζ.

[0133] Chimeric antigen receptors (CARs) Chimeric antigen receptor (CAR) consists of an extracellular antigen recognition region, usually a single-chain variable fragment (scFv), a transmembrane region and an intracellular costimulatory signal region. The design of CAR has gone through the following process. The first generation CAR has only one intracellular signal component, CD3ζ or FcγRI molecule, and only one activation domain in the cell, which can only cause short-term T cell proliferation and low cytokine secretion, but can provide long-term T cell proliferation signals and sustained anti-tumor effects in vivo, resulting in insufficient clinical therapeutic effects. The second generation CAR is based on the original structure and introduces one costimulatory molecule, such as CD28, 4-1BB, OX40, and ICOS, which greatly improves the function compared to the first generation CAR, and further enhances the persistence of CAR-T cells and the killing ability of tumor cells. Based on the second generation CAR, some new immune costimulatory molecules, such as CD27 and CD134, are tandemly linked, which has led to the development of third and fourth generation CARs.

[0134] The extracellular fragment of CAR recognizes a specific antigen, and then transmits the corresponding signal via the intracellular domain, leading to cell activation and proliferation, cytotoxicity and secretion of cytokines, thereby eliminating the target cells. This involves cell therapy in which the patient's own cells (or allogeneic donor) are isolated, activated and genetically modified to generate CAR immune cells, which are then injected into the patient's body. In this way, the probability of suffering from graft-versus-host disease is extremely low, and antigens are recognized by immune cells without MHC restriction. CAR-immune cell therapy has shown extremely high clinical response rates in the treatment of hematological malignancies; such high response rates cannot be achieved with any of the conventional therapeutic approaches, sparking a boom in clinical research worldwide.

[0135] Specifically, the endogenous chimeric antigen receptor (ECAR) of the present invention comprises an extracellular domain, a transmembrane domain, and an intracellular domain. The extracellular domain comprises a target-specific binding element (also called an antigen-binding domain). The intracellular domain comprises a costimulatory signaling region and / or a zeta chain portion. The costimulatory signaling region comprises a portion of the intracellular domain of a costimulatory molecule. A costimulatory molecule is a cell surface molecule required for an effective response of lymphocytes to antigens, and is not an antigen receptor or its ligand. A linker may be introduced between the extracellular and transmembrane domains of the CAR, or between the intracellular and transmembrane domains of the CAR. As used herein, the term "linker" generally refers to any oligopeptide or polypeptide that serves to link a transmembrane domain to an extracellular or intracellular domain of a polypeptide chain. The linker may comprise 0-300 amino acids, preferably 2-100 amino acids, and most preferably 3-50 amino acids.

[0136] When the ECAR of the present invention is expressed in T cells, it can recognize antigens based on the specificity of antigen binding. When ECAR binds to a specific antigen on the surface of a target cell, it activates the ECAR T cells and allows the ECAR T cells to kill the target cell. The antigen binding domain is preferably fused with one or more intracellular domains derived from a costimulatory molecule and / or zeta chain. Preferably, the antigen binding domain is fused with the intracellular domain combined with the CD28 signaling domain and / or the CD3zeta signaling domain.

[0137] In one preferred embodiment, the antigen-binding portion of the ECAR of the invention targets a receptor that corresponds (matches) an endogenous protein molecule. In one preferred embodiment, the antigen-binding portion of the ECAR of the invention is an endogenous protein molecule that targets a receptor that matches an endogenous protein molecule.

[0138] In one preferred embodiment, the endogenous protein molecule comprises a variant embodiment, said variant having ≧80%, ≧85%, ≧90%, ≧95%, ≧98% or ≧99% homology to the protein sequence of its wild-type endogenous protein molecule.

[0139] In the present invention, the endogenous protein molecule of the present invention further includes its conservative variants, and refers to a polypeptide in which, compared with the amino acid sequence of the endogenous protein molecule of the present invention, 10 or less, preferably 8 or less, more preferably 5 or less, and most preferably 3 or less amino acids are substituted with amino acids having similar or close properties.

[0140] In the present invention, the number of added, deleted, modified and / or substituted amino acids is preferably 40% or less of the total number of amino acids in the original amino acid sequence, more preferably 35% or less, more preferably 1 to 33%, more preferably 5 to 30%, more preferably 10 to 25%, and more preferably 15 to 20%.

[0141] In the present invention, the number of added, deleted, modified and / or substituted amino acids is usually 1, 2, 3, 4 or 5, preferably 1 to 3, more preferably 1 to 2, and most preferably 1.

[0142] Regarding the hinge region and transmembrane region (transmembrane domain), the CAR may be designed to include a transmembrane domain fused to the extracellular domain of the CAR. In one embodiment, a transmembrane domain associated with one of the domains in a naturally occurring CAR is used. In some instances, the transmembrane domain is selected or modified with amino acid substitutions to avoid binding of such domains to transmembrane domains of similar or different surface membrane proteins, thereby minimizing interactions with other members of the receptor complex.

[0143] The extracellular domain of ECAR of the present invention comprises an endogenous protein molecule, preferably an endogenous protein molecule having a specific sequence.

[0144] In the present invention, the intracellular domain in the ECAR of the present invention includes the transmembrane region of CD28, the costimulatory factor of CD28, and the signaling domain of CD3ζ.

[0145] In a preferred embodiment of the present invention, the amino acid sequence of the ECAR is represented by any one of SEQ ID NOs: 6 to 10. MALPVTALLLPLALLLHAIPTEIPTSALVKETLALLSTHRTLLIANETLRIPVPVHKNHQLCTEEIFQGIGTLESQTVQGGTVERLFKNLSLIKKYIDGQKKKCGEERRRVNQFLDYLQEFLGVMNTEWIESRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFW VLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO:6, endogenous chimeric antigen receptor CAR (ECAR) hCD28 signal peptide-hIL5-hCD28 hinge region-hCD28 transmembrane region-hCD28 costimulatory molecule-CD3 zeta intracellular signaling sequence, hIL5-ECAR) MASPLTRFLSLNLLLLGESIILGSGEAMEIPMSTVVKETLTQLSAHRALLTSNETMRLPVPTHKNHQLCIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCGEERRRTRQFLDYLQEFLGVMSTEWAMEGRAAASTTTKPVLRTPSPVHPTGTSQPQRPEDCRPRGSVKGTGLDF ACDIYIWAPLAGICVALLLSLIITLICYNSRRNRLLQSDYMNMTPRRPGLTRKPYQPYAPARDFAAYRPRAKFSRSAETAANLQDPNQLYNELNLGRREEYDVLEKKRARDPEMGGKQQRRRNPQEGVYNALQKDKMAEAYSEIGTKGERRRGKGHDGLYQGLSTATKDTYDALHMQTLAPRGSG (SEQ ID NO: 7, mCD8α signal peptide-mIL5-mCD8α hinge region-mCD8α transmembrane region-mCD28 costimulatory molecule-CD3ζ intracellular signaling sequence, mIL5-ECAR) MALPVTALLLPLALLLHAYPYDVPDYASNELHQVPSNCDCLNGGTCVSNKYFSNIHWCNCPKKFGGQHCEIDKSKTCYEGNGHFYRGKASTDTMGRPCLPWNSATVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKLLVQECMVHDCADGKKPS SPPEELKFQCGQKTLRPRFKIIGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPCWVISATHCFIDYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHKDYSADTLAHHNDIALLKIRSKEGRCAQPSRTIQTICLPSMYNDPQFGTSCEITGFGKENS TDYLYPEQLKMTVVKLISHRECQQPHYYGSEVTTKMLCAADPQWKTDSCQGDSGGPLVCSLQGRMTLTGIVSWGRGCALKDKPGVYTRVSHFLPWIRSHTKEENGLALRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACY SLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 8, hCD28 signal peptide-hPlau-hCD28 hinge region-hCD28 transmembrane region-hCD28 costimulatory molecule-CD3 ζ intracellular signaling sequence, hPLau-ECAR) MALPVTALLLPLALLLHAYPYDVPDYAGPASVPTTCCFNLANRKIPLQRLESYRRITSGKCPQKAVIFKTKLAKDICADPKKKWVQDSMKYLDQKSPTPKPRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLV TVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 9, hCD28 signal peptide-hCCL11-hCD28 hinge region-hCD28 transmembrane region-hCD28 costimulatory molecule-CD3 ζ intracellular signaling sequence, hCCL11-ECAR) MALPVTALLLPLALLLHAYPYDVPDYAVVIPSPCCMFFVSKRIPENRVVSYQLSSRSTCLKAGVIFTTKKGQQFCGDPKQEWVQRYMKNLDAKQKKASPRARAVAVKGPVQRYPGNQTTCRAAAIEVMYPPPYLDNEKSNGTIIHVKGKHLCPSPLFPGPSKPFWVLVVVG GVLACYSLLVTVAFIIFWVRSKRSRLLHSDYMNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR (SEQ ID NO: 10, hCD28 signal peptide-hCCL24-hCD28 hinge region-hCD28 transmembrane region-hCD28 costimulatory molecule-CD3 ζ intracellular signaling sequence, hCCL24-ECAR)

[0146] In a preferred embodiment of the present invention, the nucleotide sequence of the ECAR is represented by any one of SEQ ID NOs: 11 to 15.

