Methods for producing vascular smooth muscle cells derived from pluripotent stem cells, uses and related compositions

A method using pluripotent stem cells induces VSMCs with a contractile phenotype, addressing the generation and maintenance challenges, enhancing their response to vasoactive agents and therapeutic applications for cardiovascular diseases.

JP7778376B2Active Publication Date: 2025-12-02EMORY UNIVERSITY
View PDF 7 Cites 0 Cited by

Patent Information

Application Number
JP2022561523
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Priority Date
2020-04-09
Filing Date
2021-04-09
Publication Date
2025-12-02
Estimated Expiration
2041-04-09

AI Technical Summary

Technical Problem

Existing methods are inadequate for generating and maintaining vascular smooth muscle cells (VSMCs) in a contractile phenotype, which are crucial for managing vascular dysfunction and conditions like atherosclerosis and pulmonary hypertension.

Method used

A method involving pluripotent stem cells is developed, where the cells are induced through a mesoderm differentiation medium with specific growth factors, followed by serum-free culture with collagen, and purification based on cadherin-2 expression to produce VSMCs with a contractile phenotype.

Benefits of technology

The method effectively generates VSMCs that respond to vasoactive agents, offering potential therapeutic benefits for cardiovascular diseases by maintaining a contractile phenotype and improving blood vessel function.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007778376000003
    Figure 0007778376000003
  • Figure 0007778376000004
    Figure 0007778376000004
  • Figure 0007778376000005
    Figure 0007778376000005
Patent Text Reader

Abstract

The present invention relates to a method for producing vascular smooth muscle-like cells from precursor stem cells. In certain embodiments, the vascular smooth muscle-like cells can contract in response to vasoactive agents. In certain embodiments, the method comprises contacting pluripotent stem cells with a mesoderm differentiation-inducing growth medium, then replicating the cells in a serum-free vascular smooth muscle cell growth medium in the presence of collagen, and purifying the replicated cells that express cadherin-2. In certain embodiments, the purified cells are used to treat or prevent cardiovascular diseases or conditions.
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This application claims the benefit of priority to U.S. Provisional Patent Application No. 63 / 007,698, filed April 9, 2020, the entirety of which is incorporated herein by reference for all purposes.

[0002] STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT This invention was made with government support under grants HL127759 and DK108245 from the National Institutes of Health. The federal government has certain interests in this invention.

[0003] Inserting citations for materials submitted as text files via the Office Electronic File System (EFS-WEB) The Sequence Listing associated with this application is provided in text form in lieu of paper and is incorporated herein by reference. The text file containing the Sequence Listing is named 19072PCT_ST25.txt. The text file is 10 KB, was created on April 8, 2021, and has been submitted electronically via EFS-Web. [Background technology]

[0004] background Vascular dysfunction often occurs after cardiovascular ischemic events such as myocardial infarction (MI) and peripheral arterial disease (PAD). These diseases often result in atherosclerotic blockage of blood vessels, leading to poor circulation and ultimately to tissue death. Therefore, there is a need to identify improved methods for managing the consequences of vascular dysfunction.

[0005] In addition to endothelial cells, blood vessels contain vascular smooth muscle cells (VSMCs). VSMCs exist in a contractile (differentiated) phenotype characterized by the expression of smoothelin (SMTN) and smooth muscle myosin heavy chain. A decrease in VSMC contractility and the acquisition of an epithelial phenotype are involved in proliferative vascular lesions such as vasculitis, plaque formation, atherosclerosis, restenosis, and pulmonary hypertension. However, when isolated and cultured in the presence of serum, VSMCs transition to a less differentiated state known as a synthetic phenotype and become proliferative. Therefore, improved methods for generating and maintaining VSMCs and maintaining their contractile phenotype are needed.

[0006] Cheung et al. reported the generation of subtypes of human vascular smooth muscle (Nat Biotechnol. 2012, 30(2): 165-173). Patsch et al. reported the generation of vascular endothelial cells and smooth muscle cells from human pluripotent stem cells (Nat Cell Biol 2015, 17:994-1003).

[0007] The documents cited herein are not admitted to be prior art. Summary of the Invention

[0008] overview The present disclosure relates to a method for producing vascular smooth muscle-like cells from progenitor stem cells. In certain embodiments, the vascular smooth muscle-like cells respond to vasoactive agents. In certain embodiments, the method comprises contacting pluripotent stem cells with a mesoderm induction growth medium, and then replicating the cells in a serum-free vascular smooth muscle cell growth medium in the presence of collagen, and purifying the replicating cells that express cadherin-2. In certain embodiments, the purified cells are used to treat or prevent a cardiovascular disease or condition.

[0009] In certain embodiments, the present invention relates to a method for producing vascular smooth muscle-like cells of a contractile phenotype, comprising transforming pluripotent stem cells into cells that express smoothelin and smooth muscle myosin heavy chain, and purifying the cells that express cadherin-2 to provide a purified composition of vascular smooth muscle-like cells that express cadherin-2 of a contractile phenotype. In certain embodiments, the method further comprises replicating the vascular smooth muscle-like cells that express cadherin-2.

[0010] In a particular embodiment, the present invention provides a method for producing vascular smooth muscle-like cells, comprising the steps of: a) contacting pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one or more days under conditions such that the pluripotent stem cells form induced mesoderm-like cells, wherein the mesoderm differentiation-inducing growth medium comprises 1) a rho-associated protein kinase inhibitor, 2) a glycogen synthase kinase-3 inhibitor, and 3) basic fibroblast growth factor; b) contacting the induced mesoderm-like cells with a first vascular smooth muscle cell growth medium for one or more days under conditions such that the mesoderm-like cells form induced vascular smooth muscle-like cells, wherein the first vascular smooth muscle cell growth medium comprises 1) transforming growth factor-β, 2) epidermal growth factor, and 3) platelet-derived growth factor; and c) contacting the induced vascular smooth muscle-like cells with a protease or collagenase under conditions such that the induced vascular smooth muscle-like cells detach from each other to cause detachment. a) exposing the detached induced vascular smooth muscle-like cells to collagen and a first vascular smooth muscle cell growth medium for one day or more to replicate the cells and provide replicated vascular smooth muscle-like cells; b) contacting the replicated vascular smooth muscle-like cells with a second vascular smooth muscle cell growth medium for one day or more under conditions such that the replicated vascular smooth muscle-like cells form a second batch of induced vascular smooth muscle-like cells, wherein the second vascular smooth muscle cell growth medium contains 1) transforming growth factor-β, 2) epidermal growth factor, and 3) platelet-derived growth factor; and c) purifying the second batch of induced vascular smooth muscle-like cells by selecting cells that express cadherin-2 to provide purified induced vascular smooth muscle-like cells that express cadherin-2.

[0011] In certain embodiments, the concentration of transforming growth factor-β in the second vascular smooth muscle cell growth medium is increased relative to the concentration of transforming growth factor-β in the first vascular smooth muscle cell growth medium.

[0012] In certain embodiments, the concentration of platelet-derived growth factor in the second vascular smooth muscle cell growth medium is reduced relative to the concentration of platelet-derived growth factor in the first vascular smooth muscle cell growth medium.

[0013] In certain embodiments, the rho-associated protein kinase inhibitor is trans-4-[(1R)-1-aminoethyl]-N-4-pyridinylcyclohexanecarboxamide (Y-27632) or a salt thereof.

[0014] In certain embodiments, the glycogen synthase kinase-3 inhibitor is 6-[[2-[[4-(2,4-dichlorophenyl)-5-(5-methyl-1H-imidazol-2-yl)-2-pyrimidinyl]amino]ethyl]amino]-3-pyridinecarbonitrile (CHIR-99021) or a salt thereof.

[0015] In certain embodiments, said pluripotent stem cells are embryonic stem (ES) cells or induced pluripotent stem (iPS) cells.

[0016] In certain embodiments, contacting the pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one or more days comprises contacting for four days.

[0017] In certain embodiments, contacting the pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one or more days comprises contacting for five days or less.

[0018] In certain embodiments, contacting the induced mesoderm-like cells with the first vascular smooth muscle cell growth medium for one or more days comprises contacting for 20 days.

[0019] In certain embodiments, contacting the induced mesoderm-like cells with the first vascular smooth muscle cell growth medium for one or more days is for a period of 21 days or less.

[0020] In certain embodiments, replicating the detached induced vascular smooth muscle-like cells by exposure to collagen and the first vascular smooth muscle cell growth medium for one or more days comprises replicating for 15 days.

[0021] In certain embodiments, the replication of the detached induced vascular smooth muscle-like cells by exposure to collagen and the first vascular smooth muscle cell growth medium for one or more days is for a period of 16 days or less.

