Methods and compositions for treating inflammatory conditions

Administering anti-inflammatory peptides from PAR3 and PAR1 receptors addresses the inadequacies of current inflammation treatments by reducing inflammation and treating disorders like asthma and autoimmune diseases.

JP7818405B2Active Publication Date: 2026-02-20THE SCRIPPS RES INST
View PDF 4 Cites 0 Cited by

Patent Information

Application Number
JP2021574932
Authority / Receiving Office
JP · JP
Patent Type
Patents
Current Assignee / Owner
Priority Date
2019-06-18
Filing Date
2020-06-17
Publication Date
2026-02-20
Estimated Expiration
2040-06-17

AI Technical Summary

Technical Problem

Current methods for treating inflammation are inadequate, leading to untreated or ineffectively managed inflammation, which can cause significant damage and pose life-threatening risks.

Method used

Administering pharmaceutical compositions containing anti-inflammatory peptides derived from protease-activated receptors (PAR3 and PAR1) to suppress unwanted inflammation and treat inflammatory conditions, including conjugated peptides and varying dosages.

Benefits of technology

Effectively suppresses inflammation and treats inflammatory disorders by reducing pro-inflammatory cytokines and caspase-1 activity, providing therapeutic benefits for conditions such as asthma and autoimmune diseases.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure 0007818405000001
    Figure 0007818405000001
  • Figure 0007818405000002
    Figure 0007818405000002
  • Figure 0007818405000003
    Figure 0007818405000003
Patent Text Reader

Abstract

The present invention provides novel compositions for suppressing inflammation and treating inflammatory disorders. The compositions of the present invention contain at least one PARS-derived anti-inflammatory peptide or polypeptide and / or at least one PAR1-derived anti-inflammatory peptide or polypeptide. PARS-derived peptides and / or PARI-derived peptides typically contain, for example, an anti-inflammatory peptide or polypeptide derived from activated protein C at residue Arg41 in human PARS and at residue Arg42 in human PARI. 46 The anti-inflammatory compositions of the present invention contain an amino acid sequence that mimics the N-terminal sequence of activated protein C-cleaved PARS or PARI, respectively, followed by the amino acid sequence:
Need to check novelty before this filing date? Find Prior Art

Description

[Technical Field]

[0001] CROSS-REFERENCE TO RELATED APPLICATIONS This patent application claims the benefit of priority to U.S. Provisional Patent Application No. 62 / 862,977, filed June 18, 2019. The entire disclosure of the priority application is incorporated herein by reference in its entirety and for all purposes.

[0002] Statement of government support This invention was made with government support under grant numbers HL052246, HL104165 and HL142975 awarded by the National Institutes of Health. The government has certain rights in this invention. [Background technology]

[0003] Inflammation is essentially a defensive response by the body to various injuries, infections, and stresses. Its ultimate goal is to eliminate injury-inducing agents (which may be microorganisms, physical stimuli, chemical agents, etc.), prevent tissue damage, and / or initiate repair processes. Inflammation can be local or systemic, and can be acute or chronic. Although the inflammatory response is essential for stress response, infection prevention, and wound healing, inflammation can also be harmful. Indeed, inflammation is an important component of the pathogenesis of many diseases and disorders. In addition, the presence of inflammation in many diseases, such as cancer, indicates a poor prognosis. Finally, in extreme cases, inflammation can lead to a life-threatening systemic response if not properly treated.

[0004] In addition to its traditional anticoagulant function, serine protease-activated protein C (APC) exerts various protective effects on multiple cell types and organs. APC can be anti-inflammatory through inhibition of the NLRP3 inflammasome. Inflammasomes play a central role in innate immune system-driven inflammation by promoting the maturation and release of the pro-inflammatory cytokines interleukin (IL)-1β and IL-18. Excessive inflammation contributes to many diseases, including cardiovascular disease, suggesting that limiting inflammasome generation in the context of the innate immune system may be beneficial in human disease. For example, in the Canakinumab Anti-Inflammatory Thrombosis Outcomes Study (CANTOS study), an anti-IL-1β monoclonal antibody reduced overall nonfatal myocardial infarction, stroke, and cardiovascular mortality. Summary of the Invention [Problem to be solved by the invention]

[0005] Current methods for treating inflammation are inadequate, and inflammation often remains untreated or is not effectively treated.As a result, significant damage may be caused to the subject with abnormal inflammation, and the subject's life may even be endangered.Therefore, there is an unmet need in this technical field for better or alternative means for combating inflammation and inflammatory disorders.The present invention addresses this and other unmet needs in this technical field. [Means for solving the problem]

[0006] In one aspect, the present invention provides various methods for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in the subject. These methods involve administering to the subject a pharmaceutical composition containing an anti-inflammatory peptide derived from protease-activated receptor-3 (PAR3). In various embodiments, the PAR3-derived anti-inflammatory peptide is selected from the group consisting of: (1) Met 1 ~Arg41 (1) an N-terminal fragment of the extracellular domain of human PAR3 (SEQ ID NO: 3) lacking at least the first four N-terminal residues of SEQ ID NO: 3, or a conservatively modified variant thereof; or (2) an N-terminal fragment of the extracellular domain of human PAR3 (SEQ ID NO: 4) lacking at least four consecutive amino acid residues of Phe of SEQ ID NO: 4, 10 ~Phe 12 or a conservatively modified variant thereof.

[0007] In some embodiments, the PAR3-derived anti-inflammatory peptide used also has APC-like cytoprotective activity. In some embodiments, the PAR3-derived peptide used contains at least the first 6, 7, 8, 9, 10, 11, 12, 13 or more N-terminal residues of SEQ ID NO: 3. In some embodiments, the PAR3-derived peptide used contains GAPPNSFEEFPFS (SEQ ID NO: 8) or GAPPNSFEEFPFSALEGWTGATIT (SEQ ID NO: 4). In some embodiments, the PAR3-derived peptide used contains Phe 10 ~Phe 12 In some of these embodiments, the PAR3-derived peptide contains at least 6 consecutive amino acid residues of SEQ ID NO: 4, including FPFSALEGW (SEQ ID NO: 10) or FPFSALEGWT GATIT (SEQ ID NO: 9). In some embodiments, the PAR3-derived peptide used is conjugated to a carrier moiety. For example, the carrier moiety can be a carrier protein, an immunoglobulin, an Fc domain, or a PEG molecule.

[0008] Some methods of the present invention further involve administering to the subject an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1). In various embodiments, the administered PAR1-derived peptide is: (1) Met 1 ~Arg 41or (2) a variant of human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least the first four N-terminal residues of the human PAR1 extracellular domain (SEQ ID NO: 6) deleted, or a conservatively modified variant thereof, having at least one residue deleted or substituted at the N-terminus. In some of these embodiments, the administered PAR1-derived peptide contains the first four, five, six, seven, eight, nine, ten, or more N-terminal residues of human PAR1-derived peptide TR47 (SEQ ID NO: 7). In some embodiments, the administered PAR1-derived peptide contains a TR47 variant with a substituted N-terminal residue. In some of these embodiments, the TR47 variant used contains SEQ ID NO: 49 (TR47ΔQ) or SEQ ID NO: 50 (TR47ΔA). In some embodiments, the administered PAR1-derived peptide contains a TR47 variant with one or more deletions of the N-terminal residues. In some of these embodiments, the TR47 variant used contains SEQ ID NO: 47 (TR47(N-1)) or SEQ ID NO: 48 (TR47(N-5)).

[0009] In some methods involving administration of both a PAR3-derived peptide and a PAR1-derived peptide, the two peptides are administered to the subject sequentially, in any order. In some other methods, the two peptides are administered to the subject simultaneously. In some of these embodiments, a pharmaceutical composition containing both a PAR3-derived peptide and a PAR1-derived peptide is administered to the subject in need of treatment. In some of these embodiments, the PAR3-derived peptide is conjugated to the PAR1-derived peptide. For example, the PAR3-derived peptide can be covalently linked to the PAR1-derived peptide (e.g., SEQ ID NO: 61). In some of these embodiments, a linker moiety can be used to covalently link the PAR3-derived peptide (e.g., SEQ ID NO: 9) to the PAR1-derived peptide (e.g., SEQ ID NO: 36), as exemplified herein. In some embodiments, the PAR3-derived peptide and / or the PAR1-derived peptide is conjugated to a carrier moiety. In some of these embodiments, the ratio of the PAR3-derived peptide to the PAR1-derived peptide is at least about 2:1, 4:1, 6:1, 8:1, or 10:1.

[0010] In some methods involving administration of both a PAR3-derived peptide and a PAR1-derived peptide, the PAR3-derived peptide and the PAR1-derived peptide are each administered to the subject in a daily amount of at most about 0.25 mg / kg of the subject's body weight, 0.1 mg / kg of the subject's body weight, 0.05 mg / kg of the subject's body weight, 0.025 mg / kg of the subject's body weight, 0.01 mg / kg of the subject's body weight, 0.005 mg / kg of the subject's body weight, 0.0025 mg / kg of the subject's body weight, 0.001 mg / kg of the subject's body weight, 0.0005 mg / kg of the subject's body weight, 0.00025 mg / kg of the subject's body weight or less. In some other methods, the subject receives at most about 0.25 mg / kg body weight of the subject, 0.1 mg / kg body weight of the subject, 0.05 mg / kg body weight of the subject, 0.025 mg / kg body weight of the subject, 0.01 mg / kg body weight of the subject, 0.005 mg / kg body weight of the subject, 0.0025 mg / kg body weight of the subject, 0.001 mg / kg body weight of the subject, 0.0005 mg / kg body weight of the subject, 0.00025 mg / kg body weight of the subject, or more. and the other peptide is administered at a daily dose of at least about 0.01 mg / kg, 0.025 mg / kg, 0.05 mg / kg, 0.1 mg / kg, 0.25 mg / kg, 0.5 mg / kg, 1 mg / kg, 2.5 mg / kg, 5 mg / kg, 10 mg / kg, 25 mg / kg or more.