[0147] Here, in SEQ ID NO: 6, positions 1 to 54 are a signal peptide, positions 55 to 399 are an endogenous protein molecule (e.g., human IL5), positions 412 to 528 are a hinge region (e.g., the hinge region of human CD28), positions 529 to 609 are a transmembrane region (e.g., the transmembrane region of human CD28), positions 610 to 732 are a costimulatory element (e.g., the costimulatory element of human CD28), and positions 733 to 1068 are CD3ζ.

[0148] Here, in SEQ ID NO: 7, positions 1 to 81 are a signal peptide, positions 82 to 420 are an endogenous protein molecule (e.g., murine IL5), positions 433 to 570 are a hinge region (e.g., the hinge region of murine CD8α), positions 571 to 633 are a transmembrane region (e.g., the transmembrane region of murine CD8α), positions 640 to 762 are a costimulatory element (e.g., the costimulatory element of mouse CD28), and positions 763 to 1,101 are CD3ζ.

[0149] Here, in SEQ ID NO:8, positions 1 to 54 are a signal peptide, positions 82 to 1314 are an endogenous protein molecule (e.g., human Plau), positions 1327 to 1443 are a hinge region (e.g., the hinge region of human CD28), positions 1444 to 1524 are a transmembrane region (e.g., the transmembrane region of human CD28), positions 1525 to 1647 are a costimulatory element (e.g., the costimulatory element of human CD28), and positions 1648 to 1983 are CD3ζ.

[0150] Here, in SEQ ID NO:9, positions 1 to 54 are a signal peptide, positions 82 to 303 are an endogenous protein molecule (e.g., human CCL11), positions 316 to 432 are a hinge region (e.g., the hinge region of human CD28), positions 433 to 513 are a transmembrane region (e.g., the transmembrane region of human CD28), positions 514 to 636 are a costimulatory element (e.g., the costimulatory element of human CD28), and positions 637 to 972 are CD3ζ.

[0151] Here, in SEQ ID NO: 10, positions 1 to 54 are a signal peptide, positions 82 to 360 are an endogenous protein molecule (e.g., human CCL24), positions 373 to 489 are a hinge region (e.g., the hinge region of human CD28), positions 490 to 570 are a transmembrane region (e.g., the transmembrane region of human CD28), positions 571 to 693 are a costimulatory element (e.g., the costimulatory element of human CD28), and positions 694 to 1029 are CD3ζ.

[0152] Chimeric antigen receptor T cells (CAR-T cells) As used herein, the terms "CAR-T cell", "CAR-T", "CAR-T cell of the invention", "CAR-T cell of the invention", "antigen receptor T cell", "ECAR-T cell", "ECAR-T", "ECAR-T cell of the invention", "ECAR-T cell of the invention", "endogenous chimeric antigen receptor T cell" all refer to the ECAR-T cell according to the sixth aspect of the invention, which targets a receptor that corresponds (matches) to an endogenous protein molecule and can kill or destroy cells (e.g., inflammatory cells, senescent cells, tumor cells, autoimmune cells) or treat diseases (e.g., tumor diseases, allergic diseases, autoimmune diseases, senescent cell-associated diseases). CAR-T cells have the following advantages over other T cell-based therapeutic approaches: (1) The action process of CAR-T cells is not restricted by MHC. (2) Many cells express similar antibodies, so once the construction of a CAR gene for a certain antigen is completed, it can be widely used. (3) CAR can use both protein antigens and non-protein antigens such as glycolipids, widening the target range of antigens. (4) The risk of rejection is reduced because the patient's own cells are used. (5) CAR-T cells have immune memory function and can survive in the body for a long time.

[0153] In the present invention, the CAR of the present invention comprises (i) an extracellular domain which is an endogenous protein molecule, (ii) an optional hinge region, (iii) a transmembrane domain, (iv) a costimulatory factor, and (v) a signaling domain of CD3ζ.

[0154] Chimeric antigen receptor NK cells (CAR-NK cells) As used herein, the terms "CAR-NK cells", "CAR-NK", "CAR-NK cells of the invention", "CAR-NK cells of the invention", "antigen receptor NK cells", "ECAR-NK cells", "ECAR-NK", "ECAR-NK cells of the invention", "ECAR-NK cells of the invention", "endogenous antigen receptor NK cells" all refer to ECAR-NK cells according to the first aspect of the invention. The CAR-NK cells of the invention target receptors that match endogenous protein molecules and are able to kill or destroy cells (e.g., inflammatory cells, senescent cells, tumor cells, autoimmune cells).

[0155] Natural killer cells (NK cells) are the major immune effector cells that protect the body from viral infections and tumor cell invasion through non-antigen specific pathways. Engineered (genetically modified) NK cells can be endowed with novel functions, including the ability to specifically recognize cellular antigens and enhanced cell killing or abolishing activity.

[0156] Compared with autologous CAR-T cells, CAR-NK cells have the following advantages: (1) they directly kill cells by releasing perforin and granzymes, but do not kill normal cells in the body; (2) they release only small amounts of cytokines, which reduces the risk of cytokine storm; and (3) they are very easy to amplify outside the body and become a "ready-made" product. Other than that, it is similar to CAR-T cell therapy.

[0157] Chimeric antigen receptor macrophages (CAR-macrophages) As used herein, the terms "CAR-macrophage cell," "CAR-macrophage," "CAR-macrophage of the invention," "CAR-macrophage of the invention," "antigen receptor macrophage," "ECAR-macrophage cell," "ECAR-macrophage," "ECAR-macrophage of the invention," "ECAR-macrophage of the invention," "endogenous antigen receptor macrophage" all refer to ECAR-macrophages according to the first aspect of the invention. The CAR-macrophages of the invention target receptors that match endogenous protein molecules and can kill or destroy cells (e.g., inflammatory cells, senescent cells, tumor cells, autoimmune cells) or treat diseases (e.g., tumor diseases, allergic diseases, autoimmune diseases, senescent cell-associated diseases).

[0158] Exogenous T cell antigen receptor As used herein, an exogenous T cell receptor (TCR) is a TCR that is exogenously introduced into a T cell by genetic engineering using a lentivirus or retrovirus vector, by cloning the α and β chains of the TCR from a tumor-reactive T cell by gene transfer technology. T cells modified with exogenous TCRs can specifically recognize and kill cells, and by optimizing the affinity between the TCR and a specific antigen, the affinity between the T cells and the cells to be killed can be improved, thereby increasing the effect of killing or eliminating the cells.

[0159] vector Nucleic acid sequences encoding the desired molecule can be obtained by recombinant methods known in the art, such as by screening libraries for cells expressing the gene, by obtaining the vector from a vector containing a known gene of interest, or by direct isolation from cells and tissues containing the gene of interest by standard techniques. If desired, the gene of interest can also be produced synthetically.

[0160] The present invention also provides a vector into which the expression cassette of the present invention is inserted. A vector derived from a retrovirus, such as a lentivirus, is a suitable tool for long-term gene transfer, since it allows long-term, stable integration of the introduced gene and its proliferation in progeny cells. Lentiviruses have an advantage over oncogenic retroviruses, such as murine leukemia virus vectors, because they can be introduced into non-proliferating cells, such as hepatocytes. They also have the advantage of low immunogenicity.

[0161] Briefly summarized, the expression cassette or nucleic acid sequence of the present invention is typically operably linked to a promoter and incorporated into an expression vector, which is suitable for replication and integration in eukaryotic cells. Typical cloning vectors contain transcription and translation terminators, initiation sequences and promoters that can be used to regulate the expression of the desired nucleic acid sequence.

[0162] The expression constructs of the present invention can also be used in nucleic acid immunization and gene therapy using standard gene delivery protocols. Methods of gene delivery are known in the art. See, for example, U.S. Patent Nos. 5,399,346, 5,580,859, and 5,589,466, which are incorporated herein by reference in their entirety. In another embodiment, the present invention provides a gene therapy vector.

[0163] The nucleic acid can be cloned into a variety of vectors, including, but not limited to, plasmids, phages, phage derivatives, animal viruses, and cosmids. Vectors of particular interest include expression vectors, replication vectors, probe generation vectors, and sequencing vectors.

[0164] Furthermore, the expression vector can be provided to the cell in the form of a viral vector. Viral vector technology is known in the art and described, for example, in Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York) and other virology and molecular biology manuals. Viruses that can be used as vectors include, but are not limited to, retroviruses, adenoviruses, adeno-associated viruses, herpes viruses, and lentiviruses. Typically, a suitable vector contains an origin of replication functional in at least one organism, a promoter sequence, convenient restriction enzyme cleavage sites, and one or more selectable markers (e.g., WO01 / 96584, WO01 / 29058, and U.S. Patent No. 6,326,193).

[0165] Many virus-based systems have already been developed and used to introduce genes into mammalian cells. For example, retroviruses provide a convenient platform for gene delivery systems. A selected gene can be inserted into a vector and packaged into retroviral particles by techniques known in the art. The recombinant virus can then be isolated and delivered to target cells in vivo or ex vivo. Many retroviral systems are known in the art. In some embodiments, adenoviral vectors are used. Many adenoviral vectors are known in the art. In some embodiments, lentiviral vectors are used.

[0166] Additional promoter elements, such as enhancers, can regulate the frequency at which transcription is initiated. Usually, these are located in the region 30-110 bp upstream of the start site, but it has recently been shown that many promoters also contain functional elements downstream of the start site. The spacing between promoter elements is often flexible, allowing promoter function to be maintained if an element is inverted or moved relative to another element. In the thymidine kinase (tk) promoter, the spacing between promoter elements can be increased to 50 bp without loss of activity. Depending on the promoter, single elements can act either jointly or independently to initiate transcription.