[0022] In certain embodiments, contacting the replicated vascular smooth muscle-like cells with the second vascular smooth muscle cell growth medium for one or more days comprises contacting for 25 days or more.

[0023] In certain embodiments, contacting the replicated vascular smooth muscle-like cells with the second vascular smooth muscle cell growth medium for one or more days is for a period of 26 days or less.

[0024] In certain embodiments, the methods described herein further comprise replicating the purified cadherin-2-expressing vascular smooth muscle-like cells by exposing them to collagen and a second vascular smooth muscle cell growth medium for one or more days.

[0025] In certain embodiments, selecting cells that express cadherin-2 comprises contacting the cells with an anti-cadherin-2 antibody, marking with a fluorescent antibody, selecting the cells by fluorescence-activated cell sorting, and selecting the cells by fluorescence-activated cell sorting.

[0026] In certain aspects, the invention relates to compositions and growth media comprising cells produced by the methods described herein.

[0027] In certain embodiments, the present invention relates to a method for treating or preventing a cardiovascular disease or condition, comprising administering to a subject in need thereof an effective amount of cells produced by the methods described herein. In certain embodiments, the pluripotent stem cells are induced pluripotent stem cells derived from the subject. In certain embodiments, the subject is diagnosed with myocardial infarction, vascular inflammation, plaque formation, atherosclerosis, restenosis, and pulmonary hypertension.

[0028] In certain embodiments, the vascular smooth muscle-like cells contract in response to vasoactive agents such as carbachol, endothelin-1 (ET-1) or KCl.

[0029] In certain embodiments, vascular smooth muscle-like cells are mixed with or administered in combination with endothelial cells or endothelial-like cells, resulting in improved blood flow restoration compared to administration of endothelial cells or endothelial-like cells alone.

[0030] In certain embodiments, vascular smooth muscle-like cells are mixed with or administered in combination with endothelial cells or endothelial-like cells that form capillary-like tubes. [Brief explanation of the drawings]

[0031] [Figure 1] Figure 1 shows the method for generating VSMCs from hiPSCs. [Figure 2] FIG. 2 shows data on gene expression patterns during the differentiation process of hiPSC-VSMCs. [Figure 3] Figure 3 shows the gene expression patterns of hiPSC-VSMCs compared with hAoSMCs. [Figure 4] FIG. 4 shows data demonstrating that expression of pluripotency-associated genes is decreased in CDH2-positive hiPSC-VSMCs at day 57. [Figure 5] FIG. 5 shows the percentage of hiPSC-VSMCs positive for VSMC-specific markers at day 63. [Figure 6] Figure 6A shows data demonstrating increased intracellular calcium flux in hiPSC-VSMCs, and Figure 6B shows data demonstrating increased contractility in hiPSC-VSMCs. [Figure 7] Figure 7 shows quantification of tube formation of hiPSC-VSMCs using HUVECs. [Figure 8] FIG. 8 shows data regarding the expression of MMP2 and MMP9 genes in hiPSC-VSMCs. DETAILED DESCRIPTION OF THE INVENTION

[0032] Detailed Description Before describing the present invention in more detail, it is to be understood that this invention is not limited to particular embodiments described, as such may, of course, vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to be limiting, since the scope of the present invention will be limited only by the appended claims.

[0033] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. Although any methods and materials similar or equivalent to those described herein can also be used in the practice or testing of the present invention, the preferred methods and materials are described herein.

[0034] All publications and patents cited herein are incorporated by reference to the same extent as if each individual publication or patent was specifically and individually indicated to be incorporated by reference, and are incorporated herein by reference to disclose and describe the methods and / or materials in connection with which the publications are cited. The citation of any publication is for its disclosure prior to the filing date and should not be construed as an admission that the present disclosure is not entitled to antedate such publication by prior disclosure. Further, the dates of publication provided may be different from the actual publication dates, which may need to be independently confirmed.

[0035] As will be apparent to those skilled in the art upon reading this specification, each of the individual embodiments described and illustrated herein has distinct components and features which may be readily separated from or combined with the features of any of the other embodiments without departing from the scope or spirit of the invention. Any recited method can be carried out in the order of events recited or in any other order which is logically possible.

[0036] Aspects of the present invention may employ, unless otherwise indicated, techniques of medicine, organic chemistry, biochemistry, molecular biology, pharmacology and the like, which are within the skill of those in the art, and such techniques are fully explained in the literature.

[0037] It is noted that as used in this specification and the appended claims, the singular forms "a," "an," and "the" include the plural forms unless the context clearly dictates otherwise.

[0038] By "subject" is meant any animal, preferably a mammal, such as a human, monkey, mouse, or rabbit.

[0039] As used herein, the terms "treat" and "treatment" are not limited to cases where a subject (e.g., a patient) is cured or the disease is eradicated. Rather, embodiments of the present invention also contemplate treatment that merely alleviates symptoms and / or slows the progression of the disease.

[0040] The terms "smooth muscle α-actin" and "aortic smooth muscle actin" refer to the gene product of ACTA2 on chromosome 10. Homo sapiens (human) actin α2, smooth muscle (ACTA2) transcript variant 1, mRNA has NCBI reference sequence NM_001141945.2.

[0041] The terms "smooth muscle myosin heavy chain" and "SMHC" refer to the gene product of MYH11 on Homo sapiens (human) chromosome 16. Human myosin heavy chain 11 (MYH11), transcript variant SM2B, mRNA has NCBI reference sequence NM_001040113.2.

[0042] The terms "transgelin" and "SM22-α" refer to the gene product of TAGLN on human chromosome 11. Human transgelin (TAGLN), transcript variant 2, mRNA has the NCBI reference sequence NM_003186.5.

[0043] The terms "calponin 1" and "CNN1" refer to the gene product of CNN1 on Homo sapiens (human) chromosome 19. Human calponin 1 (CNN1), transcript variant 1, mRNA has the NCBI reference sequence NM_001299.6.

[0044] The terms "caldesmon1" and "CALD1" refer to the gene product of CALD1 on Homo sapiens (human) chromosome 7. Human caldesmon1 (CALD1), transcript variant 2, mRNA is NCBI reference sequence NM_004342.7.

[0045] The terms "smoothelin" and "SMTN" refer to the gene product of SMTN on Homo sapiens (human) chromosome 22. Human smoothelin (SMTN), transcript variant 4, mRNA has NCBI reference sequence NM_001207017.1.

[0046] Glycogen synthase kinase 3 (GSK-3) is a serine / threonine kinase. GSK-3 transfers a phosphate group to either a serine or threonine residue of a substrate. Phosphorylation of GSK-3 regulates biological processes such as metabolism (glucose regulation), cell signaling, cell trafficking, apoptosis, and proliferation. A "GSK-3 inhibitor" refers to a molecule that interferes with the phosphorylation of a substrate. In certain embodiments, the GSK-3 inhibitor contemplated herein is selected from the following: 6-[[2-[[4-(2,4-dichlorophenyl)-5-(5-methyl-1H-imidazol-2-yl)-2-pyrimidinyl]amino]ethyl]amino]-3-pyridinecarbonitrile (CHIR99021); N-6-[2-[[4-(2,4-dichlorophenyl)-5-(1H-imidazol-1-yl)-2-pyrimidinyl]amino]ethyl]-3-nitro -2,6-Pyridinediamine (CHIR-98014); 3-(1,3-Dihydro-3-oxo-2H-indol-2-ylidene)-1,3-dihydro-2H-indol-2-one (indirubin); (2'Z,3'E)-6-Bromoindirubin-3'-oxime (BIO); (2'Z,3'E)-6-Bromoindirubin-3'-acetoxime (BIO-acetoxime); 3-(2,4-Dichlorophenyl)-4-(1-methyl-1H-indole -3-yl)-1H-pyrrole-2,5-dione (SB216763); 3-[6-(3-aminophenyl)-7H-pyrrolo[2,3-d]pyrimidin-4-yloxy]phenol (TWS119); 4-benzyl-2-(naphthalen-1-yl)-[1,2,4]thiadiazolidine-3,5-dione (tideglusib); 3-[(3-chloro-4-hydroxyphenyl)-amino]-4-(2-nitrophenyl)-1H-pyrrole-2,5-dione (SB 415286);3-amino-6-[4-[(4-methyl-1-piperazinyl)sulfonyl]phenyl]-N-3-pyridinyl-2-pyrazinecarboxamide (AZD2858);2-hydroxy-3-[5-[(morpholin-4-yl)methyl]pyridin-2-yl]-1H-indole-5-carbonitrile (AZD1080);N-(4-methoxybenzyl)-N'-(5-nitro-1,3-thiazol-2-yl)urea (AR-A014418);3-[9-fluoro-1,2,3,4-tetrahydro-2-(1-piperidinylcarbonyl)pyrrolo[3,2,1-jk][1,4]benzodiazepin-7-yl]-4-imidazo[1,2-a]pyridin-3-yl-1h-pyrrole-2,5-dione (LY2090314); and 3-(4-fluorophenylethylamino)-1-methyl-4-(2-methyl-1H-indol-3-yl)-1H-pyrrole-2,5-dione (IM-12) or a salt thereof.