[0011] In various embodiments, the methods of the present invention relate to treating inflammatory disorders. The inflammatory disorder to be treated may be any one selected from the group consisting of asthma, autoimmune disease, chronic inflammation, chronic prostatitis, glomerulonephritis, hypersensitivity, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sterile inflammation, transplant rejection, viral-associated inflammation, and vasculitis. In some embodiments, the methods of the present invention relate to treating a condition involving unwanted immune activation or an unwanted immune response. For example, the condition to be treated involving unwanted immune activation or an unwanted immune response may be a neuropathological condition, a viral infection, or malaria. In some methods, the subject to be treated by the methods of the present invention is suffering from, or is suspected of having, acute neuroinflammation, chronic neuroinflammation, or malarial inflammation.

[0012] In another aspect, the present invention provides compositions containing a PAR3-derived anti-inflammatory peptide and a PAR1-derived anti-inflammatory peptide. In some of these embodiments, the PAR3-derived anti-inflammatory peptide comprises: (1) Met 1 ~Arg 41 (1) an N-terminal fragment of the human PAR3 extracellular domain (SEQ ID NO: 3) lacking at least the first four N-terminal residues of SEQ ID NO: 3, or a conservatively modified variant thereof; or (2) an N-terminal fragment of the PAR3-derived peptide P3R (SEQ ID NO: 4) lacking at least four consecutive amino acid residues of Phe of SEQ ID NO: 4, 10 ~Phe 12 or a conservatively modified variant thereof, and the PAR1-derived anti-inflammatory peptide comprises at least four consecutive amino acid residues comprising: (1) Met 1 ~Arg 46or (2) a variant of the human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least one residue deleted or substituted at the N-terminus.

[0013] In some embodiments, the PAR3-derived peptide used contains at least the first 13 N-terminal residues of SEQ ID NO:3, or a conservatively modified variant thereof, and the PAR1-derived peptide contains at least the first 8 N-terminal residues of SEQ ID NO:6, or a conservatively modified variant thereof. In various embodiments, the PAR3-derived peptide used contains SEQ ID NO:4, SEQ ID NO:8, SEQ ID NO:9, SEQ ID NO:10, or a conservatively modified variant thereof, and the PAR1-derived peptide contains SEQ ID NO:7, SEQ ID NO:35, SEQ ID NO:36, SEQ ID NO:43, SEQ ID NO:47, SEQ ID NO:49, SEQ ID NO:50, or a conservatively modified variant thereof. In some compositions of the present invention, the amount of PAR3-derived peptide and the amount of PAR1-derived peptide are in a ratio of at least about 2:1, 4:1, 6:1, 8:1, or 10:1. In some compositions, the PAR3-derived peptide is conjugated to the PAR1-derived peptide. In some compositions, the PAR3-derived peptide is conjugated to the PAR1-derived peptide via a linker moiety or a carrier moiety. For example, a PAR1-derived peptide (e.g., SEQ ID NO: 36) can be covalently linked to a PAR3-derived peptide (e.g., SEQ ID NO: 9) via a glycine linker, as exemplified herein in SEQ ID NO: 61. Some compositions of the invention are formulated for administration to a subject by oral, intravenous, subcutaneous, intramuscular, intranasal, intraocular, topical, or intraperitoneal administration.

[0014] Some compositions of the invention contain a daily dosage of each of the two peptides of at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight or less per average body weight of the subject group for which the composition is intended. Some other compositions of the invention comprise (1) at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight, or less of one of the above two peptides per average body weight of a group of subjects for whom the composition is intended. and (2) a daily dosage of at least about 0.01 mg / kg average body weight, 0.025 mg / kg average body weight, 0.05 mg / kg average body weight, 0.1 mg / kg average body weight, 0.25 mg / kg average body weight, 0.5 mg / kg average body weight, 1 mg / kg average body weight, 2.5 mg / kg average body weight, 5 mg / kg average body weight, 10 mg / kg average body weight, 25 mg / kg average body weight or more of the other of the two peptides per average body weight of the group of subjects for which the composition is intended.

[0015] In another aspect, the present invention provides various methods for suppressing inflammation and treating inflammatory conditions in a subject. These methods involve administering to the subject a pharmaceutical composition containing a therapeutically effective amount of an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1). In some of these methods, the administered PAR1-derived anti-inflammatory peptide is selected from the group consisting of: (1) Met 1 ~Arg 41or (2) a variant of human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least the first four N-terminal residues of the human PAR1 extracellular domain (SEQ ID NO: 6) deleted, or a conservatively modified variant thereof, having at least one residue deleted or substituted at the N-terminus. In some embodiments, the PAR1-derived peptide used comprises the first four, five, six, seven, eight, nine, ten, or more N-terminal residues of human PAR1-derived peptide TR47 (SEQ ID NO: 7). In some methods, the PAR1-derived peptide used contains a TR47 variant containing a substituted N-terminal residue. In some of these methods, the TR47 variant used contains SEQ ID NO: 49 (TR47ΔQ) or SEQ ID NO: 50 (TR47ΔA). In some methods, the PAR1-derived peptide used contains a TR47 variant containing one or more deletions of the N-terminal residues. In some of these methods, the TR47 variant used contains SEQ ID NO: 47 (TR47(N-1)) or SEQ ID NO: 48 (TR47(N-5)).

[0016] In yet another aspect, the present invention provides various methods for identifying anti-inflammatory drugs. These methods require (1) culturing a group of human THP-1 cells, (2) contacting the cultured cells with an inflammation-inducing drug, (3) contacting the cultured cells with a candidate drug and a PAR3-derived anti-inflammatory peptide or a PAR1-derived anti-inflammatory peptide, respectively, and (4) measuring inflammation-related activity in the cells contacted with the candidate drug and the cells contacted with the PAR3-derived anti-inflammatory peptide or the PAR1-derived anti-inflammatory peptide, respectively. If the inflammatory activity measured in the cells contacted with the candidate drug is the same as or less than the inflammatory activity measured in the cells contacted with the PAR3-derived anti-inflammatory peptide or the PAR1-derived anti-inflammatory peptide, the candidate drug is identified as an anti-inflammatory drug. In some methods, the PAR3-derived anti-inflammatory peptide or the PAR1-derived anti-inflammatory peptide used is P3R (SEQ ID NO: 4) or TR47 (SEQ ID NO: 7) or a conservatively modified variant thereof. In various methods, the candidate drug used is a peptide that binds to the Met domain of human PAR3. 1 ~Arg 41 The deleted extracellular domain (SEQ ID NO: 3) or Met of human PAR1 1 ~Arg 46 The present invention relates to a peptide or polypeptide that mimics the N-terminal sequence of the deleted extracellular domain (SEQ ID NO: 6), or a variant, derivative, or mimetic compound of such a peptide or polypeptide. In some methods, the inflammation-related activity to be measured is the enzyme activity of caspase 1. In some other methods, the inflammation-related activity to be measured is IL-1β release. In some methods, the inflammation-inducing agent used is lipopolysaccharide (LPS).