[0167] One example of a suitable promoter is the immediate early cytomegalovirus (CMV) promoter sequence. The promoter sequence is a strong constitutive promoter sequence capable of conferring high levels of expression of any polynucleotide sequence operably linked thereto. Another example of a suitable promoter is the elongation factor 1 alpha (EF-1 alpha). However, other constitutive promoter sequences may be used, including, but not limited to, the Simian Virus 40 (SV40) early promoter, the mouse mammary tumor virus (MMTV), the human immunodeficiency virus (HIV) long terminal repeat (LTR) promoter, the MoMuLV promoter, the avian leukosis virus promoter, the Epstein-Barr virus immediate early promoter, the Rous sarcoma virus promoter, and human gene promoters, such as, but not limited to, the actin promoter, the myosin promoter, the heme promoter, and the creatine kinase promoter. Furthermore, the present invention is not limited to the use of constitutive promoters. Inducible promoters are also contemplated as part of the present invention. The use of an inducible promoter provides a molecular switch that can initiate expression of a polynucleotide sequence operably linked to the inducible promoter when such expression is desired, or terminate expression when such expression is not desired. Examples of inducible promoters include, but are not limited to, metallothionein promoters, glucocorticoid promoters, progesterone promoters, and tetracycline promoters.

[0168] To assess the expression of a CAR polypeptide or a portion thereof, the expression vector introduced into the cells can also contain any one or both of a selectable marker gene or a reporter gene, allowing the expressing cells to be identified and selected from a group of cells transduced or infected with a viral vector. Alternatively, the selectable marker can be carried on a single DNA fragment and used in the co-transfection process. The flanking regions of both the selectable marker gene and the reporter gene can each have appropriate regulatory sequences to allow them to be expressed in the host cell. Useful selectable markers include, for example, antibiotic resistance genes, such as neo.

[0169] Reporter genes are used to identify potentially transduced cells and to evaluate the functionality of regulatory sequences. Typically, reporter genes are genes that are absent from or expressed by the recipient organism or tissue and encode a polypeptide whose expression can be clearly indicated by an easily detectable property, such as enzymatic activity. Once the DNA has been introduced into the recipient cells, reporter gene expression is measured at an appropriate time. Suitable reporter genes include genes encoding luciferase, β-galactosidase, chloramphenicol acetyltransferase, secreted alkaline phosphatase and green fluorescent protein (e.g., Ui-Tei et al., 2000 FEBS Letters 479:79-82). Suitable expression systems are known and can be produced by known techniques or obtained commercially. Typically, the construct with at least five flanking regions that exhibits the highest level of reporter gene expression is identified as the promoter. Such a promoter region can be linked to the reporter gene and used to evaluate the ability of a reagent to modulate the promoter to activate transcription.

[0170] Methods for introducing genes into cells and expressing genes in cells are known in the art. In the context of an expression vector, the vector can be easily introduced into a host cell, such as a mammalian, bacterial, yeast or insect cell, by any method known in the art. For example, the expression vector can be introduced into the host cell by physical, chemical or biological means.

[0171] Physical methods of introducing polynucleotides into host cells include calcium phosphate precipitation, lipofection, particle bombardment, microinjection, electroporation, etc. Methods of producing cells containing vectors and / or foreign nucleic acids are known in the art. See, for example, Sambrook et al. (2001, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, New York). A preferred method of introducing polynucleotides into host cells is calcium phosphate transduction.

[0172] Biological methods for introducing a polynucleotide of interest into a host cell include the use of DNA and RNA vectors. Viral vectors, particularly retroviral vectors, have become the most widely used method for inserting genes into mammalian, e.g., human cells. Other viral vectors may be derived from lentiviruses, poxviruses, herpes simplex virus I, adenoviruses and adeno-associated viruses, etc. See, e.g., U.S. Patent Nos. 5,350,674 and 5,585,362.

[0173] Chemical means for introducing polynucleotides into host cells include colloidal dispersion systems, such as macromolecule complexes, nanocapsules, microspheres, beads, and lipid-based systems, including oil-in-water emulsions, micelles, mixed micelles, and liposomes. An exemplary colloidal system used as an in vitro and in vivo delivery vehicle is a liposome (e.g., an artificial membrane vesicle).

[0174] When a non-viral delivery system is used, an exemplary delivery vehicle is a liposome. Lipid formulations may be used to introduce the nucleic acid into a host cell (in vitro, ex vivo, or in vivo). The nucleic acid may also be associated with a lipid. The nucleic acid associated with a lipid may be encapsulated in the aqueous interior of the liposome, interspersed in the lipid bilayer of the liposome, attached to the liposome via a linking molecule that links both the liposome and the oligonucleotide, incorporated into the liposome, complexed with the liposome, dispersed in a solution containing lipid, mixed with lipid, combined with lipid, contained in lipid as a suspension, contained in micelles, complexed with micelles, or otherwise associated with lipid. The lipid, lipid / DNA, or lipid / expression vector associated with the composition is not limited to any particular structure in solution. For example, it may exist in a bilayer structure, as micelles, or in a "collapsed" structure. It may simply disperse in solution and form aggregates of different sizes and shapes. Lipids are fatty substances, and may be natural or synthetic lipids. For example, lipids include the fatty droplets that occur naturally in the cytoplasm, as well as compounds such as long chain aliphatic hydrocarbons and their derivatives, including fatty acids, alcohols, amines, aminoalcohols and aldehydes.

[0175] In one preferred embodiment of the invention, the vector is a lentiviral vector.

[0176] formulation The present invention provides a CAR according to the first aspect of the invention, a nucleic acid molecule according to the second aspect of the invention, a vector according to the third aspect of the invention, or a host cell according to the fourth aspect of the invention, together with a pharma- ceutically acceptable carrier, diluent or excipient. In one embodiment, the formulation is a liquid formulation. Preferably, the formulation is an injectable formulation. Suitably, the formulation has a concentration of the CAR-T cells of 1×10 5 ~1×10 8 cells / mL, preferably 1 x 10 6 ~1×10 7 cells / mL, more preferably 1×10 6 ~5×10 6In one embodiment, the formulation may include a buffer, such as neutral buffered saline, sulfate buffered saline, carbohydrates such as glucose, mannose, sucrose, dextran, mannitol, proteins, polypeptides or amino acids such as glycine, antioxidants, chelating agents such as EDTA and glutathione, adjuvants (e.g., aluminum hydroxide), and preservatives. The formulations of the invention are preferably prepared for intravenous administration.

[0177] therapeutic use The present invention includes therapeutic uses carried out in cells (e.g., T cells) transduced with lentiviral vectors (LV) encoding the expression cassettes of the present invention, which can target receptors that match endogenous protein molecules and cooperate to activate T cells to elicit an immune response that can significantly improve the efficiency of cell killing or destruction.

[0178] Therefore, the present invention also provides a method for stimulating a T cell-mediated immune response against a target cell population or tissue in a mammal, comprising administering to the mammal a CAR-T cell of the present invention.

[0179] In one embodiment, the invention involves cell therapy in which the patient's autologous T cells (or allogeneic donor) are isolated, activated, and genetically modified to generate ECAR-T cells, which are then infused back into the patient. In this way, the chances of developing graft-versus-host disease are extremely low, and antigens are recognized by T cells without MHC restriction. Also, a single ECAR-T can treat any disease that expresses a receptor corresponding to the endogenous protein molecule. Unlike antibody therapy, ECAR-T cells can replicate in the body, resulting in long-term persistence that leads to sustained controlled cell killing or extinction.

[0180] In one embodiment, the ECAR-T cells of the invention can persist for extended periods of time via stable in vivo T cell expansion, and ECAR-mediated immune responses can be part of an adoptive immunotherapy process, where the ECAR-modified T cells induce T cells to mount a specific immune response against target cells.

[0181] Although the data published herein specifically discloses lentiviral vectors that contain endogenous protein molecules, hinge and transmembrane regions, and CD28 and CD3ζ signaling domains, the invention should be construed to include any number of variations of each component part of the construct.

[0182] The diseases that can be treated include tumor diseases, allergic diseases, autoimmune diseases, and senescent cell-related diseases.

[0183] The CAR-modified T cells of the present invention are also useful as vaccines for ex vivo immunization and / or in vivo therapy in a mammal. Preferably, the mammal is a human.

[0184] For ex vivo immunization, at least one of i) expanding the cells, ii) introducing a nucleic acid encoding a CAR into the cells, and / or iii) cryopreserving the cells is performed outside the body prior to administering the cells to a mammal.

[0185] In vitro protocols are known in the art and are discussed more fully below. Briefly, cells are isolated from a mammal (preferably a human) and genetically modified with a vector expressing a CAR as disclosed herein (i.e., in vitro transformation or transduction). The CAR-modified cells can be administered to a mammalian recipient to provide a therapeutic beneficial effect. The mammalian recipient can be a human, and the CAR-modified cells can be the recipient's own cells. Optionally, the cells can be allogeneic, syngeneic, or xenogeneic to the recipient.

[0186] In addition to cell-based vaccines for in vitro immunization, the present invention also provides compositions and methods for generating an immune response to an antigen in a patient by in vivo immunization. The present invention provides a method of treating a disease, comprising administering to a subject in need thereof a therapeutically effective amount of a CAR-modified T cell of the present invention.