[0047] Rho-associated protein kinase (ROCK) is a serine-threonine kinase involved in intracellular events, including vasoconstriction and vascular remodeling. ROCK is a downstream effector protein of the small GTPase Rho. "ROCK inhibitor" refers to a molecule that interferes with the phosphorylation of its substrate. In certain embodiments, the ROCK inhibitor contemplated herein is selected from fasudil; ripasudil; netarsudil; N-[(3-hydroxyphenyl)methyl]-N'-[4-(4-pyridinyl)-2-thiazolyl]urea (RKI-1447); trans-4-[(1R)-1-aminoethyl]-N-4-pyridinylcyclohexanecarboxamide (Y-27632); 4-[4-(trifluoromethyl)phenyl]-N-(6-fluoro-1H-indazol-5-yl)-2-methyl-6-oxo-1,4,5,6-tetrahydro-3-pyridinecarboxamide (GSK-429286); and 4-(1-aminoethyl)-N-(1H-pyrrolo(2,3-b)pyridin-4-yl)cyclohexanecarboxamide (Y-30141) or a salt thereof.

[0048] The terms "transforming growth factor beta," "TGF-β," and "TGF-beta" refer to a cytokine secreted by various cell types and regulating homeostasis in normal epithelial cells. Three isoforms of TGF-β exist. TGF-β isoform 1 is the most prominent. Human recombinant TGF-β is commercially available as a 25.0 kDa protein consisting of 112 aa subunits linked by a single disulfide bond, each subunit having the following sequence: ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS (SEQ ID NO: 1).

[0049] The term "basic fibroblast growth factor" or "bFGF" refers to a protein with a β-trefoil structure that binds to members of the FGF receptor (FGFR) family. Human recombinant bFGF is commercially available in the form of a 154 amino acid protein having the following sequence: AAGSITTLPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS (SEQ ID NO: 2).

[0050] The terms "epidermal growth factor" and "EGF" refer to a protein that is approximately 6 kDa. The human EGF gene encodes a preproprotein that is proteolytically processed to produce a peptide that functions to stimulate the division of epithelial and other cells. Human recombinant EGF is commercially available in the form of a 54 amino acid protein having the following sequence: MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (SEQ ID NO: 3).

[0051] Platelet-derived growth factor (PDGF) is a disulfide-linked dimer of two polypeptide chains, termed PDGF-A and PDGF-B. The three naturally occurring PDGFs are PDGF-AA, PDGF-BB, and PDGF-AB. Human recombinant PDGF-BB is commercially available as a 24.3 kDa disulfide-linked homodimer of two β-chains (218 amino acids total) with the following sequence: SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT (SEQ ID NO: 4).

[0052] Cadherin-2 (CDH2), also known as N-cadherin and CD325, is a transmembrane hydrophilic glycoprotein that belongs to the calcium-dependent cell adhesion molecule family. Human recombinant CDH2 is commercially available as a polypeptide chain with the following sequence: (SEQ ID NO: 5).

[0053] As used herein, the term "allogeneic" refers to cells that are not derived from the same person and are therefore genetically different. Cells derived from the same person are called "syngeneic."

[0054] Embryonic stem cells (ESCs) are derived from the inner cell mass of mammalian blastocysts, which develop 5–7 days after fertilization. ESCs remain undifferentiated indefinitely under defined conditions and differentiate into the so-called embryonic body when cultured in vitro. Because they are pluripotent, they can differentiate into all cell types. Adult stem cells (somatic cells), such as hematopoietic stem cells, neural stem cells, and mesenchymal stem cells, have the potential to become two or more cell types, but not all cell types.

[0055] Induced pluripotent stem cells (iPSCs) are differentiated cells reprogrammed back to the pluripotent stage. Reprogrammed, fully differentiated cells can be achieved using genes involved in maintaining ESC pluripotency, such as Oct3 / 4, Sox2, c-Myc, Klf4, and combinations thereof. The term "induced pluripotent stem cells" refers to cells reprogrammed from somatic or adult stem cells to an embryonic stem cell (ESC)-like pluripotent state. See Takahashi et al., "Induction of pluripotent stem cells from mouse embryonic and adult fibroblast cultures by defined factors," Cell, 2006, 126(4):663-67. Park et al. reported reprogramming of human somatic cells to pluripotency with defined factors (Nature, 2008, 451(7175):141-146). Therefore, generating iPSCs in cells can generally be achieved by ectopic (in trans) expression of OCT4, SOX2, KLF4, and c-MYC. Colonies emerge and are morphologically similar to ESCs. Alternatively, some pluripotent stem cells may not require all four transcripts. For example, umbilical cord blood CD133+ cells require only OCT4 and SOX2 to generate iPSCs. For further guidance on generating iPSCs, see Gonzalez et al., "Methods of making induced pluripotent stem cells: reprogramming a la carte," Nature Reviews Genetics 2011 12:231-242.

[0056] Induced pluripotent stem cells generally express alkaline phosphatase, Oct4, Sox2, Nanog, and / or other pluripotency-promoting factors. Induced pluripotent stem cells are not intended to be completely identical to embryonic cells. In addition, induced pluripotent stem cells are not necessarily capable of differentiating into all types of cells. TRA-1-60, TRA-1-8, or a combination thereof can be used to identify human iPSCs.

[0057] In certain embodiments, the present invention contemplates that the induced pluripotent stem cells are derived from adult stem cells or mesenchymal stem cells. These terms include the cultured (self-renewing) progeny of the cell population. The term "mesenchymal stromal cells" or "mesenchymal stem cells" refers to a subpopulation of fibroblasts or fibroblast-like non-hematopoietic cells with plastic adhesive properties that can differentiate in vitro into cells of mesodermal origin, which may be derived from bone marrow, adipose tissue, Wharton's jelly of the umbilical cord, umbilical cord perivascular cells, umbilical cord blood, amniotic fluid, placenta, skin, dental pulp, breast milk, and synovium; or clonogenic fibroblasts or fibroblast-like cells that can differentiate into several cells of mesodermal origin, such as adipocytes, osteoblasts, chondrocytes, skeletal muscle cells, or visceral stromal cells.

[0058] In certain embodiments, the present invention contemplates that induced pluripotent stem cells are derived from human adipose stem cells.Sun et al., Proc Natl Acad Sci U S A., 2009, 106(37):15720-15725, reports that induced pluripotent stem (iPS) cells can be produced from adult human adipose stem cells (hASCs) freshly isolated from patients.

[0059] In certain embodiments, the present invention contemplates that the induced pluripotent stem cells are derived from bone marrow-derived mesenchymal stromal cells. Bone marrow-derived mesenchymal stromal cells are typically expanded ex vivo from bone marrow aspirate to confluence. Certain mesenchymal stromal / stem cells (MSCs) share a similar set of core markers and properties. Certain mesenchymal stromal / stem cells (MSCs) can be defined as positive for CD105, CD73, and CD90, negative for CD45, CD34, CD14 or CD11b, CD79α or CD19, and HLA-DR surface markers, and capable of adhering to plastic. See Dominici et al., "Minimal criteria for defining multipotent mesenchymal stromal cells," The International Society for Cellular Therapy position statement, Cytotherapy, 2006, 8(4):315-317.

[0060] As used herein, the term "growth medium" refers to a composition containing components that promote cell maintenance and growth through protein biosynthesis, such as vitamins, amino acids, inorganic salts, buffers, and fuels, such as acetate, succinate, sugars, and / or any nucleotides. Additionally, growth medium may contain phenol red as a pH indicator. Components in growth medium may be derived from blood serum, or the growth medium may be serum-free. Growth medium may optionally be supplemented with albumin, lipids, insulin and / or zinc, transferrin or iron, selenium, ascorbic acid, and antioxidants such as glutathione, 2-mercaptoethanol, or 1-thioglycerol. Other components contemplated for growth medium include ammonium metavanadate, copper sulfate, manganese chloride, ethanolamine, and sodium pyruvate. Other contemplated components for growth medium include ascorbic acid, L-alanine, zinc sulfate, human transferrin, albumin, and insulin.