[0017] A further understanding of the nature and advantages of the present invention may be realized by reference to the remaining portions of the specification and claims. In one aspect, the present invention provides: [Item 1] A method for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in the subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of an anti-inflammatory peptide derived from protease-activated receptor-3 (PAR3), wherein the PAR3-derived anti-inflammatory peptide is (1) an N-terminal fragment of the human PAR3 extracellular domain (SEQ ID NO: 3) lacking Met1 to Arg41, the N-terminal fragment consisting of at least the first four N-terminal residues of SEQ ID NO: 3, or a conservatively modified variant thereof, or (2) at least four consecutive amino acid residues of the human PAR3-derived peptide P3R (SEQ ID NO: 4), the at least four consecutive amino acid residues including Phe10 to Phe12 of SEQ ID NO: 4, or a conservatively modified variant thereof. [Item 2] 2. The method of claim 1, wherein the PAR3-derived anti-inflammatory peptide has APC-like cytoprotective activity. [Item 3] 2. The method of claim 1, wherein the PAR3-derived peptide comprises at least the first 6, 7, 8, 9, 10, 11, 12, 13 or more N-terminal residues of SEQ ID NO:3. [Item 4] Item 1. The method of item 1, wherein the PAR3-derived peptide comprises GAPPNSFEEFPFS (SEQ ID NO: 8) or GAPPNSFEEFPFSALEGWTGATIT (SEQ ID NO: 4). [Item 5] Item 2. The method according to item 1, wherein the PAR3-derived peptide comprises at least 6 consecutive amino acid residues of SEQ ID NO: 4, including Phe10 to Phe12. [Item 6] The method of item 5, wherein the PAR3-derived peptide comprises FPFSALEGW (SEQ ID NO: 10) or FPFSALEGWT GATIT (SEQ ID NO: 9). [Item 7] 2. The method of claim 1, wherein the PAR3-derived peptide is conjugated to a carrier moiety. [Item 8] 8. The method of claim 7, wherein the carrier moiety is a carrier protein, an immunoglobulin, an Fc domain, or a PEG molecule. [Item 9] 2. The method of claim 1, further comprising administering to the subject a therapeutically effective amount of an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1). [Item 10] Item 10. The method of item 9, wherein the PAR1-derived anti-inflammatory peptide comprises (1) at least the first four N-terminal residues of the human PAR1 extracellular domain (SEQ ID NO: 6) lacking Met1 to Arg41, or a conservatively modified variant thereof, or (2) a variant of human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least one residue deleted or substituted at the N-terminus. [Item 11] 10. The method of claim 9, wherein the PAR1-derived peptide comprises the first 4, 5, 6, 7, 8, 9, 10 or more N-terminal residues of human PAR1-derived peptide TR47 (SEQ ID NO: 7). [Item 12] 10. The method of claim 9, wherein the PAR1-derived peptide comprises a TR47 variant containing a substituted N-terminal residue. [Item 13] 13. The method of claim 12, wherein the TR47 variant comprises SEQ ID NO: 49 (TR47ΔQ) or SEQ ID NO: 50 (TR47ΔA). [Item 14] 10. The method of claim 9, wherein the PAR1-derived peptide comprises a TR47 variant containing one or more deletions of N-terminal residues. [Item 15] 15. The method of item 14, wherein the TR47 variant comprises SEQ ID NO: 47 (TR47(N-1)) or SEQ ID NO: 48 (TR47(N-5)). [Item 16] 10. The method of item 9, wherein the PAR3-derived peptide and the PAR1-derived peptide are administered to the subject simultaneously. [Item 17] 17. The method of claim 16, wherein the administered pharmaceutical composition comprises both the PAR3-derived peptide and the PAR1-derived peptide. [Item 18] 17. The method of claim 16, wherein the PAR3-derived peptide is conjugated to the PAR1-derived peptide. [Item 19] 10. The method of claim 9, wherein the PAR3-derived peptide and / or the PAR1-derived peptide is conjugated to a carrier moiety. [Item 20] 20. The method of claim 19, wherein the ratio of the PAR3-derived peptide to the PAR1-derived peptide is at least about 2:1, 4:1, 6:1, 8:1, or 10:1. [Item 21] 10. The method of item 9, wherein each of the PAR3-derived peptide and the PAR1-derived peptide is administered to the subject at a daily dose of at most about 0.25 mg / kg body weight, 0.1 mg / kg body weight, 0.05 mg / kg body weight, 0.025 mg / kg body weight, 0.01 mg / kg body weight, 0.005 mg / kg body weight, 0.0025 mg / kg body weight, 0.001 mg / kg body weight, 0.0005 mg / kg body weight, 0.00025 mg / kg body weight or less. [Item 22] the subject is administered one peptide at a daily dose of at most about 0.25 mg / kg, 0.1 mg / kg, 0.05 mg / kg, 0.025 mg / kg, 0.01 mg / kg, 0.005 mg / kg, 0.0025 mg / kg, 0.001 mg / kg, 0.0005 mg / kg, 0.00025 mg / kg, or less of the subject's body weight; and the other peptide is administered at a daily dose of at least about 0.01 mg / kg, 0.025 mg / kg, 0.05 mg / kg, 0.1 mg / kg, 0.25 mg / kg, 0.5 mg / kg, 1 mg / kg, 2.5 mg / kg, 5 mg / kg, 10 mg / kg, 25 mg / kg or more of the subject's body weight. [Item 23] 2. The method of claim 1, wherein the subject is suffering from or suspected of having an inflammatory disorder selected from the group consisting of asthma, autoimmune disease, chronic inflammation, chronic prostatitis, glomerulonephritis, hypersensitivity, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sterile inflammation, transplant rejection, viral-associated inflammation, and vasculitis. [Item 24] 2. The method of claim 1, wherein the subject is suffering from or suspected of having a condition involving unwanted immune activation or an unwanted immune response. [Item 25] 25. The method of claim 24, wherein the condition involving unwanted immune activation or an unwanted immune response is a neuropathological condition, a viral infection or malaria. [Item 26] 2. The method of claim 1, wherein the subject is suffering from or suspected of having acute neuroinflammation, chronic neuroinflammation, or malarial inflammation. [Item 27] A composition comprising a PAR3-derived anti-inflammatory peptide and a PAR1-derived anti-inflammatory peptide. [Item 28] 28. The composition of claim 27, wherein the PAR3-derived anti-inflammatory peptide comprises: (1) an N-terminal fragment of the human PAR3 extracellular domain (SEQ ID NO: 3) lacking Met1 to Arg41, the N-terminal fragment consisting of at least the first four N-terminal residues of SEQ ID NO: 3, or a conservatively modified variant thereof; or (2) at least four consecutive amino acid residues of the PAR3-derived peptide P3R (SEQ ID NO: 4), the at least four consecutive amino acid residues including Phe10 to Phe12 of SEQ ID NO: 4, or a conservatively modified variant thereof; and (b) the PAR1-derived anti-inflammatory peptide comprises: (1) an N-terminal fragment of the human PAR1 extracellular domain (SEQ ID NO: 6) lacking Met1 to Arg46, the N-terminal fragment consisting of at least the first four N-terminal residues of SEQ ID NO: 6, or a conservatively modified variant thereof; or (2) a variant of the human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least one residue deleted or substituted at the N-terminus. [Item 29] 28. The composition of claim 27, wherein the PAR3-derived peptide comprises at least the first 13 N-terminal residues of SEQ ID NO: 3, or a conservatively modified variant thereof, and the PAR1-derived peptide comprises at least the first 8 N-terminal residues of SEQ ID NO: 6, or a conservatively modified variant thereof. [Item 30] 28. The composition of claim 27, wherein the PAR3-derived peptide comprises SEQ ID NO: 4, SEQ ID NO: 8, SEQ ID NO: 9, SEQ ID NO: 10, or a conservatively modified variant thereof, and the PAR1-derived peptide comprises SEQ ID NO: 7, SEQ ID NO: 35, SEQ ID NO: 36, SEQ ID NO: 43, SEQ ID NO: 47, SEQ ID NO: 49, SEQ ID NO: 50, or a conservatively modified variant thereof. [Item 31] 28. The composition of claim 27, wherein the amount of the PAR3-derived peptide and the amount of the PAR1-derived peptide are in a ratio of at least about 2:1, 4:1, 6:1, 8:1, or 10:1. [Item 32] 28. The composition of claim 27, wherein the PAR3-derived peptide is conjugated to the PAR1-derived peptide. [Item 33] 33. The composition of claim 32, wherein the PAR3-derived peptide is conjugated to the PAR1-derived peptide via a linker moiety or a carrier moiety. [Item 34] 28. The composition of claim 27, comprising (a) a PAR1-derived peptide comprising the sequence set forth in SEQ ID NO: 36 or a conservatively modified variant thereof, and (b) a PAR3-derived peptide comprising the sequence set forth in SEQ ID NO: 9 or a conservatively modified variant thereof, wherein (a) and (b) are linked via a peptide moiety. [Item 35] 35. The composition of item 34, comprising the sequence set forth in SEQ ID NO: 61 or a conservatively modified variant thereof. [Item 36] 28. The composition of item 27, formulated for administration to a subject by oral, intravenous, subcutaneous, intramuscular, intranasal, intraocular, topical or intraperitoneal administration. [Item 37] 28. The composition according to item 27, comprising a daily dosage of each of the two peptides of at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight or less per average body weight of a group of subjects for which the composition is intended. [Item 38] 28. The composition according to item 27, wherein (1) one of the two peptides is at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight, or less, per average body weight of a group of subjects for whom the composition is intended. and (2) a daily dosage of at least about 0.01 mg / kg average body weight, 0.025 mg / kg average body weight, 0.05 mg / kg average body weight, 0.1 mg / kg average body weight, 0.25 mg / kg average body weight, 0.5 mg / kg average body weight, 1 mg / kg average body weight, 2.5 mg / kg average body weight, 5 mg / kg average body weight, 10 mg / kg average body weight, 25 mg / kg average body weight or more of the other of said two peptides per average body weight of a group of subjects for which the composition is intended. [Item 39] A method for suppressing inflammation in a subject and treating an inflammatory condition in the subject, comprising administering to the subject a pharmaceutical composition comprising a therapeutically effective amount of an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1), wherein the PAR1-derived anti-inflammatory peptide comprises (1) at least the first four N-terminal residues of the human PAR1 extracellular domain (SEQ ID NO: 6) lacking Met1 to Arg41, or a conservatively modified variant thereof, or (2) a variant of human PAR1-derived peptide TR47 (SEQ ID NO: 7) having at least one residue deleted or substituted at the N-terminus. [Item 40] 40. The method of claim 39, wherein the PAR1-derived peptide comprises the first 4, 5, 6, 7, 8, 9, 10 or more N-terminal residues of human PAR1-derived peptide TR47 (SEQ ID NO: 7). [Item 41] 40. The method of claim 39, wherein the PAR1-derived peptide comprises a TR47 variant containing a substituted N-terminal residue. [Item 42] 42. The method of claim 41, wherein the TR47 variant comprises SEQ ID NO: 49 (TR47ΔQ) or SEQ ID NO: 50 (TR47ΔA). [Item 43] 40. The method of claim 39, wherein the PAR1-derived peptide comprises a TR47 variant containing one or more deletions of N-terminal residues. [Item 44] 44. The method of item 43, wherein the TR47 variant comprises SEQ ID NO: 47 (TR47(N-1)) or SEQ ID NO: 48 (TR47(N-5)). [Item 45] A method for identifying an anti-inflammatory drug, comprising: (1) culturing a population of human THP-1 cells; (2) contacting the cultured cells with an inflammation-inducing drug; (3) contacting the cultured cells with a candidate drug and a PAR3-derived anti-inflammatory peptide or a PAR1-derived anti-inflammatory peptide, respectively; and (4) measuring inflammation-related activity in the cells contacted with the candidate drug and the cells contacted with the PAR3-derived anti-inflammatory peptide or the PAR1-derived anti-inflammatory peptide, respectively; wherein the candidate drug is identified as an anti-inflammatory drug when the value of the inflammatory activity measured in the cells contacted with the candidate drug is the same as or less than the value of the inflammatory activity measured in the cells contacted with the PAR3-derived anti-inflammatory peptide or the PAR1-derived anti-inflammatory peptide. [Item 46] 46. ​​The method of claim 45, wherein the PAR3-derived anti-inflammatory peptide or PAR1-derived anti-inflammatory peptide is P3R (SEQ ID NO: 4) or TR47 (SEQ ID NO: 7) or a conservatively modified variant thereof. [Item 47] 46. ​​The method of claim 45, wherein the candidate drug is a peptide or polypeptide that mimics the N-terminal sequence of the Met1-Arg41 deleted extracellular domain of human PAR3 (SEQ ID NO: 3) or the Met1-Arg46 deleted extracellular domain of human PAR1 (SEQ ID NO: 6), or a variant, derivative, or mimetic compound of the peptide or polypeptide. [Item 48] 46. ​​The method of item 45, wherein the inflammation-related activity is the enzymatic activity of caspase 1. [Item 49] 46. ​​The method of claim 45, wherein the inflammation-related activity is IL-1β release. [Item 50] 46. ​​The method of claim 45, wherein the pro-inflammatory agent is lipopolysaccharide (LPS). [Brief explanation of the drawings]