[0187] The CAR-modified T cells of the present invention can be administered alone or in combination with a diluent and / or other components, other cytokines or cell populations as a pharmaceutical composition. Briefly, a pharmaceutical composition of the present invention comprises a target cell population as described herein, optionally in combination with one or more pharma- ceutical or physiologically acceptable carriers, diluents or excipients. Such compositions may include buffers, such as neutral buffered saline, sulfate buffered saline, carbohydrates, such as glucose, mannose, sucrose or dextran, mannitol, proteins, polypeptides or amino acids, such as glycine, antioxidants, chelating agents, such as EDTA or glutathione, adjuvants (e.g., aluminum hydroxide), and preservatives. The compositions of the present invention are preferably prepared for intravenous administration.

[0188] The pharmaceutical composition of the present invention can be administered in a form suitable for the disease to be treated (or prevented). The amount and frequency of administration will depend on factors such as the patient's bed and the type and severity of the patient's disease, but the appropriate dosage will be determined by clinical trials.

[0189] When referring to an "immunologically effective amount" or a "therapeutic amount," the exact amount of the composition of the present invention to be administered is determined by a physician, taking into account the age, weight, degree of infection or metastasis, and individual differences in the disease symptoms of the patient (subject). Typically, the pharmaceutical composition comprising the T cells described herein is administered in an amount of 10 4 ~10 9 Dosage of 10 cells / kg body weight, preferably 10 5 ~10 6The compositions of T cells may be administered at doses of 1000 cells / kg body weight, including all integer values ​​within these ranges. The compositions of T cells may be administered at these doses several times. The cells may be administered by injection techniques known in immunotherapy (e.g., Rosenberg et al., New Eng. J. of Med. 319:1676, 1988). The optimal dosage and treatment plan for a particular patient may be adjusted based on monitoring and monitoring the patient's disease profile, and may be readily determined by one of ordinary skill in the medical arts.

[0190] The composition may be administered to a subject by any convenient means, including aerosolization, injection, oral administration, infusion, implantation or transplantation. The compositions described herein may be administered to a patient subcutaneously, intradermally, intratumorally, intranodal, intraspinal, intramuscular, intravenous (iv) injection or intraperitoneally. In one embodiment, the T cell composition of the invention is administered to a patient by intradermal or subcutaneous injection. In another embodiment, the T cell composition of the invention is preferably administered by iv injection. The T cell composition may be injected directly into the cell, tumor, lymph node or site of infection to be killed.

[0191] In some embodiments of the invention, cells activated and expanded by the methods described herein or other methods known in the art for expanding T cells to therapeutic levels are used to administer to a patient in conjunction with (e.g., before, simultaneously, or after) any number of relevant therapeutic procedures, including, but not limited to, antiviral therapy, treatment with agents such as cidofovir and interleukin-2, azacitidine (known as ARA-C), or treatment with natalizumab for MS patients or efalizumab for psoriasis patients, or other treatments for PML patients. In further embodiments, the T cells of the invention can be administered in conjunction with chemotherapy, radiation, immunosuppressive agents such as cyclosporine A, azathioprine, methotrexate, mycophenolate mofetil, or FK506, antibodies, or other immunotherapeutic agents. In further embodiments, the cell compositions of the invention are administered to a patient in conjunction with (e.g., before, simultaneously, or after) bone marrow transplantation, chemotherapy agents such as fludarabine, external beam radiation therapy (XRT), and cyclophosphamide. For example, in one embodiment, a subject may undergo high-dose chemotherapy followed by a peripheral blood stem cell transplant. In some embodiments, after transplant, the subject receives an infusion of expanded immune cells of the invention. In another embodiment, the expanded cells are administered pre- or post-surgery.

[0192] The dosage of the above treatment administered to a patient will vary depending on the exact nature of the disease being treated and the recipient being treated. The dosage rate administered to a human can be implemented according to accepted practices in the art. Typically, a single treatment or course of treatment will be administered in the range of 1×10 6 pieces~1×10 10 The modified T cells of the present invention can be administered to a patient, for example, by means of intravenous infusion.

[0193] The main advantages of the present invention are: (1) In the present invention, for the first time, it was found that an endogenous chimeric antigen receptor (ECAR) designed by using an endogenous protein molecule instead of an antibody single domain fragment as the extracellular antigen-binding domain of the CAR can specifically and selectively kill several types of cells and has a remarkable killing effect.

[0194] (2) In the present invention, for the first time, an endogenous protein molecule is used as the extracellular binding domain of a chimeric antigen receptor, and a new endogenous chimeric antigen receptor (eCAR) is constructed. The gene sequence of the extracellular binding domain is selected from the molecular chain of a protein present in the human body, so that it has good tolerance in the human body and avoids rejection reactions.

[0195] (3) In the present invention, an endogenous chimeric antigen receptor (CAR) is designed by targeting an antigen that has already been found to have a ligand in the body, and using an endogenous protein molecule instead of an antibody single domain fragment as the extracellular antigen-binding domain of the CAR. The method of the present invention greatly shortens the time cost, reduces the economic cost, and avoids the process of antibody production and screening.

[0196] (4) The endogenous chimeric antigen receptor designed in the present invention is composed entirely of endogenous protein molecular chains and therefore does not lead to rejection reactions in the human body, unlike chimeric antigen receptors that have conventional exogenous single-domain antibodies.

[0197] The present invention will be further described below with reference to specific examples. It is understood that these examples are only used to illustrate the present invention and do not limit the scope of the present invention. Experimental methods for which no specific conditions are given in the following examples are generally performed according to standard conditions, such as those described in Sambrook et al., "Molecular Cloning: A Laboratory Manual" (New York, Cold Spring Harbor Laboratory Press, 1989), or according to the manufacturer's recommended conditions. Unless otherwise stated, percentages and parts are by weight.

[0198] Unless otherwise stated, all materials or reagents used in the examples of the present invention are commercially available. EXAMPLES

[0199] Example 1: Confirmation of the hCD8α signal peptide-hIL5 (endogenous protein molecule)-hCD28 hinge region-hCD28 transmembrane region-hCD28 intracellular domain (costimulatory molecule)-hCD3ζ gene sequence and construction of lentiviral vector The NCBI database was searched for the gene sequences of human CD8α signal peptide, human IL5, human CD28 hinge region, human CD28 transmembrane region, human CD28 intracellular domain, and human CD3ζ intracellular region.

[0200] We commissioned Tsingke Biotech Co., Ltd. to synthesize the complete hIL5-ECAR gene sequence in the order of the coding region of the gene for human CD8α signal peptide, the coding region of the gene for human IL5, the coding region of the gene for human CD28 hinge region, the coding region of the gene for human CD28 transmembrane region, the coding region of the gene for human CD28 intracellular domain, and the coding region of the gene for human CD3ζ intracellular domain, and then ligated the hIL5-ECAR into the PHAGE lentivirus plasmid by PCR and the non-ligase-dependent single fragment rapid cloning kit of Vazyme Biotech Co., Ltd. The ligation product was transformed into competent cells (DH5α, Tsingke Biotech Co., Ltd.), plated overnight, and a single clone was selected and sent to Tsingke Biotech Co., Ltd. for sequencing, and the sequencing results were compared to confirm that the plasmid construction was successful.

[0201] The purified hIL5-ECAR lentiviral plasmid was extracted using the Plasmid Maxi Kit from Kangwei Century Co., Ltd. (a schematic diagram of the plasmid is shown in Figure 1).

[0202] Example 2: Packaging and concentration of hIL5-ECAR lentivirus The hIL5-ECAR plasmid obtained in Example 1 was used to transduce 293T cells using the PEI method to package the virus, and the virus was concentrated by ultracentrifugation. The specific steps are as follows: Day 1: 293T cells with a passage number of less than 20 and a cell density of approximately 90% were selected and placed in a 15 cm dish containing 30 mL of DMEM complete medium at a cell density of 30%. The cells were thoroughly mixed evenly and cultured overnight at 37°C in a 5% CO2 incubator. Day 2: When the 293T cell density was observed to reach 70%-90%, the medium was discarded and 27 mL of new 10% serum-containing DMEM medium was added to prepare for transduction. Preparation of plasmid mixture: 1500 μL of DMEM medium was added to a clean 15 mL centrifuge tube, and 22.5 μg of hIL5-ECAR lentivirus plasmid obtained in Example 1, 16.875 μg of psPAX2, and 5.625 μg of pMD2.G were added and mixed thoroughly and uniformly. Separately, a clean 15 mL centrifuge tube was taken, and 1500 μL of DMEM medium was added, and 112.5 μL of PEI 40000 transduction reagent from Shanghai Yisheng Bio-Technology Co., Ltd. was added and mixed thoroughly and uniformly. The PEI mixture was added dropwise to the plasmid mixture, mixed thoroughly and uniformly, and left to stand for 20 min. 3 mL of the above mixture was placed in a 293T cell dish along the wall of the dish and cultured at 37°C for 8 hours. The medium was then aspirated and discarded, and 30 mL of fresh heated 10% serum-containing DMEM complete medium was gently poured into the dish along the wall. Day 4: 36-48 h after transduction, the viral supernatant was collected and filtered through a 0.22 μm filter. The filtered supernatant was transferred to an ultracentrifuge tube, balanced, and centrifuged at 35,000 rpm for 90 min at 4°C in an ultracentrifuge. After centrifugation, the supernatant was aspirated and discarded, and the precipitate obtained per 30 mL of virus stock solution was resuspended in 300 μL DMEM medium. The concentrated hIL5-ECAR lentivirus solution was used for infection within 24 h or stored at -80°C.