[0061] Minimum essential medium (MEM) is a term of art that refers to a growth medium containing calcium chloride, potassium chloride, magnesium sulfate, sodium chloride, sodium phosphate, and sodium bicarbonate, essential amino acids, and the vitamins thiamine (vitamin B1), riboflavin (vitamin B2), nicotinamide (vitamin B3), pantothenic acid (vitamin B5), pyridoxine (vitamin B6), folic acid (vitamin M), choline, and inositol (originally known as vitamin B8). A variety of growth media are known in the art.

[0062] Dulbecco's Modified Eagle's Medium (DMEM) is a growth medium that contains increased amounts of vitamins, amino acids, and glucose, and additional components such as glycine, serine, and ferric nitrate, as shown in Table 1 below.

[0063] [Table 1]

[0064] Ham's F-12 medium is high in amino acids, vitamins, and other trace elements. Putrescine and linoleic acid are included in the formulation. See Table 2 below.

[0065] [Table 2]

[0066] In certain embodiments, the present invention contemplates a growth medium described herein that utilizes DMEM / F-12 medium, which is a mixture of DMEM and Ham's F-12. In certain embodiments, the growth medium may include an antibacterial agent or combination of antibacterial agents, for example, an antifungal agent including the antibiotics penicillin, streptomycin, and the antifungal agent amphotericin B.

[0067] Human embryonic stem cells and induced pluripotent stem cells can be cultured in the presence of basic fibroblast growth factor (bFGF), for example, on a fibroblast feeder layer or in unconditioned medium (UM) supplemented with 100 ng / mL or more of bFGF. Growth medium (TeSR1) is a DMEM / F12-based medium supplemented with human serum albumin, vitamins, antioxidants, trace minerals, specific lipids, and cloned growth factors. (商標) TeSR medium is a DMEM / F12 base containing 52 components, to which 18 components have been added. TeSR1 is reported in the supplementary material of Ludwig et al., Derivation of human embryonic stem cells in defined conditions, Nature Biotechnology volume 24, pages 185-187 (2006). (商標) A list of each component and associated concentrations is below:

[0068] inorganic salts Calcium chloride (anhydrous) HEPES Lithium chloride (LiCl) Magnesium chloride (anhydrous) Magnesium sulfate (MgSO4) Potassium chloride (KCl) Sodium bicarbonate (NaHCO3) Sodium chloride (NaCl) Sodium phosphate (anhydrous) Sodium phosphate (monobasic) (NaH2PO4-H20) trace minerals Ferric nitrate (Fe(NO3)3-9H2O) Ferric sulfate (FeSO4·7H2O) Copper sulfate (CuSO4·5H2O) Zinc sulfate (ZnSO4·7H2O) Ammonium metavanadate (NH4VO3) Manganese sulfate monohydrate (MnSO4·H2O) Nickel sulfate hexahydrate (NiSO4·6H2O) selenium Sodium metasilicate Na2SiO39H2O SnCl2 Molybdic acid, ammonium salt CdCl2 CrCl3 AgNO3 AlCl3 6H2O Ba(C2H3O2)2 CoCl26H2O GeO2 KBr KI NaF RbCl ZrOCl28H2O Energy Substrate D-glucose Sodium pyruvate lipids Linoleic acid Linolenic acid Lipoic Acid Arachidonic acid cholesterol DL-α-Tocopheryl acetate Myristic acid oleic acid Palmitic acid Palmitoleic acid stearic acid amino acid L-alanine L-Arginine Hydrochloride L-Asparagine-H2O L-Aspartic Acid L-Cysteine-HCl-H2O L-Cystine Hydrochloride L-Glutamic Acid L-Glutamine glycine L-Histidine-HCl-H2O L-Isoleucine L-Leucine L-Lysine Hydrochloride L-Methionine L-Phenylalanine L-Proline L-Serine L-Threonine L-tryptophan L-Tyrosine Disodium 2H2O L-valine Vitamins Ascorbic acid Biotin B12 Choline chloride D-Calcium Pantothenate folic acid i-Inositol Niacinamide Pyridoxine hydrochloride Riboflavin Thiamine hydrochloride Growth factors and other proteins GABA Pipecolic acid bFGF TGFβ1 Human insulin Human holotransferrin Human serum albumin Glutathione (reduced) Other ingredients Hypoxanthine Sodium Phenol red Putrescine-2HCl Thymidine 2-mercaptoethanol Pluronic F-68 Tween 80

[0069] Animal-derived proteins (bovine serum albumin (BSA) and Matrigel) (商標) Modifications of the medium (mTeSR1), including the use of Matrigel and cloned zebrafish basic fibroblast growth factor (zbFGF), are described in Ludwig et al., "Feeder-independent culture of human embryonic stem cells," Nature Methods, Vol. 3, pp. 637-646 (2006). (商標)The matrix is ​​a solubilized basement membrane preparation extracted from the Engelbreth-Holm-Swarm (EHS) mouse sarcoma, a tumor rich in extracellular matrix proteins. (商標) Matrigel is a partially defined extracellular matrix (ECM) extract containing laminin (the main component), collagen IV, heparan sulfate proteoglycans, entactin / nidogen, and many growth factors, such as TGF-β1, epidermal growth factor, insulin-like growth factor, fibroblast growth factor, and tissue plasminogen activator. (商標) Alternatively, native and recombinant vitronectin were effective in maintaining sustained self-renewal and pluripotency in three independent human embryonic stem cell lines (Stem Cells, 2008, 26(9): 2257-65).

[0070] Chen et al. reported that E8-based medium can be used to induce and culture iPS cells under defined conditions (Nat Methods, 2011, 8(5): 424-429). Human ES cells and iPS cells can be grown in DMEM / F12 medium containing insulin, selenium, transferrin, L-ascorbic acid, bFGF, and TGF-β (or NODAL) with pH adjusted with NaHCO3. Addition of NODAL (100 ng / ml) or TGF-β1 (2 ng / ml) increased NANOG expression levels and resulted in consistent long-term culture stability for both human ES cells and iPS cells. The inclusion of either a ROCK inhibitor (HA100 or Y27632) or blebbistatin improved initial viability and assisted cloning, which was further improved by the addition of transferrin and culturing under hypoxic conditions. Several matrix proteins, including laminin, vitronectin, and fibronectin, support the growth of human ES cells.

[0071] The term "fluorescence-activated cell sorting" or "FACS" refers to a method for sorting a mixture of cells into three or more regions, usually one cell at a time, based on the fluorescent properties of each cell. Separation is typically achieved by applying an electric charge and moving the cells through an electrostatic field. Cells can also be labeled by mixing them with fluorescent antibodies bearing epitopes against cell surface markers. Typically, in FACS, a vibrating mechanism separates a stream of cells into individual droplets. Just before droplet formation, the cells pass through a region where their fluorescence is measured. A charging mechanism is installed at the point where the droplets separate. Based on the fluorescence intensity measurement, each droplet is charged as it separates from the stream. The charged droplets then travel through an electrostatic deflection system, which separates the droplets into regions based on their relative charges. In some systems, a charge is applied directly to the stream, and separating droplets retain a charge of the same sign as the stream. In other systems, a charge is applied to the flow channel, inducing an opposite charge in the droplets.

[0072] Mutants of the proteins described herein can be easily produced by those skilled in the art. Computer modeling can be used to predict functional variants with structural similarity. Tests to confirm intrinsic activity can be performed using the literature or methods described herein. Those skilled in the art will understand that numerous effective variants predicted to have desirable properties can be produced. The genes are known, and members share significant homology from one species to another. The sequences are not identical, as shown by the differences between human and mouse sequences. Some substitutions are conservative. Some substitutions are not conservative. To create functional variants, those skilled in the art can use computer programs to perform stable substitutions rather than blindly trying random combinations. Those skilled in the art will know that certain conservative substitutions are desirable. In addition, those skilled in the art will typically not alter evolutionarily conserved positions. See Saldano et al., "Evolutionary Conserved Positions Define Protein Conformational Diversity," PLoS Comput Biol., 2016, 12(3):e1004775.