[0018] [Figure 1]Anti-inflammatory activity of the PAR1-derived peptide TR47 and the PAR3-derived peptide P3R is shown. THP1 null (THP1) cells were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 µM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Various subsets of wells were selected, and cells were treated in serum-free RPMI at 37°C for 60 min with: (A) APC (4 μg / mL), TR47 (50 μM to 2 nM), scrTR47 (50 μM), SFLLRN (50 μM), or TFLLRN (50 μM); (B) P3R (50 μM to 500 nM), or P3K (50 μM); (C) APC (4 μg / mL or 1 μg / mL), TR47 (8 nM), P3R (500 nM), or TR47 plus P3R (8 nM and 500 nM, respectively); (D) TR47 (0 to 128 nM) (●) ± P3R (500 nM) (□); (E) P3R (0 to 500 nM) (●) ± TR47 (1 nM) (□). After washing with DPBS, cells were incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. After washing with DPBS, cells were incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase-1 inhibitor) or 2.5 μM ZVAD (pan-caspase inhibitor) for 45 minutes at 37°C. Caspase-1 activity assays were then performed according to the manufacturer's instructions, measuring luminescence (relative light units, RLU). (D&E) Experimental caspase-1 activity was normalized to the luminescence units induced by YVAD (caspase-1 inhibitor). (A-E) Data points represent the mean ± SD of at least three independent experiments. *P<0.05 (vs. LPS+ATP); #P<0.05 (vs. LPS+ATP&APC, TR47 or P3R); **P<0.005 (vs. LPS+ATP&TR47+500nM P3R); ns not significant. [Figure 2]These results show that APC and PAR1- and PAR3-derived peptides reduce caspase-1 activity of the NLRP3-driven inflammasome, in part through EPCR, PAR1, and PAR3. THP1 cells or (A) NLRP3-deficient cells (THP1-defNLRP3) were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Briefly, selected wells were treated with APC (4 μg / mL), TR47 (50 μM), or P3R (50 μM) for 1 hour, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. After washing with DPBS, cells were incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase 1 inhibitor) or 2.5 μM ZVAD (pan-caspase inhibitor) for 45 min at 37°C. In (B), after PMA differentiation, selected wells were treated with APC (4 μg / mL), TR47 (50 μM), or P3R (50 μM) for 1 h, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI for 3 h at 37°C. Cells were washed with DPBS and then treated with the NLRP3 inhibitor MCC950 (10 μM) or DMSO for 30 min. Cells were washed again with DPBS and incubated with ATP (5 mM) for 45 min in the presence or absence of 10 μM YVAD (caspase-1 inhibitor) or 2.5 μM ZVAD (pan-caspase inhibitor). Caspase-1 activity assays were then performed according to the manufacturer's instructions, measuring luminescence. In (C-F), cells were incubated with antibodies or inhibitors prior to treatment with APC, TR47, or P3R. In (C), cells were incubated with the blocking EPCR antibody RCR-252 (50 μg / mL) for 30 min. In (D), cells were incubated with the mouse monoclonal antibody clone 19b against PAR3 (clone 19b; 25 μg / mL) for 30 min.In (E), cells were treated with either WEDE15 (20 μg / mL) or ATAP2 (10 μg / mL), a mouse monoclonal antibody against PAR1, for 15 minutes. In (F), cells were treated with the small molecule PAR1 inhibitor SCH79797 (SCH; 20 μM) for 20 minutes. After antibody or small molecule treatment (C–F), selected wells were treated with APC (4 μg / mL), TR47 (50 μM), or P3R (50 μM) for 1 hour, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI for 3 hours at 37°C. After washing with DPBS, cells were incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase-1 inhibitor) or 2.5 μM ZVAD (pan-caspase inhibitor) for 45 min at 37 °C. Caspase-1 activity assays were then performed according to the manufacturer's instructions, measuring luminescence (relative light units, RLU). (A–F) Data points represent the mean ± SD of at least three independent experiments. *P < 0.05 (vs. LPS + ATP); #P < 0.05 (vs. LPS + ATP & APC, TR47, or P3R); ##P < 0.005 (vs. LPS + ATP & APC, TR47, or P3R); ns not significant. [Figure 3]We show that APC and PAR1- and PAR3-derived peptides reduce IL-1β release. THP1 cells were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Selected wells were treated with APC (4 μg / mL), TR47 (50 μM), P3R (50 μM), or TR47 / P3R (8 nM and 500 nM, respectively) for 1 hour, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. Cells were washed with DPBS and incubated with ATP (5 mM) for 45 minutes in the presence or absence of 10 μM YVAD (a caspase-1 inhibitor). The resulting cell supernatants were used in an IL-1β Quantikine ELISA according to the manufacturer's (R&D) instructions to measure absorbance, and the concentration of IL-1β was calculated according to the standard curve. Data points represent the mean ± SEM of at least three independent experiments. *P<0.05 (vs. LPS + ATP). [Figure 4]Anti-inflammatory activity of various fragments of the PAR3-derived peptide P3R is shown. THP1 cells were plated in 96-well plates at a final concentration of 1 × 10 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Selected wells were treated with APC (4 μg / mL), (A) 50 μM, or (B) 2 μM of P3R, P3Rm, P3R 51-65, P3R 51-59, P3R 54-59, or P3R 59-65 for 1 hour, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. Cells were washed with DPBS and incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase 1 inhibitor; C1i) or 2.5 μM ZVAD (pan-caspase inhibitor; pCi) for 45 minutes at 37°C. Caspase 1 activity assays were then performed according to the manufacturer's instructions, measuring luminescence (relative light units, RLU). (C) Schematic diagram showing the sequences of PAR3, peptides, and their relative (anti-inflammatory) activity. These include the sequence of P3R (SEQ ID NO: 4), the sequence of P3Rm (SEQ ID NO: 8), the sequence of P3R 51-65 (SEQ ID NO: 9), the sequence of P3R 51-59 (SEQ ID NO: 10), the sequence of P3R 54-59 (SEQ ID NO: 54), and the sequence of P3R 59-65 (SEQ ID NO: 55). [Figure 5]Anti-inflammatory activity of various variants of the PAR1-derived peptide TR47 is shown. THP1 cells were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 µM) in supplemented RPMI at 37 °C for 3 hours. The medium was then changed every 24 hours for 3 days. Selected wells were treated with APC (4 μg / mL), TR47, or the 9-mer (TR47 9-mer; NPNDKYEPF (SEQ ID NO: 36)) or Ac-TR47 (acylated TR47) at either 50 μM or 10 nM in (A), or 50 μM of 16-mer-TR47, 8-mer-TR47, 6-mer-TR47, TR47 N-1, TR47 N-2, TR47 N-5, TR47ΔQ, TR47ΔD, TR47ΔA, or TR48-54 in (B) for 1 hour, washed with DPBS, and incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. Cells were washed with DPBS and incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase-1 inhibitor; C1i) or 2.5 μM ZVAD (pan-caspase inhibitor; pCi) for 45 min at 37°C. Caspase-1 activity assays were then performed according to the manufacturer's instructions to measure luminescence (relative light units, RLU). #P<0.001 (vs. LPS + ATP), **P<0.005 (vs. LPS + ATP), *P<0.05 (vs. LPS + ATP). (C) Schematic diagram showing the sequence of PAR1, peptide sequences, and relative (anti-inflammatory) activity. These include the sequence of TR47 (SEQ ID NO:7), the sequence of Ac-TR47 (SEQ ID NO:56), the sequence of 16-mer-TR47 (SEQ ID NO:43), the sequence of 9-mer-TR47 (SEQ ID NO:36), the sequence of 8-mer-TR47 (SEQ ID NO:35), the sequence of 6-mer-TR47 (SEQ ID NO:33), the sequence of TR47 N-1 (SEQ ID NO:47), the sequence of TR47 N-2 (SEQ ID NO:51), the sequence of TR47 N-5 (SEQ ID NO:48), the sequence of TR47ΔQ (SEQ ID NO:49), the sequence of TR47ΔD (SEQ ID NO:52), the sequence of TR47ΔA (SEQ ID NO:50), and the sequence of TR48-54 (SEQ ID NO:53). [Figure 6]We demonstrate that PAR3- and PAR1-derived peptide variants cooperate to reduce caspase-1 activity. THP1 cells were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI for 3 hours at 37°C. The medium was then changed every 24 hours for 3 days. (A) Selected wells were treated with P3(42-65) or P3(42-54) (0 or 16 nM) in the presence or absence of TR47 (1 nM) for 60 minutes at 37°C. (B) Selected wells were treated with TR47 (0 or 4 nM) or TR47(N-1) (0 or 4 nM) in the presence or absence of 500 nM P3R for 60 minutes at 37°C. Cells were washed with DPBS and incubated with LPS (1 μg / mL) in serum-free RPMI for 3 hours at 37° C. Cells were washed with DPBS and incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase-1 inhibitor; C1i) or 2.5 μM ZVAD (pan-caspase inhibitor; pCi) for 45 minutes at 37° C. Afterwards, a caspase-1 activity assay was performed according to the manufacturer's instructions to measure luminescence (relative light units, RLU). [Figure 7]These results show that both PAR1- and PAR3-derived peptide variants cooperatively reduce caspase-1 activity. THP-1 null cells (THP1 cells obtained from Invivogen) were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. A subset of wells was selected, and cells were treated with either APC (4 μg / mL) or 50 μM of the indicated peptides ("TR47" (PAR1(47-66); SEQ ID NO: 7), "TR47ΔQ" (PAR1(N47Q)-66; SEQ ID NO: 49), "P3R" (PAR3(42-65); SEQ ID NO: 4), or "P3Rm" (PAR3(42-54); SEQ ID NO: 5)) in serum-free RPMI for 60 minutes at 37°C. No. 8); (B) TR47 (0-16 nM) (■) alone or with P3R (500 nM) (□), or TR47ΔQ (0-16 nM) (▲) alone or with P3R (500 nM) (▽); (C) P3R (0-16 nM) (■) alone or with TR47 (1 nM) (□), or P3Rm (0-16 nM) (▲) alone or with TR47 (1 nM) (▽); or (D) a subset of wells Cells were selected and treated with P3R (0-16 nM) (●) ± TR47 (1 nM) (◯) or P3R51-65 (SEQ ID NO: 9) (0-16 nM) (▲; dotted line) ± TR47 (1 nM) (△; dotted line) in serum-free RPMI for 60 minutes at 37°C. After washing with DPBS, cells were incubated with LPS (1 μg / mL) in serum-free RPMI for 3 hours at 37°C. After washing with DPBS, cells were incubated with 10 μM YVA. After incubation with ATP (5 mM) in the presence or absence of D (a caspase-1 inhibitor) or 2.5 μM ZVAD (a pan-caspase inhibitor) for 45 min at 37°C, caspase-1 activity assays were performed according to the manufacturer's instructions, measuring luminescence (relative light units, RLU). Experimental caspase-1 activity was normalized to the value for light units induced by YVAD (a caspase-1 inhibitor).(B), (C), and (D): Experimental caspase-1 activity was normalized to the value for luminescence units induced by YVAD (a caspase-1 inhibitor). For (A–E): Data points represent the mean ± SD of at least three independent experiments. *P<0.005 (vs. LPS + ATP, or vs. LPS + ATP and TR47 or P3R alone or variants); #P<0.05 (vs. LPS + ATP and P3R alone or P3(42-54) alone); ns not significant. For (D), *P<0.05 (vs. LPS + ATP and P3 peptide alone); **P<0.005 (vs. LPS + ATP and P3 peptide alone); ns not significant. [Figure 8] This shows that the PAR1:PAR3 covalently linked peptide reduces caspase-1 activity. THP-1 cells were plated in 96-well plates at a final concentration of 1 x 106 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI for 3 hours at 37°C. The medium was then changed every 24 hours for 3 days. Selected wells were treated with the PAR1 9-mer peptide P1(47-55) (SEQ ID NO: 36) (0-500 nM) (◯), the PAR3 peptide P3(51-65) (SEQ ID NO: 9) (0-500 nM) (▽), or the Gly10-linked PAR1 / PAR3 fusion peptide "G10" (0-500 nM) (□) for 60 minutes at 37°C. Cells were washed with DPBS and incubated with LPS (1 μg / mL) in serum-free RPMI for 3 hours at 37°C. Cells were washed with DPBS and incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (a caspase-1 inhibitor) at 37°C for 45 minutes. Caspase-1 activity assays were then performed according to the manufacturer's instructions, measuring luminescence (relative light units, RLU). Experimental caspase-1 activity was then adjusted to the luminescence units of the caspase-1 inhibitor and expressed as caspase-1 activity. Data points represent the mean ± SD of at least three independent experiments. *P < 0.05 (vs. LPS + ATP). [Figure 9]Figure 1 shows that PAR1-derived peptides, PAR3-derived peptides, and PAR1 / PAR3 fusion peptides inhibit thrombin-induced disruption of the endothelial barrier. The lowest curve in each panel, labeled "IIa," represents the observed effect of thrombin (IIa) in the absence of peptide. In each panel, IIa was always present for each added peptide. The numbers in each panel indicate the concentration of each peptide for each curve. A peptide concentration of 0 is represented by the lowest curve, labeled "IIa." (A) Dose-response inhibition of TER over time, as measured by the normalized cell index (NCI), by the PAR1-derived peptide P1(47-66) or TR47 using concentrations between 5 nM and 50 nM. (B) Dose-response inhibition of NCI over time by the PAR3-derived peptide P3(42-65) or P3R using a concentration range of 5 nM to 50 nM. (C) Dose-response inhibition of NCI over time by the short-sequence PAR1-derived peptide P1(47-55) using a peptide concentration range between 50 nM and 100 μM. (D) Dose-response inhibition of NCI over time by the short-sequence PAR3-derived peptide P3(42-54) using a peptide concentration range between 1 μM and 200 μM. (E) Dose-response inhibition of NCI over time by the hybrid peptide G10, in which the P1(47-55) peptide described in panel C was linked to the PAR3 peptide P3(51-65) using ten Gly residues. In this case, the concentration range for dose-response inhibition was between 3 nM and 50 nM peptide. An estimate of the percentage activity for each peptide dilution in the presence of thrombin can be quantified by obtaining the area under the curve (AUC) for each peptide dilution compared to the AUC value for thrombin alone in the absence of any peptide. These values ​​were used to calculate the potency of each PAR peptide. DETAILED DESCRIPTION OF THE INVENTION