[0203] Example 3: Detection of CD69 expression after co-culturing hIL5-ECAR Jurkat and hIL5Ra target cells Jurkat cell line was infected with the hIL5-ECAR virus concentrated in Example 2 to obtain hIL5-ECAR Jurkat stable transfected cell line. In the experimental group, each well was inoculated with 1×10 hIL5-ECAR Jurkat cells. 5 1 × 10 hIL5Ra target cells (U2OS cell line) 5 For the negative control group, each well contained 1 × 10 hIL5-ECAR Jurkat cells. 51 × 10 hIL5Ra-free target cells (U2OS cell line) 5 In the blank group, each well contained 1×10 hIL5-ECAR Jurkat cells. 5 The entire system was made up of 200 μL of 1640 complete medium containing 10% serum, and the two types of cells were thoroughly and homogeneously mixed and then co-cultured in a 96-well plate.

[0204] After 24 hours of incubation in an incubator, the cells were collected and washed once with 1 mL PBS (Beijing Solarbio Science & Technology Co.,Ltd) in each tube, centrifuged at 400g for 5 min, and the supernatant was discarded. 100 μL of PBS and 0.5 μL of Biolegend's human CD69 flow cytometry antibody (PE fluorescence) were added and stained at 4°C for 30 min away from light. The cells in each tube were washed once with 1 mL 1×PBS, centrifuged at 400g for 5 min, and the supernatant was discarded. The cells were resuspended in 200 μL of PBS and the expression of surface CD69 on hIL5-ECAR Jurkat cells was detected by flow cytometer. FIG. 2 shows that hIL5-ECAR Jurkat cells after co-culture were significantly activated by hIL5Ra target cells (simulating inflammatory cells (eosinophils)).

[0205] Example 4: Purification and culture of human T cells Human peripheral blood mononuclear cells were obtained using lymphocyte separation fluid (DAYOU), and CD3 T lymphocytes were isolated and purified using Biolegend's CD3 T cell negative selection kit. The cells were cultured in X-VIVO 15 medium (LONZA) at a cell density of 1 × 10 6 / mL and the quantity is 1 x 10 6 CD3 / CD28 magnetic beads (Gibco) were added and the cells were stimulated and cultured for 48 hours.

[0206] Example 5: Infection of human T cells with hIL5-ECAR lentivirus and detection of viral infection efficiency by flow cytometry The hIL5-ECAR concentrated virus obtained in Example 3 was used to infect human T cells by centrifugal infection method to produce CART cells, and the expression of hIL5-ECAR was detected by flow cytometry. The specific steps are as follows: After 2 days of activation culture of T cells, the cells were counted and the T cell density was 1 × 10 6 / well, and 500 μL of fresh X-VIVO 15 was added to each well and inoculated into a new 24-well plate. Preparation of virus solution: each well was filled with 100 μL of the virus concentrate of Example 2, 6 μg / mL polybrene (Shanghai Yisheng Bio-Technology Co., Ltd.), and 400 μL of X-VIVO 15 medium. Centrifugal infection of T cells: The 24-well plate was placed in a centrifuge and centrifuged at 32°C, 1500 g for 2 h. After centrifugation, the infected T cells were centrifuged at 1600 rpm for 5 minutes, the supernatant was aspirated and discarded, and each well was inoculated into a new 24-well plate with 1 mL of fresh X-VIVO medium. The cells were cultured in an incubator at 37°C and 5% CO2. After 72 h of incubation, 5 × 10 5 The CAR T cells and T cells (control group) were collected in a flow cytometry tube, washed once with PBS, the supernatant was discarded, and Biolegend's hIL5 flow cytometry antibody was added and stained for 30 minutes in the dark, washed again with PBS, resuspended in 200 μL of PBS, and detected by a flow cytometer. As shown in Figure 3, the expression efficiency of hIL5-ECAR was 41% 72 hours after infecting T cells with the hIL5-ECAR lentivirus obtained in Example 2.

[0207] Example 6: Detection of killing after co-culturing hIL5-ECAR T and target cells expressing hIL5Ra (luciferase detection method) The luciferase-containing hIL5Ra-U2OS target cells were constructed by lentivirus infection, and the killing ability of hIL5-ECAR T cells was detected by the luminescence intensity of luciferase. The specific steps are as follows:

[0208] Prepare an all-white 96-well plate from White Blood Cells and resuspend hIL5Ra-U2OS-luciferase target cells and U2OS-luciferase cells in X-VIVO 15 medium until the cell density is 1 × 10 4 / well, with each well being 100 μL. The hIL5-ECAR T cells prepared in Example 5 were resuspended in X-VIVO 15 medium until the cell density reached 2 × 10 6 / mL and dilute to 5 × 10 4 / well, 2.5 x 10 4 / well, 1.25 x 10 4 Plates were seeded at cell densities of 0 / well, 1 / well, and 100 μL in each well.

[0209] In the experimental group, 100 μL of hIL5Ra-U2OS-luciferase target cells, 100 μL of hIL5-ECAR T cells with different cell densities or uninfected T cells (UTD-T) were placed in each well of a 96-well plate, and in the negative control group, 100 μL of U2OS-luciferase target cells, 100 μL of hIL5-ECAR T cells with different cell densities or uninfected T cells (UTD-T) were placed in each well of a 96-well plate. After thorough homogeneous mixing, the mixture was cultured in a 37°C, 5% CO2 incubator for 24 hours.

[0210] After 24 hours, the 96-well plate was removed. The medium in the well plate was discarded, and 1 μL of coenzyme A (Beijing Solarbio Science & Technology Co., Ltd.) and 1 μL of D-fluorescein (Gold Biotechnology) and 100 μL of PBS were added to each well, and the reaction was allowed to proceed for 10 minutes in the dark, and the chemiluminescence intensity was detected by an M5 microplate reader.

[0211] As shown in Figure 4, after co-culture of hIL5-ECAR T cells with hIL5R-U2OS-luciferase target cells, the killing ability was enhanced with increasing effector-target ratio, and showed dose-dependence. Lysis was calculated as (1-(RLU) sample ) / (RLU max RLU was defined as )) × 100. sample is the relative light intensity of the sample detected by the microplate reader, RLU max indicates the relative light intensity of the target cell control group that did not contain killed cells, detected by the microplate reader.

[0212] Example 7: Detection of IFN-γ secretion after co-culturing hIL5-ECAR T and target cells expressing hIL5Ra Prepare a clear 96-well plate and resuspend hIL5Ra-U2OS target cells and U2OS cells in X-VIVO 15 medium until the cell density is 1 × 10 4 The concentration was adjusted to 1 / well.

[0213] The hIL5-ECAR T cells prepared in Example 5 were resuspended in X-VIVO 15 medium until the cell density reached 2 × 10 6 / mL and dilute to 5 × 10 4 / well, 2.5 x 10 4 Plates were seeded at a cell density of 100 μL / well with each well containing 100 μL.

[0214] In the experimental group, 100 μL of hIL5Ra-U2OS-luciferase target cells and 100 μL of hIL5-ECAR T cells with different cell densities were placed in each well of a 96-well plate, and in the negative control group, 100 μL of U2OS-luciferase target cells and 100 μL of hIL5-ECAR T cells with different cell densities were placed in each well of a 96-well plate. After thorough homogeneous mixing, the mixture was cultured in a 37°C, 5% CO2 incubator for 24 hours.

[0215] After 24 hours, the 96-well plate was removed. The supernatant was removed into a 1.5 mL EP tube. The cells were centrifuged at 400 g for 5 min at 4°C in a centrifuge to remove cell debris, and the supernatant was retained. The IFN-γ content in the supernatant was detected using an Abclonal human IFN-γ ELISA kit according to the kit instructions.

[0216] The results, as shown in Figure 5, showed that hIL5-ECAR T cells effectively secreted large amounts of IFN-γ after co-culture with hIL5R-U2OS target cells, but failed to secrete IFN-γ after co-culture with U2OS target cells.

[0217] Example 8: Confirmation of the mCD8α signal peptide-mIL5 (endogenous protein molecule)-mCD28 hinge region-mCD28 transmembrane region-mCD28 intracellular domain (costimulatory molecule)-mCD3ζ gene sequence and construction of lentiviral vector The NCBI database was searched for the gene sequences of mouse CD8α signal peptide, mouse IL5, mouse CD8α hinge region, mouse CD8α transmembrane region, mouse CD28 intracellular domain, and mouse CD3ζ intracellular region.

[0218] We commissioned Tsingke Biotech Co., Ltd. to synthesize the complete mIL5-ECAR gene sequence in the order of the coding region of the gene for mouse CD8α signal peptide, the coding region of the gene for mouse IL5, the coding region of the gene for mouse CD28 hinge region, the coding region of the gene for mouse CD28 transmembrane region, the coding region of the gene for mouse CD28 intracellular domain, and the coding region of the gene for mouse CD3ζ intracellular domain, and then ligated mIL5-ECAR into the PMX retrovirus plasmid by PCR and the non-ligase-dependent single fragment rapid cloning kit of Vazyme Biotech Co., Ltd. The ligation product was transformed into susceptible cells (DH5α), plated overnight, and a single clone was selected and sent to Tsingke Biotech Co., Ltd. for sequencing, and the sequencing results were compared to confirm that the plasmid construction was successful.

[0219] The purified mIL5-ECAR lentiviral plasmid was extracted using the Plasmid Maxi Kit from Kangwei Century Co., Ltd. (a schematic diagram of the plasmid is shown in Figure 6).