[0073] Guidance for determining which amino acid residues and to what extent can be substituted, inserted, or deleted without losing biological activity can be found using computer programs in combination with publicly available databases known in the art, such as RaptorX, ESyPred3D, HHpred, Homology Modeling Professional for HyperChem, DNAStar, SPARKS-X, EVfold, Phyre, and Phyre2 software. See Kelley et al., Nat Protoc., 2015, 10(6):845-858, which reports the Phyre2 web portal for protein modeling, prediction, and analysis. It is also described in Marks et al., Protein structure from sequence variation, Nat Biotechnol, 2012, 30(11):1072-1080; Mackenzie et al., Curr Opin Struct Biol, 2017, 44:161-167; Mackenzie et al., Proc Natl Acad Sci U S A., 2016, 113(47), E7438-E7447 and Wei et al., Int. J. Mol. Sci., 2016, 17(12), 2118.

[0074] In certain embodiments, the present invention contemplates the use of variants of the polypeptide sequences described herein that have 50%, 60%, 70%, 80%, 90%, 95% or more identity. "Sequence identity" refers to a measure of relatedness between three or more nucleic acids or proteins, typically expressed as a percentage based on the total length of the comparison. Identity calculations take into account amino acid residues that are identical and in the same relative positions within each larger sequence. Identity calculations can be performed using default parameters by algorithms contained within computer programs such as "GAP" (Genetics Computer Group, Madison, Wis.) and "ALIGN" (DNAStar, Madison, Wis.). In certain embodiments, sequence "identity" refers to the number of exact matching residues (expressed as a percentage) in a sequence alignment between two sequences in an alignment. In certain embodiments, the percent identity of an alignment may be calculated using the number of identical positions divided by the number of equivalent positions in the shortest sequence or excluding overhangs, where internal gaps are counted as equivalent positions. For example, the polypeptides GGGGGG (SEQ ID NO:6) and GGGGT (SEQ ID NO:7) share 4 out of 5 or 80% sequence identity. For example, the polypeptides GGGPPP (SEQ ID NO:8) and GGGAPPP (SEQ ID NO:9) share 6 out of 7 or 85% sequence identity.

[0075] In certain embodiments, it is also contemplated that for any contemplated percent sequence identity, sequences may have the same percent or more sequence similarity. Percent "similarity" is used to quantify the degree of amino acid similarity, e.g., hydrophobicity, hydrogen bonding potential, electrostatic charge, between two aligned sequences. This method is similar to determining identity, except that certain amino acids do not need to be identical to be matched. In certain embodiments, sequence similarity may be calculated using well-known computer programs with default parameters. Generally, amino acids are classified as matching when they are in groups with similar properties, for example, according to the following amino acid groups: aromatic—FYW; hydrophobic—AVIL; charged positive—RKH; charged negative—DE; polar—STNQ.

[0076] Generation of smooth muscle cells from human pluripotent stem cells Cardiovascular ischemic conditions such as myocardial infarction (MI) and peripheral arterial disease (PAD) result in circulatory dysfunction. These conditions often involve arteriosclerotic blockage of blood vessels, leading to poor blood circulation and ultimately to tissue necrosis. To improve this ischemic condition and improve quality of life, it is possible to introduce more functional blood vessels into the affected area.

[0077] Vascular smooth muscle cells (VSMCs) are important components of both the blood and lymphatic vasculature. High-pressure arteries are covered with multiple layers of VSMCs, whereas veins generally have a punctate VSMC lining. Lymphatic vessels are only lightly covered with VSMCs. VSMCs contribute to the maturation and stabilization of new vessels, resulting in functional blood vessels.

[0078] Induced pluripotent stem cells (iPSCs) derived from skin or blood cells have the ability to proliferate and differentiate into various somatic cells. Therefore, human iPSCs differentiated under chemically defined conditions (hiPSCs) are an excellent source of VSMCs for various clinical applications. However, chemically defined, clinically compatible differentiation conditions for VSMCs from human pluripotent stem cells (hPSCs), including human embryonic stem cells (hESCs) and hiPSCs, are still required. Furthermore, the selection and purification of VSMCs derived from hiPSCs and hESCs remains challenging due to the lack of specific surface markers for VSMCs.

[0079] Human iPSCs were differentiated into VSMCs after GSK3 inhibition and exposure to specific growth factors, TGF-β1 and PDGF-BB. hiPSC-derived VSMCs express VSMC-specific genes and proteins, including TAGLN, CNN1, ACTA2, CALD1, SMTN, and MYH11.

[0080] To be functional, VSMCs must exhibit a contractile phenotype. The phenotypic switch from contractile to synthetic VSMCs results in pathological changes in the vasculature. The formation of F-actin by polymerization of G-actin indicates mature contractile VSMCs. Myocardin-related transcription factor A (MRTFA), a cofactor of serum response factor (SRF), translocates between the cytoplasm and nucleus, and this translocation is dependent on binding to G-actin in the cytoplasm. Upon the formation of F-actin, MRTFA is released from G-actin and translocates to the nucleus, where it activates SRF.

[0081] Matrix metalloproteinases (MMPs) play an important role in tissue remodeling, especially in the vasculature. MMPs degrade the extracellular matrix (ECM). In addition to the ECM, MMPs also degrade peptide growth factor and tyrosine kinase receptors, cell adhesion molecules, cytokines, and chemokines. MMP2 and MMP9 liberate TGFβ from inactive extracellular complexes consisting of TGFβ, TGFβ latency-associated protein (the prodomain of TGFβ), and latent TGFβ binding protein. MMP2- and MMP9-mediated activation of TGFβ leads to angiogenesis.

[0082] Cadherin 2 (CDH2), the major cadherin in SMCs, has been identified and expressed in the rat vasculature. CDH2 upregulation occurs during SMC differentiation from human mesenchymal stem cells (hMSCs). CDH2 is important for endothelial sprout maturation and neovascularization through interaction with pericytes. Recruitment of β-catenin to transmembrane CDH2 is regulated by actin polymerization, a process critical for SMC contraction. Cleavage of the extracellular domain of CDH2 by MMP9 and MMP12 induces β-catenin signaling and cyclin D1 expression in VSMCs, increasing VSMC proliferation.

[0083] VSMCs were generated from hiPSCs under chemically defined conditions. hiPSCs were seeded on collagen-coated dishes without animal feeder cells. Mesoderm induction was performed using only the GSK inhibitor CHIR-99021 and bFGF, and differentiation of VSMCs from hiPSCs was performed using only three growth factors: TGF-β1, PDGF-BB, and EGF. Accutase 1 (Accutase 1) was used to efficiently generate VSMCs. (商標) After detachment and filtration with Accutase, the cells were reseeded on day 10. (商標) consists of a mixture of proteolytic and collagenolytic enzymes and Na4EDTA, and is used as a gentle exfoliant without cleaving the extracellular domains of transmembrane proteins on the cell surface.

[0084] Furthermore, we used two VSMC differentiation media containing different concentrations of TGF-β1 and PDGF-BB but the same EGF concentration. From day 25, we confirmed that contractile VSMCs were generated in VSMC-differentiation medium II, which contained increased TGF-β1 concentrations (from 2.5 ng / ml to 5.0 ng / ml) and decreased PDGF-BB concentrations (from 5.0 ng / ml to 2.5 ng / ml). Furthermore, CDH2 was found to be a selectable marker on the surface of hiPSC-VSMCs. By selecting differentiated hiPSC-VSMCs using CDH2 as a selectable surface marker, contractile VSMCs were efficiently differentiated and enriched from hiPSCs. These contractile hiPSC-VSMCs were generated under simple, chemically defined, animal-product-free conditions, demonstrating their therapeutic potential in vasculature remodeling and regeneration.

[0085] How to use In certain embodiments, the methods described herein comprise contacting pluripotent stem cells with a mesoderm-inducing growth medium, then replicating the cells in serum-free vascular smooth muscle cell growth medium in the presence of collagen, and purifying the replicated cells that express Cadherin 2. In certain embodiments, the purified cells are used to treat or prevent a cardiovascular disease or condition.

[0086] In certain embodiments, the present invention relates to a method for producing vascular smooth muscle-like cells of a contractile phenotype, comprising transforming pluripotent stem cells into cells that express smoothelin and smooth muscle myosin heavy chain, and purifying the cells that express cadherin-2 to provide a purified composition of vascular smooth muscle-like cells that express cadherin-2 of a contractile phenotype. In certain embodiments, the method further comprises replicating the vascular smooth muscle-like cells that express cadherin-2.