[0019] I. Overview The present invention relates to the anti-inflammatory activity of various peptides or polypeptides derived from PAR1 and PAR3. The present invention is based in part on the discovery by the inventors that some peptides mimicking the N-terminal sequences of PAR3 and PAR1, which are cleaved by APC at their respective non-canonical sites, have anti-inflammatory activity. Surprisingly, it was also discovered that there is a strong synergistic effect in the observed anti-inflammatory activity between PAR3-derived peptides and PAR1-derived peptides.

[0020] Activated protein C (APC) binds PAR1 to Arg 41 and Arg 46 APC is a protease that cleaves PAR3 at both Arg and 41 APC cleavage is known to be cytoprotective and anti-apoptotic. The central finding of the present invention is the following: 46 and Asn 47 Based on the cleavage by APC of the peptide bond between the N-terminal residue Asn 47 Peptides mimicking the partial sequence of PAR1, such as residues 47-NPNDKYEPFWEDEEKNESGL-66 ("TR47" or "P1(47-66)"), induce anti-inflammatory cell signaling, which may often involve the inhibition of inflammasomes. In addition, the Arg residue in PAR3 41 and Gly 42 Based on APC cleavage of the peptide bond between the N-terminal residue Gly 42 Peptides that mimic the partial sequence of PAR3 beginning at 42-GAPPNSFEEFPFSALEGWTGATIT-65, such as residues 42-GAPPNSFEEFPFSALEGWTGATIT-65 ("P3R"), also induce anti-inflammatory cell signaling.

[0021] As detailed herein, we have demonstrated the roles of EPCR, PAR1, and PAR3 in enhancing the anti-inflammatory activity of APCs using an induced human macrophage-like cell line. We discovered that TR47, a PAR1-derived peptide, and P3R, a PAR3-derived peptide, are each independently anti-inflammatory, and that the combination of these two peptides can exert a synergistic anti-inflammatory effect. Specifically, we evaluated the relevance of inflammasomes in APC suppression in the human immune system by using the THP1 model cell line, which has historically been used to study both inflammasomes and the cytoprotective activity of APCs. Caspase-1, a cysteine ​​protease in the NLRP3 inflammasome, is diagnostic for inflammasome activation. We monitored caspase-1 activity in activated THP1 cells to assess the anti-inflammatory effects of APCs on human cells. We further evaluated whether peptides derived from protease-activated receptors (PAR1 and PAR3), which mimic the non-canonical cleavage of APC in these two G protein-coupled receptors (GPCRs), i.e., TR47 and P3R, respectively, exert anti-inflammatory activity in human THP1 cells. We found that APC, TR47, and P3R could each restrict the NLRP3 inflammasome, as measured by caspase-1 activity and IL-1β release, in the human THP1 cell line. Surprisingly, we observed that these two peptides could synergistically suppress inflammasome activity. The anti-inflammatory effects of these PAR peptides indicate their utility as novel anti-inflammatory pharmacological agents.

[0022] To further clarify the observed synergistic effect, we also created a PAR1 / PAR3 fusion peptide by covalently linking a PAR1-derived peptide with a PAR3-derived peptide and examined its anti-inflammatory efficacy. Not surprisingly, we found that the covalently linked PAR1 / PAR3 peptide significantly reduced caspase-1 activity at certain concentrations, whereas each of the component peptides alone had a modest anti-inflammatory effect. Importantly, we also observed that the covalently linked PAR1 / PAR3 fusion peptide inhibited thrombin-induced reductions in transendothelial electrical resistance (TEER). These data provide further evidence that PAR1- and PAR3-derived peptides can exert anti-inflammatory and cytoprotective activities (e.g., preventing thrombin-induced endothelial barrier disruption) in a synergistic manner.

[0023] In accordance with these discoveries, the present invention provides novel methods for inhibiting or suppressing inflammation and methods for treating inflammatory disorders or conditions. Also provided herein are therapeutic compositions that can be used to practice the therapeutic methods of the present invention.

[0024] Unless otherwise specified, the present invention can be carried out using standard procedures, for example, as described in Methods in Enzymology, Vol. 289: Solid-Phase Peptide Synthesis, JN Abelson, M.I. Simon, G.B. Fields (editors), Academic Press; 1st Edition (1997) (ISBN-13: 978-0121821906); U.S. Patent Nos. 4,965,343 and 5,849,954; Maniatis et al., Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA (1982); Sambrook et al., Molecular Cloning: A Laboratory Manual (2nd Edition), Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, USA (1989); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, NY York, USA (1986); or Methods in Enzymology: Guide to Molecular Cloning Techniques, Vol. 152, S.L. Berger and A.R. Kimmerl (editors), Academic Press Inc., San Diego, USA (1987); Current Protocols in Protein Science (CPPS) (John E. Coligan et al., eds., John Wiley and Sons, Inc.), Current Protocols in Cell Biology (CPCB) (Juan S. Bonifacino et al., eds., John Wiley and Sons, Inc.), and Culture of Animal Cells: A Manual of Basic Technique, R.Ian Freshney, Publisher: Wiley-Liss; 5th Edition (2005), Animal Cell Culture Methods (Methods in Cell Biology, Vol. 57, Jennie P. Mather and David Barnes (editors), Academic Press, 1st Edition, 1998). The following sections provide further guidance for carrying out the compositions and methods of the present invention.

[0025] II. Definition Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by those skilled in the art to which this invention belongs.The following references provide those skilled in the art with general definitions of many of the terms used in this invention: Oxford Dictionary of Biochemistry and Molecular Biology, Smith et al. (editors), Oxford University Press (revised edition, 2000); Dictionary of Microbiology and Molecular Biology, Singleton et al. (editors), John Wiley & Sons (3rd Edition, 2002); and A Dictionary of Biology (Oxford Paperback Reference), Martin and Hine (editors), Oxford University Press (4th Edition, 2000).In addition, the following definitions are provided to assist the reader in the practice of this invention.

[0026] The singular terms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Similarly, the word "or" is intended to include "and" unless the context clearly dictates otherwise.

[0027] As used herein, the term "amino acid" of a peptide refers to naturally occurring amino acids and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a similar manner to naturally occurring amino acids. Naturally occurring amino acids are those amino acids encoded by the genetic code, as well as those amino acids that are subsequently modified, such as hydroxyproline, γ-carboxyglutamate, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as naturally occurring amino acids, i.e., compounds that have carbon atoms bonded to hydrogen, a carboxyl group, an amino group, and an R group, such as homoserine, norleucine, methionine sulfoxide, and methionine methylsulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as naturally occurring amino acids. The PAR1-derived protective polypeptides of the present invention include derivatives or analogs modified with non-naturally encoded amino acids.