[0220] Example 9: Packaging and concentration of mIL5-ECAR retrovirus The mIL5-ECAR plasmid obtained in Example 8 was used to transduce the Plat-E cell line using the PEI method to package the virus, and the virus was concentrated by ultracentrifugation. The specific steps are as follows: Day 1: Plat-E cells with a passage number of less than 20 and a cell density of approximately 90% were selected and placed in a 15 cm dish containing 30 mL of DMEM complete medium at a cell density of 30%. The cells were thoroughly mixed evenly and cultured overnight at 37°C in a 5% CO2 incubator. Day 2: When the Plat-E cell density was observed to reach 70% to 90%, transfection was prepared. Preparation of plasmid mixture: 1.5 mL of DMEM medium was placed in a clean 15 mL centrifuge tube, and 45 μg of mIL5-ECAR lentivirus plasmid obtained in Example 8 was placed and mixed thoroughly and uniformly. Separately, a clean 15 mL centrifuge tube was taken, and 1.5 mL of DMEM medium was placed, and 112.5 μL of transfection reagent PEI was placed and mixed thoroughly and uniformly. The PEI mixture was dropped into the plasmid mixture, mixed thoroughly and uniformly, and left to stand for 20 min. 3 mL of the mixture was placed in a Plat-E cell dish along the wall of the dish, and cultured at 37 ° C for 8 h, the medium was aspirated and discarded, and fresh 10% serum-containing DMEM complete medium that had been reheated was gently placed along the wall of the dish. Day 4: 48 h after transduction, the viral supernatant was collected and filtered through a 0.22 μm filter. The filtered supernatant was transferred to an ultracentrifuge tube, balanced, and centrifuged at 35,000 rpm for 90 min at 4°C in an ultracentrifuge. After centrifugation, the supernatant was aspirated and discarded, and the precipitate obtained per 30 mL of virus stock solution was resuspended in 300 μL DMEM medium. The concentrated mIL5-ECAR retrovirus solution was used for infection within 24 h or stored at -80°C.

[0221] Example 10: Purification and culture of murine T cells Biolegend brand anti-mouse CD3 factor and anti-mouse CD28 factor were diluted in PBS to 1 μg / mL and 2 μg / mL, respectively, and placed in a 24-well plate, with 500 μL per well, and incubated in a 37°C incubator for 2 h before use. One Balb / c mouse was sacrificed by means of cervical dislocation, and the spleen was removed and ground in a clean bench, lysed of red blood cells with red blood cell lysis solution (BD Biosciences), and filtered through a 0.45 μm filter net to obtain a spleen single cell suspension. T lymphocytes were isolated and purified with Biolegend brand mouse CD3 T cell negative selection kit. The cells were cultured at a cell density of 1 × 10 in 1640 complete medium containing 10% fetal bovine serum (Gibco), 1% penicillin-streptomycin solution (Beyotime Biotechnology), 1% 1 M HEPES (Beijing Solarbio Science & Technology Co., Ltd), 1% MEN NEAA (Gibco), 1% 100 mM sodium pyruvate (Jinno Biopharmaceutical Technology Co., Ltd), and 1‰ β-mercaptoethanol (Sigma-Aldrich). 6 The 24-well plate was taken out from the 37°C incubator, the liquid was aspirated and discarded, and 1 × 10 6 T cells were added and incubated in a 37°C incubator for 48 hours.

[0222] Example 11: Infection of mouse T cells with mIL5-ECAR retrovirus and detection of viral infection efficiency by flow cytometry The mIL5-ECAR concentrated virus obtained in Example 9 was used to infect mouse T cells by centrifugal infection method to produce CART cells, and the expression of mIL5-ECAR was detected by flow cytometry. The specific steps are as follows:

[0223] After 2 days of activation culture of T cells, the cells were counted and the T cell density was 1 × 10 6 / well, and inoculated a new 24-well plate with 500 μL of fresh 1640 complete medium per well.

[0224] Preparation of virus solution: 100 μL of the virus concentrate of Example 9, 6 μg / mL polybrene, and 400 μL of X-VIVO 15 medium were added to each well.

[0225] Centrifugal infection of T cells: The 24-well plate was placed in a centrifuge and centrifuged at 32°C, 1500 g for 2 h.

[0226] After centrifugation, the infected T cells were centrifuged at 1600 rpm for 5 minutes, the supernatant was aspirated and discarded, and each well was inoculated into a new 24-well plate with 1 mL of fresh 1640 complete medium. The cells were cultured in an incubator at 37°C and 5% CO2.

[0227] After 72 h of incubation, 5 × 10 5 The mIL5-ECAR T cells and T cells (control group) were collected in a flow cytometry tube, washed once with PBS, discarded the supernatant, added Biolegend's mIL5 flow cytometry antibody, and stained for 30 minutes away from light, washed again with PBS, resuspended in 200 μL of PBS, and detected by a flow cytometer. As shown in Figure 7, 72 hours after infecting T cells with the mIL5-ECAR retrovirus obtained in Example 9, the expression efficiency of mIL5-ECAR was 56%.

[0228] Example 12: Detection of killing effect on eosinophils after mIL5-ECAR T is introduced back into a mouse asthma model Six to eight week old SPF male Balb / c mice were housed at the Animal Center of Zhejiang University and injected with mIL5-ECAR T cells via the tail vein. The cell dose was 3 × 10 6 The cells were resuspended in saline (Genka Bio) per mouse, with the injection volume for each mouse being 200 μL. The control group was injected with the same volume of saline.

[0229] Preparation of sensitization solution (prepared immediately before use): 20 mg of ovalbumin (OVA, Sigma-Aldrich) was weighed out and dissolved in 1 mL of physiological saline to obtain solution A. 0.4 mL to 15 mL of solution A was taken and placed in a sterile centrifuge tube, and mixed evenly with 9.6 mL of sterile physiological saline to obtain solution B. 2 mL of solution B was taken and placed in a new 15 mL centrifuge tube, and mixed with 2 mL of Imject. (商標) Alum adjuvant (Thermo Scientific (商標) ) was added and mixed thoroughly to prepare the sensitization solution, which was then ready for use.

[0230] Sensitization: One week after the return of mIL5-ECAR T cells, each mouse was intraperitoneally injected with 200 μL of sensitization solution, which was designated as day 1, and a second sensitization was performed on day 14 with the same vehicle and volume.

[0231] Nebulization: Thereafter, OVA nebulization was performed daily on days 27, 28, and 29, respectively (the nebulization liquid had a volume of 10 mL, was a saline solvent, and contained 130 mg OVA).

[0232] Treatment of mice: Mice were treated on the 30th day. Each mouse was intraperitoneally injected with 200μL of 1.5% sodium pentobarbital tungsten (Shandong Xiya Chemical Industry Co., Ltd.), and after the mouse was anesthetized, the mouse's thoracic cavity was cut open, and blood was collected from the heart, placed in a 1.5mL EDTA anticoagulant tube, and placed on ice. The airway and both lobes were exposed, and the right lung was ligated near the hilum of the right lung with a thin wire to make a small incision at the far end of the airway, and a syringe (artificially blunted 20mL syringe needle and 1mL syringe cylinder) was prepared. The syringe was inserted into the airway through the small hole, the needle was placed in the airway, the cylinder was removed, and 400μL of clean PBS was sucked up, and then slowly pushed from the airway into the lung, and the syringe was repeatedly moved back and forth 2-3 times, and finally the aspirated liquid was put into a 1.5mL EP tube and placed on ice, and the whole liquid became the bronchoalveolar lavage fluid (BALF). The above steps were repeated three times to obtain a total of about 1 mL of BALF. Finally, 400 μL of 4% formaldehyde solution (China Pharmaceutical Group) was aspirated and injected into the left lung, and the airway was ligated to prevent formaldehyde leakage. The four right lung lobes were cut and placed in tissue homogenization tubes, respectively, and stored in liquid nitrogen. The airway ligation line was pulled up, and the entire left lung was cut and placed together with the heart in a 15 mL centrifuge tube containing 13 mL of 4% formaldehyde.

[0233] After mixing the BALF homogenously, 20μL was taken into a PCR tube, 20μL of erythrocyte digestion solution was added, mixed homogenously, waited for 1min, and counted under a microscope. The remaining BALF was centrifuged at 6000rpm, 4℃ for 15min, and the supernatant was collected and stored at -80℃. The cell precipitate was diluted with 200μL of chilled PBS (300μL was added in the OVA group). 100μL of the cell suspension was placed in a flow cytometry tube containing 1mL PBS (including one blank group and six single reference tubes) and centrifuged at 400g, 4℃ for 5min, and the other 100μL was centrifuged. After centrifugation, the supernatant was discarded and 100 μL of chilled PBS (containing 0.5 μL of flow cytometry antibodies, including CD45 (PE-CY7, biolegend), SiglecF (PE, biolegend), F4 / 80 (APC-CY7, biolegend), CD11b (FITC, biolegend), CD11c (APC, biolegend) and DAPI (PB450)) was added, and the mixture was mixed uniformly by blowing. The mixture was then incubated in a refrigerator at 4°C for 30 min, away from light. 1 mL of chilled PBS was added to each tube, and the tubes were centrifuged at 400g for 5 min at 4°C. After discarding the supernatant, 200 μL of chilled PBS was added and the tubes were set in the device to detect the expression of eosinophils.