[0087] In a particular aspect, the present invention provides a serum-free method for producing vascular smooth muscle-like cells, comprising the steps of: a) contacting pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one or more days under conditions such that the pluripotent stem cells form induced mesoderm-like cells, wherein the mesoderm differentiation-inducing growth medium comprises 1) a rho-associated protein kinase inhibitor, 2) a glycogen synthase kinase-3 inhibitor, and 3) a basic fibroblast growth factor; b) contacting the induced mesoderm-like cells with a first vascular smooth muscle cell growth medium for one or more days under conditions such that the mesoderm-like cells form induced vascular smooth muscle-like cells, wherein the first vascular smooth muscle cell growth medium comprises 1) transforming growth factor-β, 2) epidermal growth factor, and 3) platelet-derived growth factor; c) contacting the induced vascular smooth muscle-like cells with a protease and / or collagenase under conditions such that the induced vascular smooth muscle-like cells are obtained; d) a) exposing the detached induced vascular smooth muscle-like cells to collagen and a first vascular smooth muscle cell growth medium for one or more days to provide replicated vascular smooth muscle-like cells; b) contacting the replicated vascular smooth muscle-like cells with a second vascular smooth muscle cell growth medium for one or more days under conditions such that the replicated vascular smooth muscle-like cells form a second batch of induced vascular smooth muscle-like cells, wherein the second vascular smooth muscle cell growth medium comprises 1) transforming growth factor-β, 2) epidermal growth factor, and 3) platelet-derived growth factor; and c) purifying the second batch of induced vascular smooth muscle-like cells by selecting for cells that express cadherin-2 to provide purified induced vascular smooth muscle-like cells that express cadherin-2. The present invention relates to a manufacturing method including:

[0088] In certain embodiments, the concentration of transforming growth factor-β in the second vascular smooth muscle cell growth medium is increased relative to the concentration of transforming growth factor-β in the first vascular smooth muscle cell growth medium.

[0089] In certain embodiments, the concentration of platelet-derived growth factor in the second vascular smooth muscle cell growth medium is reduced compared to the concentration of platelet-derived growth factor in the first vascular smooth muscle cell growth medium.

[0090] In certain embodiments, the rho-associated protein kinase inhibitor is trans-4-[(1R)-1-aminoethyl]-N-4-pyridinylcyclohexanecarboxamide (Y-27632) or a salt thereof.

[0091] In certain embodiments, the glycogen synthase kinase-3 inhibitor is 6-[[2-[[4-(2,4-dichlorophenyl)-5-(5-methyl-1H-imidazol-2-yl)-2-pyrimidinyl]amino]ethyl]amino]-3-pyridinecarbonitrile (CHIR-99021 or a salt thereof.

[0092] In certain embodiments, said pluripotent stem cells are embryonic stem (ES) cells or induced pluripotent stem (iPS) cells.

[0093] In certain embodiments, contacting the pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one or more days comprises contacting for four days.

[0094] In certain embodiments, contacting the pluripotent stem cells with the mesoderm differentiation-inducing growth medium for one or more days is for a period of five days or less.

[0095] In certain embodiments, contacting the induced mesoderm-like cells with the first vascular smooth muscle cell growth medium for one or more days comprises contacting for 20 days.

[0096] In certain embodiments, contacting the induced mesoderm-like cells with the first vascular smooth muscle cell growth medium for one or more days is for a period of 21 days or less.

[0097] In certain embodiments, replicating the detached induced vascular smooth muscle-like cells by exposure to collagen and the first vascular smooth muscle cell growth medium for one or more days comprises replicating for 15 days.

[0098] In certain embodiments, replicating the detached induced vascular smooth muscle-like cells by exposure to collagen and the first vascular smooth muscle cell growth medium for one or more days is for a period of 16 days or less.

[0099] In certain embodiments, contacting the replicated vascular smooth muscle-like cells with the second vascular smooth muscle cell growth medium for one or more days comprises contacting for 25 days or more.

[0100] In certain embodiments, contacting the replicated vascular smooth muscle-like cells with the second vascular smooth muscle cell growth medium for one or more days is for a period of 26 days or less.

[0101] In certain embodiments, the methods described herein further comprise contacting the purified cadherin-2 (CDH2)-expressing induced vascular smooth muscle-like cells with collagen and a second vascular smooth muscle cell growth medium for one or more days to replicate.

[0102] In certain embodiments, selecting cells expressing cadherin-2 (CDH2) comprises contacting the cells with an anti-cadherin-2 antibody, marking the surface of cells expressing cadherin-2 (CDH2) with the fluorescently conjugated antibody, and selecting the cells by fluorescence-activated cell sorting.

[0103] In certain aspects, the invention relates to compositions and growth media comprising cells produced by the methods described herein.

[0104] In certain embodiments, the present invention relates to methods for treating or preventing a cardiovascular disease or condition, comprising administering to a subject in need thereof an effective amount of cells produced by the methods described herein. In certain embodiments, the pluripotent stem cells are induced pluripotent stem cells derived from the subject.

[0105] In certain embodiments, the subject has been diagnosed with or is at risk for damaged and narrowed arteries, aneurysms, angina, arrhythmias, left ventricular hypertrophy, transient ischemic attacks, stroke, dementia, renal scarring, renal failure, myocardial infarction, vascular inflammation, plaque formation, atherosclerosis, restenosis, pulmonary hypertension, ocular hypertension, retinopathy, choroidopathy, optic neuropathy, glaucoma, and blindness.

[0106] In certain embodiments, the vascular smooth muscle-like cells contract in response to a vasoactive agent such as carbachol or KCl.

[0107] In certain embodiments, vascular smooth muscle-like cells are mixed with or administered in combination with endothelial cells or endothelial-like cells, resulting in improved blood flow restoration compared to administration of endothelial cells or endothelial-like cells alone.

[0108] In certain embodiments, vascular smooth muscle-like cells are mixed with or administered in combination with endothelial cells or endothelial-like cells that form capillary-like tubes.

[0109] In certain embodiments, the present invention relates to the use of CDH2 as a biomarker for isolating vascular smooth muscle cells generated from human induced pluripotent stem cells. In certain embodiments, the present invention contemplates mixing a sample of cells suspected of containing smooth muscle cells with a specific binding agent for CDH2 (e.g., a CDH2 antibody) under conditions such that the specific binding agent for CDH2 binds to CDH2, and measuring and / or detecting specific binding.

[0110] In certain embodiments, the present invention relates to artificial blood vessels for treating ischemic conditions. In certain embodiments, a tube of a mixture of endothelial cells and vascular smooth muscle-like cells described herein is produced in vitro and then implanted into a subject in need thereof. In certain embodiments, the present invention contemplates administering the vascular smooth muscle-like cells described herein, optionally in combination with endothelial cells, in vivo, thereby allowing the cells to circulate and be effective at the site of ischemic injury. In certain embodiments, the present invention contemplates administering the vascular smooth muscle-like cells described herein, optionally in combination with endothelial cells, locally to the site of ischemic injury, for example, by direct injection into a vein, artery, heart, or around or near the heart.

[0111] In a specific embodiment, the present invention relates to a method using hiPSC-VSMCs that are directly applied to ischemic areas. VSMCs are intended to localize in adjacent new blood vessels and stabilize angiogenesis. In addition to the role of VSMCs in stabilizing angiogenesis, incubation with indirect angiogenic cytokines such as PDGF-BB and TGF-β1 induces the expression of direct angiogenic factors such as VEGF and bFGF. Under hypoxic conditions, VSMCs express VEGF. The expression and secretion of MMPs are other beneficial factors in angiogenic remodeling.

[0112] In certain embodiments, the present invention relates to a method for generating blood vessels ex vivo and transplanting them into a subject. In certain embodiments, blood vessels are generated by culturing vascular smooth muscle-like cells described herein, optionally in combination with endothelial cells, in the form of tubes or sheets, or by transforming the sheets into cylinder-like structures. In certain embodiments, the present invention contemplates harvesting the sheets and applying them locally to ischemic vasculature.

[0113] In certain embodiments, it is contemplated that in vivo vasculature, e.g., a vein or artery, is extracted, the vasculature is contacted with the vascular smooth muscle-like cells described herein, optionally in combination with endothelial cells to provide exposed vasculature, and then the exposed vasculature is transplanted into a subject.

[0114] In certain embodiments, the present invention relates to a method for drug screening using the vascular smooth muscle-like cells described herein. In certain embodiments, the vascular smooth muscle-like cells described herein, optionally combined with endothelial cells, are contacted with a test drug. In certain embodiments, the vascular smooth muscle-like cells described herein are derived from induced pluripotent stem cells with a genetic profile that indicates a subject at risk of vascular defects and / or undesirable cardiovascular conditions. In addition, the test drug is observed to induce phenotypic changes, for example, compared with a control drug. For example, the vascular smooth muscle-like cells described herein can be used to determine whether the contractile force increases or decreases in the presence of a test drug.