[0028] As used herein, the term "comprising" or "comprises" is used in reference to compositions, methods, and their respective component(s) that are essential to the invention, yet may include unspecified elements, whether essential or not.

[0029] As used herein, the term "consisting essentially of" refers to those elements required for a given embodiment. The term allows for the presence of elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.

[0030] The term "consisting of" refers to compositions, methods, and their respective components described herein excluding any element not recited in that description of an embodiment.

[0031] The term "conservatively modified variants" or "conservatively substituted variants" applies to both amino acid and nucleic acid sequences. With respect to a particular nucleic acid sequence, conservatively modified variants refer to those nucleic acids that encode identical or essentially identical amino acid sequences, or essentially identical sequences if the nucleic acid does not encode an amino acid sequence. Due to the degeneracy of the genetic code, any given protein can be encoded by a large number of functionally identical nucleic acids. For example, the codons GCA, GCC, GCG, and GCU all encode the amino acid alanine. Thus, at any position where alanine is specified by a given codon, this codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variants are "silent variants," and are one species of conservatively modified variants. Any nucleic acid sequence herein that encodes a polypeptide also represents all possible silent variants of that nucleic acid. Those skilled in the art will recognize that each codon in a nucleic acid (except AUG, which is normally the only codon for methionine, and TGG, which is normally the only codon for tryptophan) can be altered to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid that encodes a polypeptide is implicit in each described sequence.

[0032] With respect to polypeptide sequences, "conservatively modified variants" refers to variants with conservative amino acid substitutions, i.e., variants in which an amino acid residue is replaced with another amino acid residue having a side chain with a similar charge. Various groups of amino acid residues with similarly charged side chains have been defined in the art. These groups include amino acids with basic side chains (e.g., lysine, arginine, histidine), acidic side chains (e.g., aspartic acid, glutamic acid), uncharged polar side chains (e.g., glycine, asparagine, glutamine, serine, threonine, tyrosine, cysteine), nonpolar side chains (e.g., alanine, valine, leucine, isoleucine, proline, phenylalanine, methionine, tryptophan), beta-branched side chains (e.g., threonine, valine, isoleucine), and aromatic side chains (e.g., tyrosine, phenylalanine, tryptophan, histidine).

[0033] As used herein, a "derivative" of a reference molecule (e.g., an anti-inflammatory peptide disclosed herein) is a molecule that is chemically modified relative to the reference molecule while substantially retaining biological activity. Modifications can be, for example, oligomerization or polymerization, modification of amino acid residues or the peptide backbone, crosslinking, cyclization, conjugation, fusion to additional heterologous amino acid sequences, or other modifications that substantially alter the stability, solubility, or other properties of the peptide.

[0034] The terms "decrease," "reduced," "reduction," "decrease," or "inhibit" are all used generally herein to mean a decrease by a statistically significant amount. However, for the avoidance of doubt, "reduced," "reduction," or "decrease" or "inhibit" means a decrease (decrease) of at least 10% when compared to a reference level, for example, at least about a 20% decrease (decrease) when compared to a reference level, or at least about a 30% decrease (decrease), or at least about a 40% decrease (decrease), or at least about a 50% decrease (decrease), or at least about a 60% decrease (decrease), or at least about a 70% decrease (decrease), or at least about a 80% decrease (decrease), or at least about a 90% decrease (decrease), or a decrease (decrease) up to and including 100% (e.g., levels abolished when compared to a reference sample), or any decrease (decrease) between 10-100%.

[0035] The terms "engineered cell" or "recombinant host cell" (or simply "host cell") refer to a cell into which a recombinant expression vector has been introduced. It should be understood that such terms are intended to refer not only to the particular subject cell but also to the progeny of such a cell. Because certain modifications may occur in successive generations due to either mutation or environmental influences, such progeny may not, in fact, be identical to the parent cell, although such progeny are still included within the term "host cell" as used herein.

[0036] The term "fragment" refers to any peptide or polypeptide having an amino acid residue sequence shorter than the amino acid residue sequence of the full-length polypeptide described herein. An isolated peptide of PAR1 is shortened or truncated compared to its parent full-length PAR1. Compared to the full-length PAR1 sequence, the PAR3-derived or PAR1-derived polypeptides or peptides of the present invention typically contain a conserved Arg residue, respectively. 41 residues and Arg 46 residues, and optionally with further N-terminal deletions or substitutions as described herein. These fragments can additionally contain C-terminal truncations (e.g., truncations of up to 50, 100, 200, 300 or more C-terminal residues) and / or internal deletions as well.

[0037] "Inflammation" or "inflammatory response" refers to the innate immune response that occurs when tissue is injured by bacteria, trauma, toxins, heat, or any other cause. Damaged tissue releases various compounds, including histamine, bradykinin, and serotonin. Inflammation can be either acute (i.e., a response in which the inflammatory process is active) or chronic (i.e., a response characterized by slow progression and the formation of new connective tissue). Acute and chronic inflammation can be distinguished by the cell types involved. Acute inflammation often involves polymorphonuclear neutrophils, whereas chronic inflammation is usually characterized by lymphohistiocytic and / or granulomatous responses. Inflammation involves both specific and nonspecific defense system responses. Specific defense system responses are specific immune system responses to antigens (possibly including self-antigens). Nonspecific defense system responses are inflammatory responses mediated by leukocytes lacking immunological memory. Such cells include granulocytes, macrophages, neutrophils and eosinophils.

[0038] Inflammatory disorders are diseases caused by a dysregulated inflammatory response, such as rheumatoid arthritis, hay fever, and atherosclerosis. Inflammation or the inflammatory response refers to the innate immune response that occurs when tissue is injured by bacteria, trauma, toxins, heat, or any other cause. Damaged tissue releases various compounds, including histamine, bradykinin, and serotonin. Inflammation includes both acute responses (i.e., responses in which the inflammatory process is active) and chronic responses (i.e., responses characterized by slow progression and the formation of new connective tissue). Acute and chronic inflammation can be distinguished by the cell types involved. Acute inflammation often involves polymorphonuclear neutrophils, whereas chronic inflammation is usually characterized by lymphohistiocytic and / or granulomatous responses. Inflammation includes both specific and nonspecific defense system responses. One type of specific defense system response is a specific immune system response to antigens, possibly including self-antigens. One type of nonspecific defense reaction is the inflammatory response mediated by leukocytes lacking immunological memory, including granulocytes, macrophages, neutrophils, and eosinophils.

[0039] The term "isolated" means that a protein is removed from its natural environment. However, some of the components that are found together may continue to be present with the "isolated" protein. Thus, an "isolated polypeptide" may be a protein that is not as it appears in nature and is substantially less than 100% pure.

[0040] The terms "identical" or percent "identity," in the context of two or more nucleic acid or polypeptide sequences, refer to two or more sequences or subsequences that are the same. Two sequences are "substantially identical" if they have a specified percentage of amino acid residues or nucleotides that are the same (i.e., 60% identity over a specified region, or, when not specified, over the entire sequence), when compared and aligned for maximum correspondence over a comparison area or selected region as estimated using one of the sequence comparison algorithms described below or by manual alignment and visual inspection. Optionally, identity can exist over a region that is at least about 50 nucleotides (or 10 amino acids) in length, or more preferably, over a region that is 100 to 500 or 1000 or more nucleotides (or 20, 50, 200 or more amino acids) in length.

[0041] Various methods for aligning sequences for comparison are well known in the art. Optimal alignment of sequences for comparison can be achieved, for example, by local homology algorithms (Smith and Waterman, Adv. Appl. Math. 2:482c, 1970), by homology alignment algorithms (Needleman and Wunsch, J. Mol. Biol. 48:443, 1970), by similarity search methods (Pearson and Lipman, Proc. Nat'l. Acad. Sci. USA 85:2444, 1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package (Genetics Computer Group, Madison, WI)), or by manual alignment and visual inspection (see, for example, Brent et al., Current Protocols in Molecular Biology (John Wiley & Sons, Inc. (Ringbinder edition, 2003). Two examples of algorithms that are suitable for determining percent sequence identity and percent sequence similarity are the BLAST algorithm and the BLAST 2.0 algorithm, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402, 1977, and Altschul et al., J. Mol. Biol. 215:403-410, 1990, respectively.

[0042] In addition to the percentage of sequence identity mentioned above, another indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid has immunological cross-reactivity with the antibody generated against the polypeptide encoded by the second nucleic acid, as described below.Therefore, a polypeptide is typically substantially identical to a second polypeptide, for example, when the two peptides differ only by conservative substitutions.Another indication that two nucleic acid sequences are substantially identical is that these two molecules or their complements hybridize with each other under stringent conditions, as described below.Another indication that two nucleic acid sequences are substantially identical is that the same primer can be used to amplify the sequence.

[0043] Unless otherwise specified, the terms "polypeptide" and "peptide" are used interchangeably herein to refer to a polymer of amino acid residues (e.g., "PAR3-derived anti-inflammatory polypeptide" and "PAR1-derived anti-inflammatory peptide"). These terms encompass both short oligopeptides (e.g., peptides having fewer than about 25 residues) and longer polypeptide molecules (e.g., polymers of more than about 25 or 30 amino acid residues). Typically, anti-inflammatory peptides (oligopeptides) or anti-inflammatory polypeptides of the invention can comprise from about 4 amino acid residues to about 350 or more amino acid residues in length. In some embodiments, peptides or polypeptides can comprise from about 8 amino acid residues to about 60 amino acid residues in length. Anti-inflammatory peptides or anti-inflammatory polypeptides of the invention include naturally occurring and non-naturally occurring amino acid polymers, as well as amino acid polymers in which one or more amino acid residues are artificial chemical mimetics of the corresponding naturally occurring amino acid. Unless otherwise indicated, a particular polypeptide sequence also implicitly encompasses conservatively modified variants thereof.

[0044] As used herein, the term "peptidomimetic" or "peptidomimetic" refers to a derivative compound of a reference peptide (e.g., an anti-inflammatory polypeptide disclosed herein) that biologically mimics the function of the peptide. Typically, a peptidomimetic derivative of a PAR1-derived anti-inflammatory polypeptide of the present invention has at least 50%, at least 75%, or at least 90% of the biological activity of the reference polypeptide (e.g., inhibition of caspase 1 activity).