[0234] As shown in Figure 8, after treating Balb / c mice with the OVA asthma model (see the model construction flow diagram in Figure 8a) with mIL5-ECAR T, the ratio of eosinophils in the BALF fluid (the fourth bar from the left in the right column in Figure 8b) and the absolute value of eosinophils in the BALF fluid (the fourth bar from the left in the column in Figure 8c) were significantly lower than those in the OVA asthma model group injected with saline (the right bar in Figure 8b and the third bar from the left in the column in Figure 8c). At the same time, when comparing the treatment of the OVA asthma model group with mIL5-ECAR T and the OVA asthma model group injected with saline, the ratio of eosinophils showed a tendency to decrease in BALF fluid, and similar decreased changes were also observed in lung tissue (the third and fourth columns from the left in the vertical bar graph in Fig. 8d) and peripheral blood (the third and fourth columns from the left in the vertical bar graph in Fig. 8e), suggesting that mIL5-ECAR T can effectively reduce eosinophils in the asthma model induced by OVA.

[0235] Example 13: Detection of alleviating effects on inflammatory factors after mIL5-ECAR T is introduced back into a mouse asthma model RNA extraction from lung tissue: A piece of lung tissue from a processed mouse was selected, polished with polishing beads, and 1 mL of Trizol (Takara) was added. The tissue was polished in a polisher at a speed of 60 Hz for 1 min, and this was repeated once. The tissue was left at room temperature for 5 min, then blown to mix, and the decomposition liquid was collected in a 1.5 mL EP tube. 0.2 mL of trichloromethane (Kokusai Pharmaceutical Group) was added to each tube, shaken thoroughly to mix evenly, and left at room temperature for 5 min. The tubes were centrifuged at 12000 g for 15 min at 4°C. After centrifugation, the tissue was separated into three layers, with the RNA distributed in the upper aqueous phase, and 400 μL of the upper liquid was sucked up into a new EP tube. 0.5 mL of isopropanol (Kokusai Pharmaceutical Group) was added to the RNA solution in each tube, and the tubes were gently mixed evenly by inverting the tubes, and left at room temperature for 5 min. The tubes were centrifuged at 12000 g for 10 min at 4°C. The supernatant was discarded, and the precipitate was left. Add 1mL of chilled 75% ethanol to each tube, gently invert the tube upside down to float the precipitate, and be careful not to apply too much pressure to cause the precipitate to burst. Centrifuge at 4℃ and 9000g for 5min. Remove the remaining liquid with absorbent paper and dry at room temperature for 5min. Add an appropriate amount of DEPC water and mix by blowing until the RNA is dissolved. The concentration and mass of the RNA were measured using Nanodrop.

[0236] RNA reverse transcription: Using a Takara reverse transcription kit, cDNA was obtained in the following reaction system. Reverse transcription reaction system: 5×PrimeScript Buffer 4μL PrimeScript RT Enzyme Mix 1μL Random 6 mers (100uM) 1μL Oligo dT Primer (50uM) 1μL Total mRNA 1000ng DEPC water up to 20μL Reaction conditions: 37℃ 15min 85℃ 5sec

[0237] The mRNA levels of IL4 and IL25 inflammatory factors were quantitatively detected by fluorescent quantitative PCR (RT-PCR) using Takara's fluorescent quantitative PCR kit. The reaction system was as follows. RT-PCR reaction system: Taq Mix 10μL Primer F 1μL Primer R 1μL ddH20 6μL 2 μL cDNA The reaction program is as follows: 94℃ 2 min 94℃ 15 sec, 60℃ 30 sec, 72℃ 30 sec, 40 cycles 72℃ 10 min 4℃ sustained

[0238] After processing and analyzing the data, the results were as shown in Figure 9. After treating Balb / c mice with OVA model (fourth from the left in the vertical bar graph in Figure 9), the mRNA levels of inflammation-related factors (IL4, IL25) in the lung tissue were significantly lower than those of the OVA model group simply injected with saline (third from the left in the vertical bar graph in Figure 9). And compared with the untreated group (first from the left in the vertical bar graph in Figure 9) and the group simply injected with mIL5-ECAR T (second from the left in the vertical bar graph in Figure 9), there was no obvious difference, which showed that airway inflammation was obviously alleviated.

[0239] Example 14: Detection of the alleviating effect on inflammation after mIL5-ECAR T is administered back to a mouse asthma model Lung tissue pathology was used to determine the severity of airway inflammation by observing the infiltration of inflammatory cells around the airways in the lung tissue of the mice.

[0240] We commissioned Gu Song Biotechnology Co., Ltd. to prepare sections of the lung tissue, and stained them with hematoxylin-eosin (HE) to make it easier to observe the infiltration of inflammatory cells.

[0241] Specific semi-quantitative airway inflammation scores are as follows: Score 0: No infiltration of inflammatory cells around the airways. Score 1: Occasional infiltration of inflammatory cells was observed around the airways. Score 2: There is a thin layer of inflammatory cell infiltrate around most of the airways, or there is a thick layer of inflammatory cell infiltrate in some areas. Score 3: There is a thick layer of inflammatory cell infiltrate around most of the airways.

[0242] The results are shown in Figure 10. In the representative images of lung tissue HE sections of Balb / c mice treated with mIL5-ECAR T in the OVA model (fourth image from the left in Figure 10a), it is clearly seen that the infiltration of inflammatory cells was significantly less than that of the OVA model group simply injected with saline (third image from the left in Figure 10a). After further quantitative analysis of the data, it was shown that the inflammation level of the OVA model treated with mIL5-ECAR T (fourth image from the left in the vertical bar graph in Figure 10b) was significantly alleviated compared to that of the OVA model group simply injected with saline (third image from the left in the vertical bar graph in Figure 10b).

[0243] Example 15: Construction of hPlau-ECAR T primary mouse cells The human Plau gene sequence was searched from the NCBI database.

[0244] We commissioned Tsingke Biotech Co., Ltd. to synthesize a fragment of the coding region of the human Plau gene. Then, by PCR and the non-ligase-dependent single fragment rapid cloning kit of Vazyme Biotech Co., Ltd., we completed the sequence of the coding region of the mouse CD8α signal peptide gene, the coding region of the human Plau gene, the coding region of the mouse CD28 hinge region gene, the coding region of the mouse CD28 transmembrane region gene, the coding region of the mouse CD28 intracellular domain gene, and the coding region of the mouse CD3ζ intracellular domain gene in this order, and ligated the hPlau-ECAR gene sequence into the PMX retrovirus plasmid. The ligation product was transformed into responsive cells (DH5α), plated overnight, and a single clone was selected and sent to Tsingke Biotech Co., Ltd. for sequencing, and the sequencing results were compared to confirm that the plasmid construction was successful.

[0245] The purified hPlau-ECAR retroviral plasmid was extracted using the Plasmid Maxi Kit from Kangwei Century Co., Ltd. (a schematic diagram of the plasmid is shown in FIG. 11).

[0246] The packaging and concentration of the hPlau-ECAR retrovirus was carried out according to Example 9.

[0247] Obtaining, activating and culturing murine T lymphocytes were carried out according to Example 10.

[0248] hPlau-ECAR T cells were constructed according to Example 11.

[0249] Example 16: Detection of killing after co-culturing hPlau-ECAR T with target cells expressing human Plau receptor (hPlauR) (simulation of senescent cells) (luciferase detection method) The hPlauR-293T target cells carrying luciferase were constructed by lentivirus infection method, and the killing ability of hPlau-ECAR T cells was detected by the luminescence intensity of luciferase. The specific steps are as follows:

[0250] Prepare a WHB brand all-white 96-well plate and resuspend the hPlau-293T-luciferase target cells and 293T-luciferase cells in 100 µL of 1640 complete medium until the cell density is 1 × 10 4 The concentration was adjusted to 1 / well.

[0251] The hPlau-ECAR T cells prepared in Example 5 were resuspended in 1640 complete medium until the cell density reached 2 × 10 6 / mL and then gradient dilution to 1 × 10 5 / well, 5 x 10 4 / well, 2.5x 4 Plates were seeded at a density of 0 cells / well with 100 μL in each well.

[0252] In the experimental group, 100 μL of hPlauR-293T-luciferase target cells and 100 μL of hPlau-ECAR T cells with different cell densities were placed in each well of a 96-well plate; in the negative control group, 100 μL of 293T-luciferase target cells and 100 μL of hPlau-ECAR T cells with different cell densities were placed in each well of a 96-well plate; in the blank control group and the positive control group, 100 μL of hPlauR-293T-luciferase and 100 μL of 1640 complete medium were placed in each well of a 96-well plate, mixed thoroughly and uniformly, and then cultured in an incubator at 37°C and 5% CO2 for 12 h.

[0253] After 12 hours, the 96-well plate was removed. In the positive control group, 1 μL of NP40 (Beijing Solarbio Science & Technology Co., Ltd.) was added to each well and mixed thoroughly. After 5 minutes, the medium in the well plate was discarded, and 1 μL of coenzyme A and 1 μL of D-fluorescein and 100 μL of PBS were added to each well, and the reaction was allowed to proceed for 10 minutes in the dark, and the chemiluminescence intensity was detected by an M5 microplate reader.

[0254] As shown in FIG. 12, after co-culture of hPlau-ECAR T cells with hPlauR-293T-luciferase target cells, the killing ability was enhanced with an increase in the effector-target ratio, and showed a dose-dependent manner.

[0255] Example 17: Construction of hCCL11-ECAR T primary mouse cells The human CCL11 gene sequence was searched from the NCBI database.