[0115] Disease models exist in which genomic mutations affect VSMCs associated with patient diseases, including congenital heart disease associated with supravalvular aortic stenosis (SVAS), Williams-Behren syndrome (WBS), Hutchison-Gilford progeria (HGP), and Marfan syndrome. Thus, the vascular smooth muscle-like cells described herein can be produced from induced pluripotent stem cells derived from subjects with one or more of these diseases or conditions. Vascular smooth muscle-like cells generated by the methods described herein from subjects associated with one of these conditions can then be used in drug screening libraries to identify therapeutic agents. See Granata et al., "An iPSC-derived vascular model of Marfan syndrome identifies key mediators of smooth muscle cell death," Nat Genet., 49, 97-109 (2017). [Example]

[0116] hiPSC-VSMC manufacturing process Human induced pluripotent stem cells (hiPSCs) were cultured in 5% Matrigel (商標) (Corning, Cat. No. 354234) on mTeSR (商標)(STEMCELL Technologies, Cat. No. 85850) at 37°C and 5% CO 2 Three types of media were used for VSMC differentiation: mesoderm induction medium, VSMC differentiation medium I, and VSMC differentiation medium II. These media were cultured in 20% Knockout medium. (商標) The basal medium contains serum replacement (KO-SR, Invitrogen, Cat. No. 10828-028) with small molecules and growth factors. The basal medium DMEM / F12 (Invitrogen, Cat. No. 11330057) is supplemented with antibiotics (Gibco, Cat. No. 15240-112), MEM NEAA (Gibco, Cat. No. 11140076), and GlutaMax. (商標) (Gibco, Cat. No. 35050079) was added. After dispersion using Dispase (Gibco, Cat. No. 17105-041), hipSCs were seeded onto 0.01% collagen (STEMCELL Technologies, Cat. No. 4902) coated plates.

[0117] On day 0, the cells were treated with 20% knockout medium containing Y-27632 (STEMCELL Technologies, Cat. No. 72304), 3 μM CHIR-99021 (GSK inhibitor) (Selleckchem, Cat. No. S1263), and bFGF (4 ng / ml). (商標) Mesoderm induction was achieved by culturing hiPSCs in basal medium containing serum replacement. The ROCK inhibitor Y-27632 was used only on day 0. The mesoderm induction medium was replaced every day (see Figure 1).

[0118] On day 4, mesoderm induction medium was added to the cells supplemented with TGF-β1 (2.5 ng / ml, PeproTech, Cat. No. 100-21C), PDGF-BB (5 ng / ml, PeproTech, Cat. No. 100-14B), EGF (20 ng / ml, R&D System, Cat. No. 236-EG-200), and 20% Knockout. (商標) The medium was replaced with VSMC-differentiation medium I containing serum replacement.

[0119] On day 10, cells were detached with Accutase (eBioscience, Cat. No. 00-4555-56) and filtered through a cell strainer (70 μm nylon mesh, Fisher Scientific, Cat. No. 22363548) and re-cultured onto collagen-coated plates. VSMC-differentiation medium I was replaced daily.

[0120] From day 25, TGF-β1 (5ng / ml), PDGF-BB (2.5ng / ml), EGF (20ng / ml), 20% Knockout (商標) Cultured in VSMC-differentiation medium II containing serum replacement.

[0121] On day 50, cells were labeled with PE-labeled anti-CDH2 antibody (eBioscience, catalog number 12-3259-42) at 4°C, and CDH2-expressing cells were then sorted by FACS. After sorting, CDH2-positive cells were further cultured on collagen-coated plates in VSMC-differentiation medium II. VSMC-differentiation medium II was replaced daily. Once the cells reached confluence, they were passaged every 3–4 days.

[0122] Assessment of cellular changes Maintenance of the contractile phenotype of VMSCs using growth factors has been reported. Differentiation of VSMCs derived from human ESCs and iPSCs is not straightforward. VSMCs were generated from human PSCs, including ESCs and iPSCs. Human PSCs were maintained in a feeder-free environment. VSMCs were differentiated under chemically defined conditions without animal serum. Furthermore, contractile VSMCs were enriched by CDH2-positive selection.

[0123] Cheung et al. (Nature Protocols, 2014) reported that approximately 80% of VSMCs differentiated with PDGF-BB (10 ng / ml) and TGF-β1 (2 ng / ml) were double-positive for CNN1 and MYH11. However, despite ACTA2, CNN1, and TAGLN being early SMC markers, only a small number of cells were positive for CNN1 and TAGLN. Patsch et al. (Nature Cell Biology, 2015) reported that they differentiated VSMCs and counted cells positive for ACTA2 (48%), myosin IIB (96.99%), and TAGLN (100%). Myosin IIB (MYH10) is not a VSMC marker. Many cells were positive for CD140b. Fibroblasts also express CD140b.

[0124] ACTA2, CNN1, and TAGLN are early smooth muscle cell markers. The mRNA expression levels of VSMC-specific genes, such as TAGLN, CNN1, ACTA2, SMTN, CALD1, and MYH11, were significantly increased at day 22 (Figure 2). However, the mRNA expression levels of these VSMC-specific genes in hiPSC-VSMCs were comparable to or higher than those in human aortic smooth muscle cells (hAoSMCs), except for ACTA2 and SMTN (Figure 3).

[0125] Expression of pluripotency-related genes, such as OCT4, SOX2, NANOG, and KLF4, was significantly higher in the CDH2-negative fraction, whereas cMYC expression levels were comparable between CDH2-negative and -positive fractions (Figure 4). Immunofluorescence microscopy revealed the formation of F-actin and expression of MRTFA in hiPSC-VSMCs at day 49. Furthermore, the nuclear localization of MRTFA indicates enhanced expression of contractile genes. Expression of contractile VSMC proteins, such as ACTA2, CNN1, SMTN, and MYH11, was observed in CDH2-positive hiPSC-VSMCs at day 58. Flow cytometry analysis after intracellular staining with BD LSRII confirmed the expression of CNN1 (95.23 ± 2.15), SMTN (95.37 ± 1.96), and MYH11 (87.87 ± 0.94) in hiPSC-VSMCs at day 63 (Figure 5). The long isoform of SMTN (SMTN-B) is a late-expressing marker of vascular smooth muscle cells (VSMCs). It is difficult to detect in primary cells. SMTN expression dramatically decreased when primary cells were cultured. However, human PSC-derived VSMCs (hPSC-VSMCs) expressed SMTN. The expression level of the long isoform of SMTN (SMTN-B) was confirmed in differentiated hPSC-VSMCs.

[0126] The dramatic increase in Fluo4 fluorescence by carbachol indicates an increase in intracellular calcium flux in hiPSC-VSMCs (Figure 6A). Furthermore, a significant increase in contractile force was observed in hiPSC-VSMCs treated with carbachol and KCl. A significant difference was also observed between cells treated with carbachol and potassium chloride (Figure 6B).

[0127] Therapeutic utility of hiPSC-VSMCs in angiogenesis Growth factor-reduced VSMC differentiation medium I containing VEGFA (10 ng / ml) was used to culture stained cells in Matrigel. (商標)HUVECs were pre-stained with DiI (red), and hAoSMCs and hiPSC-VSMCs were pre-stained with DiO (green). Division points were quantified from five images per group. When hiPSC-VSMCs were co-cultured with HUVECs, tube formation with significant division points was observed. Furthermore, when hiPSC-VSMCs and hAoSMCs were co-cultured with HUVECs, no significant difference in division points was observed (Figure 7).