[0045] The term "operably linked" refers to a functional relationship between two or more polynucleotide (e.g., DNA) segments. Typically, the term refers to the functional relationship of a transcriptional regulatory sequence to a transcriptional sequence. For example, a promoter or enhancer sequence is operably linked to a coding sequence if it stimulates or regulates the transcription of the coding sequence in an appropriate host cell or other expression system. Generally, a promoter transcriptional regulatory sequence operably linked to a transcriptional sequence is physically contiguous to the transcriptional sequence. That is, such a promoter transcriptional regulatory sequence is cis-acting. However, some transcriptional regulatory sequences, such as enhancers, need not be physically contiguous to the coding sequence whose transcription they enhance, nor need they be located in close proximity to such a coding sequence.

[0046] As used herein, the term "ortholog" or "homologue" refers to a polypeptide that shares substantial sequence identity and has the same or similar function from a different species or organism. For example, PAR3 and PAR1 from humans, rabbits, rats, mice, and many other animal species, respectively, are orthologs due to the similarity in their sequences and functions.

[0047] The phrase "signaling pathway" or "signaling activity" (e.g., cytoprotective signaling mediated by APC, PAR3, or PAR1) refers to at least one biochemical reaction resulting from the interaction of a cell with a stimulatory compound or agent, but more generally refers to a series of biochemical reactions resulting from such an interaction. Thus, the interaction of a stimulatory compound (e.g., a PAR3- or PAR1-derived peptide) with a cell results in a "signal" that is transmitted through a signaling pathway, ultimately resulting in a cellular response.

[0048] The term "subject" includes human and non-human animals. Non-human animals include all vertebrates, including mammals and non-mammals, such as non-human primates, sheep, dogs, cows, chickens, amphibians, and reptiles. Except where noted, the terms "patient" and "subject" are used interchangeably herein.

[0049] The term "agent" includes any substance, molecule, element, compound, or entity, or combination thereof. The term includes, but is not limited to, proteins, polypeptides, small organic molecules, polysaccharides, polynucleotides, etc. The term can refer to a natural product, a synthetic compound, or a chemical compound, or a combination of two or more substances. Unless otherwise specified, the terms "agent," "substance," and "compound" are used interchangeably herein.

[0050] Administration "in combination with" one or more other therapeutic agents includes simultaneous (concurrent) and consecutive administration in any order.

[0051] The term "contacting" has its ordinary meaning and refers to the bringing together of two or more agents (e.g., polypeptides or small molecule compounds), or the bringing together of an agent and a cell. Contacting can occur in vitro: for example, the bringing together of two or more agents in a test tube or other container, or the bringing together of an agent and a cell or cell lysate in a test tube or other container. Contacting can also occur in a cell or in situ in vivo: for example, the bringing into contact of two polypeptides in a cell by coexpression in the cell of a recombinant polynucleotide encoding the two polypeptides, or in a cell lysate. Contacting can also occur inside the body of a subject, for example, by administering to the subject an agent that then interacts with the intended target (e.g., a tissue or cell).

[0052] Protease-activated receptors (PARs) are a subfamily of related G protein-coupled receptors that are activated by cleavage of a portion of their extracellular domain. They are highly expressed on platelets, endothelial cells, muscle cells, and neurons. There are four known types of protease-activated receptors: PAR1, PAR2, PAR3, and PAR4. They are members of the seven-transmembrane G protein-coupled receptor superfamily. PARs are activated by the action of serine proteases at their N-termini, such as thrombin (for PAR1, PAR3, and PAR4), activated protein C (for PAR1, PAR2, and PAR3), trypsin (for PAR2), or other proteases, exposing tethered ligands. The rate-limiting step in PAR signaling is determined by the efficiency of N-terminal proteolysis, which is regulated by allosteric binding sites, cofactors, membrane localization, and receptor dimerization. This ultimately controls the initiation of PAR signaling. In addition, these factors also suppress cellular responses by directing signaling to the G protein pathway or the β-arrestin pathway. PAR1 signaling on the endothelial cell surface is regulated by activating proteases and heterodimerizing with PAR2 or PAR3. The cellular effects of thrombin are mediated by protease-activated receptors (PARs). Thrombin signaling in platelets contributes to hemostasis and thrombosis.

[0053] PAR1 is expressed not only in all types of blood cells but also in epithelia, neurons, astrocytes, and immune cells. PAR1 was initially identified as a thrombin receptor, but other agonists, such as activated protein C (APC), were later identified. Proteolytic removal of a portion of the N-terminal extracellular domain of PAR1 by these protease agonists generates new tethered ligands that interact with the receptor body and induce transmembrane signaling, thereby triggering a wide range of signaling pathways. For example, PAR1 is involved in regulating vascular tone and endothelial cell permeability. In vascular smooth muscle, PAR1 mediates contraction, proliferation, and hypertrophy. PAR1 contributes to the proinflammatory responses observed in atherosclerosis and restenosis.

[0054] Protease-activated receptor 3 (PAR3), also known as coagulation factor II receptor-like 2 (F2RL2) and thrombin receptor-like 2, is a protein encoded by the F2RL2 gene in humans. PAR3 is activated by proteolytic cleavage of its extracellular amino terminus. Similar to PAR1, the new amino terminus of PAR3 functions as a tethered ligand, activating the receptor. PAR3 is a cofactor for PAR4 activation by thrombin in mouse platelets, whereas PAR3 may contribute to PAR1 activation in human cells. Like PAR1, PAR3 is also expressed on the surface of vascular endothelial cells. Similarly, low levels of, but detectable, PAR3 expression are also evident in human platelets.

[0055] As used herein, "treat," "treatment," or "ameliorate" refers to (i) preventing a pathological condition (e.g., an inflammatory disorder) from occurring (e.g., prophylaxis); (ii) suppressing or halting the development of a pathological condition; and (iii) alleviating the symptoms associated with a pathological condition. Thus, "treatment" includes administering a therapeutic compound or composition described herein to prevent or delay the onset of symptoms, complications, or biochemical manifestations of a disease described herein, thereby alleviating or ameliorating the symptoms of the disease, condition, or disorder, or halting or inhibiting further development of the disease, condition, or disorder. "Treatment" also refers to any indicia of success in treating or ameliorating or preventing a disease, condition, or disorder described herein, including any objective or subjective parameter, such as reduction; remission; reduction; or making the disease state more tolerable to the patient; slowing the rate of degeneration or decline; or making the end point of degeneration less debilitating. The detailed procedure for treating or ameliorating a disorder or its symptoms can be based on objective or subjective parameters, including the results of an examination by a physician.

[0056] As used herein, the term "variant" refers to a molecule (e.g., a polypeptide or polynucleotide) that contains a sequence that is substantially identical to that of a reference molecule. For example, the reference molecule can be an N-terminally truncated PAR3 or PAR1 polypeptide (e.g., SEQ ID NO: 2 or SEQ ID NO: 5), or a polynucleotide encoding this polypeptide. The reference molecule can also be a PAR3-derived or PAR1-derived anti-inflammatory polypeptide disclosed herein, or a polynucleotide encoding this anti-inflammatory polypeptide (e.g., P3R or TR47). In some embodiments, the variant can share at least 50%, at least 70%, at least 80%, at least 90%, at least 95% or more sequence identity with the reference molecule. In some other embodiments, the variant differs from the reference molecule by having one or more conservative amino acid substitutions. In some other embodiments, a variant of a reference molecule (e.g., the anti-inflammatory polypeptides P3R or TR47) has an altered amino acid sequence (e.g., with one or more conservative amino acid substitutions) but substantially retains the biological activity of the reference molecule (e.g., activating PAR3 signaling or PAR1 signaling). A variety of conservative amino acid substitutions are well known to those skilled in the art.

[0057] The term "vector" is intended to refer to a polynucleotide molecule capable of transporting another polynucleotide to which it has been linked. One type of vector is a "plasmid," which refers to a circular double-stranded DNA loop into which additional DNA segments can be ligated. Another type of vector is a viral vector, into which additional DNA segments can be ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Other vectors (e.g., non-episomal mammalian vectors) can be integrated into the genome of a host cell upon introduction into the host cell, and thereby are replicated along with the host genome. Moreover, certain vectors are capable of directing the expression of genes to which they are operatively linked. Such vectors are referred to herein as "recombinant expression vectors" (or simply "expression vectors").

[0058] III. PAR3-Derived Anti-Inflammatory Peptides and PAR1-Derived Anti-Inflammatory Peptides and Derivative Compounds The present invention provides methods and compositions related to the use of anti-inflammatory peptides or polypeptides derived from PAR3 and PAR1 to suppress inflammation and treat inflammatory conditions or disorders. PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides refer to peptides or polypeptides, respectively, that have anti-inflammatory activity and are derived from the N-terminal sequences of PAR3 and PAR1 after cleavage by APC at a non-canonical cleavage site, or are fragments of such N-terminal sequences. In various embodiments, PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides can also have cytoprotective activity. The cytoprotective activity of these peptides includes any non-anticoagulant protective cellular activity mediated by the APC signaling pathway, including, inter alia, various activities associated with inhibiting apoptosis and promoting cell survival. These include activating the PI3K-Akt survival pathway, preventing thrombin-induced endothelial barrier disruption, inhibiting endothelial apoptosis (e.g., by blocking the pro-apoptotic activity of p53 or by other mechanisms), secreting TNF-α by macrophages, reducing cellular NFκB activation in endothelial cells, preventing leukocyte adhesion to activated endothelial cells, and inducing stabilization of endothelial cell barrier integrity via sphingosine-1 phosphate release or sphingosine-1 phosphate receptor 1 (S1P1) activation or Tie2 activation. Such activities can be easily assessed by a variety of methods widely known in the art, for example, by endothelial barrier assays and in vivo vascular permeability assays. See, for example, Mosnier et al., Blood. 120:5237-5246, 2012; Burnier and Mosnier, Blood 122:807-816, 2013; and Stavenuiter and Mosnier, Blood 124:3480-3489, 2014.