[0256] We commissioned Tsingke Biotech Co., Ltd. to synthesize a fragment of the coding region of the human CCL11 gene. Then, by PCR and the non-ligase-dependent single fragment rapid cloning kit of Vazyme Biotech Co., Ltd., we completed the sequence of the coding region of the gene for mouse CD8α signal peptide, the coding region of the human CCL11 gene, the coding region of the gene for mouse CD28 hinge region, the coding region of the gene for mouse CD28 transmembrane region, the coding region of the gene for mouse CD28 intracellular domain, and the coding region of the gene for mouse CD3ζ intracellular domain in this order, and ligated the hCCL11-ECAR gene sequence into the PMX retrovirus plasmid. The ligation product was transformed into responsive cells (DH5α), plated overnight, and a single clone was selected and sent to Tsingke Biotech Co., Ltd. for sequencing, and the sequencing results were compared to confirm that the plasmid construction was successful.

[0257] The purified hCCL11-ECAR retroviral plasmid was extracted using the Plasmid Maxi Kit from Kangwei Century Co., Ltd. (a schematic diagram of the plasmid is shown in FIG. 13).

[0258] Packaging and concentration of the hCCL11-ECAR retrovirus was carried out according to Example 9.

[0259] Obtaining, activating and culturing murine T lymphocytes were carried out according to Example 10.

[0260] hCCL11-ECAR T cells were constructed according to Example 11.

[0261] Example 18: Detection of killing after co-culturing hCCL11-ECAR T with target cells expressing human CCR3 receptors (simulation of inflammatory cells (eosinophils)) (luciferase detection method) The hCCR3-U2OS target cells carrying luciferase were constructed by lentivirus infection method, and the killing ability of hCCl11-ECAR T cells was detected by the luminescence intensity of luciferase. The specific steps are as follows:

[0262] Prepare an all-white 96-well plate in WHB and resuspend hCCR3-U2OS-luciferase target cells in 100 µL of 1640 complete medium so that the cell density is 1 × 10 4 The concentration was adjusted to 1 / well.

[0263] Resuspend the hCCL11-ECAR T cells prepared in Example 17 in 1640 complete medium until the cell density is 2 × 10 6 / mL and dilute to 2 × 10 5 / well, 1 x 10 5 / well, 5 x 10 4 / well, 2.5 x 10 4 Plates were seeded at a cell density of 100 μL / well with each well containing 100 μL.

[0264] In the experimental group, 100 μL of hCCR3-U2OS-luciferase target cells and 100 μL of hCCL11-ECAR T cells with different cell densities were placed in each well of a 96-well plate, and in the blank control group and positive control group, 100 μL of hCCR3-U2OS-luciferase target cells and 100 μL of 1640 complete medium were placed in each well of a 96-well plate, mixed thoroughly and uniformly, and then cultured in an incubator at 37°C and 5% CO2 for 12 hours.

[0265] After 12 hours, the 96-well plate was removed. In the positive control group, 1 μL of NP40 was added to each well and mixed thoroughly. After 5 minutes, the medium in the well plate was discarded, and 1 μL of coenzyme A, 1 μL of D-fluorescein, and 100 μL of PBS were added to each well, and the reaction was allowed to proceed for 10 minutes in the dark, and the chemiluminescence intensity was detected by an M5 microplate reader.

[0266] The results, as shown in FIG. 14, showed that after co-culture of hCCL11-ECAR T cells with hCCR3-U2OS-luciferase target cells, the killing ability was enhanced with increasing effector-to-target ratio, and was dose-dependent.

[0267] Example 19: Construction of hCCL24-ECAR T primary mouse cells The human CCL24 gene sequence was searched from the NCBI database. We commissioned Tsingke Biotech Co., Ltd. to synthesize a fragment of the coding region of the human CCL24 gene. Then, by PCR and the non-ligase-dependent single fragment rapid cloning kit of Vazyme Biotech Co., Ltd., we completed the sequence of the coding region of the gene for mouse CD8α signal peptide, the coding region of the gene for human CCL24, the coding region of the gene for mouse CD28 hinge region, the coding region of the gene for mouse CD28 transmembrane region, the coding region of the gene for mouse CD28 intracellular domain, and the coding region of the gene for mouse CD3ζ intracellular domain in this order, and ligated the hCCL24-ECAR gene sequence into the PMX retrovirus plasmid. The ligation product was transformed into responsive cells (DH5α), plated overnight, and a single clone was selected and sent to Tsingke Biotech Co., Ltd. for sequencing, and the sequencing results were compared to confirm that the plasmid construction was successful.

[0268] The purified hCCL24-ECAR retroviral plasmid was extracted using the Plasmid Maxi Kit from Kangwei Century Co., Ltd. (a schematic diagram of the plasmid is shown in FIG. 15).

[0269] Packaging and concentration of the hCCL24-ECAR retrovirus was carried out according to Example 9.

[0270] Obtaining, activating and culturing murine T lymphocytes were carried out according to Example 10.

[0271] hCCL24-ECAR T cells were constructed according to Example 11.

[0272] Example 20: Detection of killing after co-culturing hCCL24-ECAR T with target cells expressing human CCR3 receptors (luciferase detection method) The hCCR3-U2OS target cells carrying luciferase were constructed by lentivirus infection method, and the killing ability of hCCl24-ECAR T cells was detected by the luminescence intensity of luciferase. The specific steps are as follows:

[0273] Prepare an all-white 96-well plate in WHB and resuspend hCCR3-U2OS-luciferase target cells in 1640 complete medium until a cell density of 1 x 10 4 The concentration was adjusted to 1 / well.

[0274] Resuspend the hCCL24-ECAR T cells prepared in Example 17 in 50 μL of 1640 complete medium to a cell density of 2 × 10 6 / mL and dilute to 2 × 10 5 / well, 1 x 10 5 / well, 5 x 10 4 / well, 2.5 x 10 4 Plates were seeded at a cell density of 100 μL / well with each well containing 100 μL.

[0275] In the experimental group, 100 μL of hCCR3-U2OS-luciferase target cells and 100 μL of hCCL24-ECAR T cells with different cell densities were placed in each well of a 96-well plate, and in the blank control group and positive control group, 100 μL of hCCR3-U2OS-luciferase target cells and 100 μL of 1640 complete medium were placed in each well of a 96-well plate, mixed thoroughly and uniformly, and then cultured in an incubator at 37°C and 5% CO2 for 12 hours.

[0276] After 12 hours, the 96-well plate was removed. In the positive control group, 1 μL of NP40 was added to each well and mixed thoroughly. After 5 minutes, the medium in the well plate was discarded, and 1 μL of coenzyme A and 1 μL of D-fluorescein and 100 μL of PBS were added to each well, and the reaction was allowed to proceed for 10 minutes in the dark, and the chemiluminescence intensity was detected by an M5 microplate reader.

[0277] The results, as shown in FIG. 16, showed that after co-culture of hCCL24-ECAR T cells with hCCR3-U2OS-luciferase target cells, the killing ability was enhanced with increasing effector-to-target ratio, and was dose-dependent.

[0278] All documents related to the present invention are incorporated herein by reference as if each document were incorporated individually. After reading the above content of the present invention, it will be understood that those skilled in the art can make various changes and modifications to the present invention, and that equivalent forms thereof are within the scope of the claims of the present invention.

Claims

1. 1. An endogenous chimeric antigen receptor CAR (ECAR), comprising an antigen-binding domain, the antigen-binding domain being an endogenous protein molecule, wherein the endogenous protein molecule is IL5 (interleukin 5), Plau (urokinase-type plasminogen activator), CCL11, or CCL24.

2. The ECAR of claim 1, wherein the amino acid sequence of the endogenous protein molecule consists of any one of SEQ ID NOs: 1 to 5.

3. The chimeric antigen receptor CAR (ECAR) of claim 1, wherein the structure of the ECAR is represented by formula I. [Formula 1] L-Z1-Z2-TM-C-CD3ζ (I) (In the formula, Each "-" is independently a connecting peptide or a peptide bond. L is the signal peptide sequence. Z1 is an antigen-binding domain that is an endogenous protein molecule. Z2 is absent or is the hinge region. TM is the transmembrane domain. C is a costimulatory signal molecule. CD3ζ is an intracellular signaling sequence derived from CD3ζ.

4. A nucleic acid molecule encoding the endogenous chimeric antigen receptor CAR (ECAR) of claim 1.

5. A vector comprising the nucleic acid molecule of claim 4.

6. A host cell comprising the vector according to claim 5, or chromosomally incorporating an exogenous nucleic acid molecule according to claim 4, or expressing the ECAR according to claim 1.

7. 13. A method for producing an engineered immune cell, said engineered immune cell expressing an ECAR according to claim 1, comprising the step of obtaining said engineered immune cell by transducing a nucleic acid molecule according to claim 4 or a vector according to claim 5 into a macrophage, a T cell or a NK cell.

8. A pharmaceutical composition comprising the ECAR of claim 1, the nucleic acid molecule of claim 4, the vector of claim 5, or the host cell of claim 6, together with a pharma- ceutically acceptable carrier, diluent or excipient.

9. 10. Use of an ECAR according to claim 1, a nucleic acid molecule according to claim 4, a vector according to claim 5, a host cell according to claim 6, or a pharmaceutical composition according to claim 8, for the manufacture of a drug or formulation for use in (a) selectively killing cells and / or (b) treating a disease.

10. 13. A kit for selectively killing cells, comprising a container and an ECAR of claim 1, a nucleic acid molecule of claim 4, a vector of claim 5, a host cell of claim 6, or a pharmaceutical composition of claim 8 located within the container.

Images