[0128] MMPs play an important role in vasculature remodeling. We measured the expression levels of MMP2 and MMP9, and found that hiPSC-VSMCs expressed MMP2 and MMP9 mRNA at levels comparable to those of hAoSMCs (Fig. 8). Further aspects of the present invention are described below: [Section 1] A method for producing vascular smooth muscle-like cells, comprising: a) contacting pluripotent stem cells with a mesoderm differentiation-inducing growth medium for one day or more under conditions such that the pluripotent stem cells form induced mesoderm-like cells, wherein the mesoderm differentiation-inducing growth medium comprises: 1) rho-associated protein kinase inhibitors, 2) glycogen synthase kinase-3 inhibitors, and 3) Basic fibroblast growth factor a process comprising: b) contacting the induced mesoderm-like cells with a first vascular smooth muscle cell growth medium for one or more days under conditions such that the mesoderm-like cells form induced vascular smooth muscle-like cells, wherein the first vascular smooth muscle cell growth medium comprises: 1) Transforming growth factor-β, 2) epidermal growth factor, and 3) Platelet-derived growth factor a process comprising: c) contacting the induced vascular smooth muscle-like cells with a protease or collagenase under conditions such that the induced vascular smooth muscle-like cells are detached from each other to obtain detached induced vascular smooth muscle-like cells; d) exposing the detached induced vascular smooth muscle-like cells to collagen and a first vascular smooth muscle cell growth medium for one or more days to replicate, thereby providing replicated vascular smooth muscle-like cells; e) contacting the replicated vascular smooth muscle-like cells with a second vascular smooth muscle cell growth medium for one or more days under conditions such that the replicated vascular smooth muscle-like cells form a second batch of derived vascular smooth muscle-like cells, wherein the second vascular smooth muscle cell growth medium comprises: 1) Transforming growth factor-β, 2) epidermal growth factor, and 3) Platelet-derived growth factor and f) purifying the second batch of induced vascular smooth muscle-like cells by selecting for cells that express cadherin-2 to provide purified induced vascular smooth muscle-like cells that express cadherin-2. A manufacturing method comprising: [Section 2] Item 10. The method of claim 1, wherein the concentration of transforming growth factor-β in the second vascular smooth muscle cell growth medium is increased compared to the concentration of transforming growth factor-β in the first vascular smooth muscle cell growth medium. [Section 3] Item 3. The method according to item 2, wherein the concentration of the platelet-derived growth factor in the second vascular smooth muscle cell growth medium is reduced compared to the concentration of the platelet-derived growth factor in the first vascular smooth muscle cell growth medium. [Section 4] Item 2. The method according to item 1, wherein the rho-associated protein kinase inhibitor is trans-4-[(1R)-1-aminoethyl]-N-4-pyridinylcyclohexanecarboxamide (Y-27632) or a salt thereof. [Section 5] Item 2. The method according to item 1, wherein the glycogen synthase kinase-3 inhibitor is 6-[[2-[[4-(2,4-dichlorophenyl)-5-(5-methyl-1H-imidazol-2-yl)-2-pyrimidinyl]amino]ethyl]amino]-3-pyridine-carbonitrile (CHIR-99021) or a salt thereof. [Section 6] The method according to item 1, wherein the pluripotent stem cells are embryonic stem (ES) cells or induced pluripotent stem (iPS) cells. [Section 7] Item 1. The method according to Item 1, wherein the period of time during which the pluripotent stem cells are contacted with the mesoderm-inducing growth medium for one day or more is four days. [Section 8] Item 1. The method according to Item 1, wherein the period of time during which the pluripotent stem cells are contacted with the mesoderm-inducing growth medium for one day or more is five days or less. [Section 9] Item 2. The method according to Item 1, wherein the period of time during which the induced mesoderm-like cells are contacted with the first vascular smooth muscle cell growth medium for one day or more is 20 days. [Section 10] Item 2. The method according to Item 1, wherein the period of time during which the induced mesoderm-like cells are contacted with the first vascular smooth muscle cell growth medium for one day or more is 21 days or less. [Section 11] Item 2. The method according to item 1, wherein the period for replicating the induced vascular smooth muscle-like cells detached by contacting them with collagen and the first vascular smooth muscle cell growth medium for one day or more is 15 days. [Section 12] Item 2. The method according to item 1, wherein the replication period of the detachment-induced vascular smooth muscle-like cells by exposure to collagen and the first vascular smooth muscle cell growth medium for one or more days is 16 days or less. [Section 13] Item 2. The method according to Item 1, wherein the period of contacting the replicated vascular smooth muscle-like cells with the second vascular smooth muscle cell growth medium for one day or more is 25 days or more. [Section 14] Item 2. The method according to Item 1, wherein the period of time during which the replicated vascular smooth muscle-like cells are contacted with the second vascular smooth muscle cell growth medium for one day or more is 26 days or less. [Section 15] Item 14. The method according to Item 1, further comprising a step of contacting the purified cadherin-2 expression-induced vascular smooth muscle-like cells with collagen and a second vascular smooth muscle cell growth medium for one day or more to replicate them. [Section 16] A method or method for producing vascular smooth muscle-like cells, comprising transforming pluripotent stem cells into cells that express vascular smoothelin and vascular smooth muscle myosin heavy chain, and purifying cadherin-2-expressing cells to provide vascular smooth muscle-like cells. [Section 17] A composition comprising cells produced by the method according to item 16. [Section 18] A method for treating or preventing a cardiovascular disease or condition, comprising administering an effective amount of cells produced by the method described in item 1 to a subject in need thereof. [Section 19] 20. The method of claim 18, wherein the pluripotent cells are induced pluripotent cells derived from a subject.

Claims

1. A method for producing vascular smooth muscle cells, comprising: a) contacting pluripotent stem cells with a mesoderm differentiation-inducing growth medium for at least one day and at most five days under conditions such that the pluripotent stem cells form induced mesoderm-like cells, wherein the mesoderm differentiation-inducing growth medium comprises: 1) rho-associated protein kinase inhibitors; 2) glycogen synthase kinase-3 inhibitors, and 3) Basic fibroblast growth factor wherein the rho-associated protein kinase inhibitor is trans-4-[(1R)-1-aminoethyl]-N-4-pyridinylcyclohexanecarboxamide (Y-27632) or a salt thereof, and the glycogen synthase kinase-3 inhibitor is 6-[[2-[[4-(2,4-dichlorophenyl)-5-(5-methyl-1H-imidazol-2-yl)-2-pyrimidinyl]amino]ethyl]amino]-3-pyridine-carbonitrile (CHIR-99021) or a salt thereof; b) contacting the induced mesoderm-like cells with a first vascular smooth muscle cell growth medium for at least 1 day and not more than 21 days under conditions such that the mesoderm-like cells form induced vascular smooth muscle cells, wherein the first vascular smooth muscle cell growth medium comprises: 1) transforming growth factor-β, 2) platelet-derived growth factor, and 3) Epidermal growth factor a process comprising: c) contacting the induced vascular smooth muscle cells with a protease or collagenase under conditions such that the induced vascular smooth muscle cells are detached from each other to obtain detached induced vascular smooth muscle cells; d) exposing the detached induced vascular smooth muscle cells to collagen and a first vascular smooth muscle cell growth medium for at least 1 day and not more than 16 days to replicate, thereby providing replicated vascular smooth muscle cells; e) contacting the replicated vascular smooth muscle cells with a second vascular smooth muscle cell growth medium for at least 1 day and not more than 26 days under conditions such that the replicated vascular smooth muscle cells form a second batch of derived vascular smooth muscle cells, wherein the second vascular smooth muscle cell growth medium comprises: 1) transforming growth factor-β, 2) epidermal growth factor, and 3) Platelet-derived growth factor and f) purifying the second batch of induced vascular smooth muscle cells by selecting for cells that express cadherin-2 to provide purified induced cadherin-2-expressing vascular smooth muscle cells. A manufacturing method comprising:

2. 2. The method of claim 1, wherein the concentration of transforming growth factor-β in the second vascular smooth muscle cell growth medium is increased compared to the concentration of transforming growth factor-β in the first vascular smooth muscle cell growth medium.

3. 3. The method of claim 2, wherein the concentration of platelet-derived growth factor in the second vascular smooth muscle cell growth medium is reduced compared to the concentration of platelet-derived growth factor in the first vascular smooth muscle cell growth medium.

4. The method of claim 1, wherein the pluripotent stem cells are embryonic stem (ES) cells or induced pluripotent stem (iPS) cells.

5. The method of claim 1, wherein the period of time during which the pluripotent stem cells are contacted with the mesoderm-inducing growth medium for one or more days is four days.

6. The method of claim 1, wherein the period of time during which the induced mesoderm-like cells are contacted with the first vascular smooth muscle cell growth medium for one or more days is 20 days.

7. The method of claim 1, wherein the period for replicating the detached induced vascular smooth muscle cells by contacting them with collagen and the first vascular smooth muscle cell growth medium for one or more days is 15 days.

8. The method of claim 1, wherein the period of time during which the replicated vascular smooth muscle cells are contacted with the second vascular smooth muscle cell growth medium for one day or more is 25 days or more.

9. The method of claim 1, further comprising the step of contacting the purified cadherin-2 expression-induced vascular smooth muscle cells with collagen and a second vascular smooth muscle cell growth medium for one or more days to replicate the cells.

Citation Information

Patent Citations

  • Novel methods for identifying, isolating or differentiating angiogenic progenitor cells in vitro

    JP2005522213A

  • Cell differentiation of adipose-derived progenitor cells

    JP2007507202A

  • Compounds and methods that modulate cadherin-mediated processes

    JP2008540340A

  • Methods for differentiating pluripotent stem cells into vascular bed cells

    JP2014516557A

  • Vascularized tissue, skin, or mucosal equivalent

    JP2018518970A