[0059] As exemplified herein by peptides P3R and TR47 or various fragments thereof, respectively, PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides activate PAR1 and PAR3 differently, eliciting different types of signal transduction in cells than do peptides mimicking the PAR1 sequence starting at residue 42 (so-called TRAP reagents) or the PAR3 sequence starting at residue 39 (P3K reagents). PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides derived from the N-terminal sequences of PAR3 and PAR1 after cleavage by APC at non-canonical cleavage sites may all be used in the present invention. Specifically, PAR1 is cleaved by APC (and other proteases), particularly thrombin, at the Arg 41 It is cleaved at the canonical site of Arg 41 Peptides that mimic the new N-terminus resulting from cleavage by PAR1 are often called thrombin receptor-activating peptides (TRAPs). Thrombin cleavage of PAR1, or treatment of cells with TRAPs, is generally pro-inflammatory and, in many cases, can be harmful to cells or animals, depending on the context of the cell, organ, or animal. APC also cleaves PAR1 at the non-canonical site, Arg. 46 TRAP and TR47 are agonists for PAR1 activation. However, TR47 has been shown to act as an agonist with an activity profile distinct from that of TRAP. PAR3 is cleaved at a canonical site (Lys38) by proteases such as thrombin. Peptides that mimic the new N-terminus resulting when cleavage at Lys38 occurs (e.g., sequences beginning at Thr39, such as the peptide "P3K") can act as agonists of PAR3 in activating the thrombin-mediated pathway. Similar to PAR1, PAR3 also cleaves at a non-canonical site (Arg). 41), resulting in a new N-terminus as shown in peptide P3R (also known herein as "P3(42-65)") (42-GAPPNSFEEFPFSALEGWTGATIT-65; SEQ ID NO: 4). Peptides P3R and P3K are agonists for PAR3 activation. However, it has been shown that P3R appears to act as an agonist with an activity profile distinct from that of P3K.

[0060] As exemplified herein, the N-terminal residue Asn 47 PAR1-derived anti-inflammatory peptides (e.g., peptide TR47) that mimic the partial sequence of PAR1 beginning with α-Gly can induce anti-inflammatory cell signaling. Anti-inflammatory cell signaling can be manifested by activities such as inflammasome suppression and / or inhibition of caspase-1 activation. Similarly, the N-terminal residue Gly 42 PAR3-derived anti-inflammatory peptides (such as peptide P3R) that mimic the partial sequence of PAR3 beginning with , or some fragments thereof, can also cause anti-inflammatory cell signaling. P3R and P3K are agonists for PAR3 activation. In the examples, it is shown that P3R appears to act as an agonist with an activity profile that is distinct from that of P3K.

[0061] Typically, the PAR3-derived anti-inflammatory peptides for practicing the present invention include: (1) Met 1 ~Arg 41 or (2) at least the first four N-terminal residues of the human PAR3 sequence (SEQ ID NO: 2) or a conservatively modified variant thereof, from which Phe of SEQ ID NO: 3 has been deleted; or (3) at least four consecutive amino acid residues of the human PAR3-derived peptide P3R (SEQ ID NO: 4), from which Phe of SEQ ID NO: 3 has been deleted. 10 ~Phe 12 In some embodiments, the peptide contains at least four consecutive amino acid residues encompassing the Met motif, or a conservatively modified variant thereof. 1 ~Arg 41In some embodiments, the anti-inflammatory PAR3-derived polypeptide comprises the first 4, 5, 6, 7, 8, 9, 10, 11, 12, or more N-terminal residues of peptide P3R (SEQ ID NO: 4), or a conservatively modified variant sequence. In some embodiments, the anti-inflammatory PAR3-derived polypeptide comprises the first 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, or 24 ...). 10 ~Phe 12 In some embodiments, the anti-inflammatory PAR3-derived polypeptide comprises at least 5, 6, 7, 8, 9, 10, 11, 12 or more consecutive amino acid residues of SEQ ID NO:4, or a conservatively modified variant thereof, comprising the motif Phe. 10 ~Phe 12 Some of these PAR3-derived peptides contain at least 13, 14, 15, 16, 17, 18, 19, 20, 21, 22 or more consecutive amino acid residues of SEQ ID NO: 4, including the Phe motif, or conservatively modified variants thereof. 10 ~Trp 18A few specific examples of PAR3-derived anti-inflammatory polypeptides suitable for the present invention are P3R (SEQ ID NO: 4), P3Rm or P3(42-54) (GAPPNSFEEFPFS; SEQ ID NO: 8), P3R51-65 or P3(51-65) (FPFSALEGWTGATIT; SEQ ID NO: 9), and P3R51-59 or P3(51-59) (FPFSALEGW; SEQ ID NO: 10), or conservatively modified variants thereof. Further examples of PAR3-derived anti-inflammatory polypeptides include GAPPNSFEEFPFSA (SEQ ID NO: 11), GAPPNSFEEFPFSAL (SEQ ID NO: 12), GAPPNSFEEFPFSALE (SEQ ID NO: 13), GAPPNSFEEFPFSALEG (SEQ ID NO: 14), GAPPNSFEEFPFSALEGW (SEQ ID NO: 15), GAPPNSFEEFPFSALEGWT (SEQ ID NO: 16), GAPPNSFEEFPFSALEGWTG (SEQ ID NO: 17), GAPPNSFEEFPFSALEGWTGA (SEQ ID NO: 18), GAPPNSFEEFPFSALEGWT GAT (SEQ ID NO: 19), GAPPNSFEEFPFSALEGWTGATI (SEQ ID NO: 20), FPFSALEGWT (SEQ ID NO: 21), FPFSALEGWTG (SEQ ID NO: 22), FPFSALEGWTGA (SEQ ID NO: 23), FPFSALEGWTGAT (SEQ ID NO: 24), FPFSALEGWTGATI (SEQ ID NO: 25), FPFSALEG (SEQ ID NO: 26), FPFSALE (SEQ ID NO: 27), FPFSAL (SEQ ID NO: 28), EFPFSAL (SEQ ID NO: 29), and EEFPFSAL (SEQ ID NO: 30), or conservatively modified variants thereof. Any of these PAR3-derived peptides can be used alone or in combination with the PAR1-derived peptides described herein in the methods of the invention for suppressing inflammation and / or treating inflammatory conditions.

[0062] Typically, PAR1-derived anti-inflammatory peptides for practicing the present invention are Met 1 ~Arg 46Human PAR1 sequence (SEQ ID NO: 5), variants (e.g., with conservative substitutions, Met 1 ~Arg 46 Preferably, the peptide has at least the first four or five N-terminal residues that are substantially identical to the corresponding N-terminal residues of a variant of TR47 (also known as P1(47-66)) (SEQ ID NO: 7), a human PAR1 sequence with a deletion of Met, an ortholog (e.g., a non-human PAR1 sequence with a similar deletion), or a variant of TR47 (also known as P1(47-66)) (SEQ ID NO: 7) with an additional N-terminal modification (amino acid substitution or deletion). 1 ~Arg 46The anti-inflammatory PAR1-derived polypeptides have a sequence derived from the N-terminal residues of the soluble human PAR1 extracellular sequence (SEQ ID NO: 6) with deletions of the N-terminal residues. In some embodiments, the anti-inflammatory PAR1-derived polypeptides have at least the first four N-terminal residues substantially identical to the corresponding N-terminal residues of SEQ ID NO: 6. In some of these embodiments, the anti-inflammatory PAR1-derived polypeptides contain the first 21 or more N-terminal residues of SEQ ID NO: 6, or a conservatively modified variant sequence. In some preferred embodiments, the PAR1-derived anti-inflammatory polypeptides contain the first 6, 7, 8, 9, 10, 11, 12, or more N-terminal residues of peptide TR47 (SEQ ID NO: 7), or a conservatively modified variant sequence. As exemplified herein by the TR47 8-mer, TR47 9-mer, and TR47 16-mer, these peptides maintain substantial anti-inflammatory activity compared to that of TR47. In some embodiments, the PAR1-derived anti-inflammatory polypeptide contains the first 13, 14, 15, 16, 17, 18, 19, or more N-terminal residues of SEQ ID NO:7, or a conservatively modified variant sequence. In some other embodiments, the PAR1-derived anti-inflammatory peptide is a variant of TR47 with a mutation at the N-terminus. These include TR47 variants with deletions of the first 1, 2, 3, 4, 5, 6, 7, 8, or more residues at the N-terminus. They also include TR47 variants with one or more amino acid substitutions at the N-terminus. As exemplified herein by TR47(N-1), TR47(N-5), TR47ΔQ, and TR47ΔA, these TR47 variant peptides also maintain substantial anti-inflammatory activity compared to that of TR47.

[0063] Some specific examples of PAR1-derived anti-inflammatory polypeptides that are suitable for the present invention are shown in SEQ ID NO: 6 and SEQ ID NO: 7 (peptide TR47), as well as the following peptides: peptide NPND (SEQ ID NO: 31), peptide NPNDK (SEQ ID NO: 32), peptide NPNDKY (SEQ ID NO: 33), peptide NPNDKYE (SEQ ID NO: 34), peptide NPNDKYEP (SEQ ID NO: 35), peptide NPNDKYEPF (SEQ ID NO: 36), peptide NPNDKYEPFW (SEQ ID NO: 37), peptide NPNDKYEPFWE (SEQ ID NO: 38), peptide NPNDKYEPFWED (SEQ ID NO: 39), peptide NPNDKYEPFWEDE (SEQ ID NO: 40), peptide NPNDKYEPFWEDEE (SEQ ID NO: 41), peptide NPNDKYEPFWEDEEK (SEQ ID NO: 42), peptide NPNDKYEPFWEDEEKN (SEQ ID NO:43), peptide NPNDKYEPFWEDEEKNE (SEQ ID NO:44), peptide NPNDKYEPFWEDEEKNES (SEQ ID NO:45), peptide NPNDKYEPFWEDEEKNESG (SEQ ID NO:46), peptide PNDKYEPFWEDEEKNESGL (SEQ ID NO:47), peptide NDKYEPFWEDEEKNESGL (SEQ ID NO:51), peptide DKYEPFWEDEEKNESGL (SEQ ID NO:57), peptide KYEPFWEDEEKNESGL (SEQ ID NO:58), peptide YEPFWEDEEKNESGL (SEQ ID NO:48), peptide EPFWEDEEKNESGL (SEQ ID NO:59), peptide PFWEDEEKNESGL (SEQ ID NO:60), peptide QPNDKYEPFWEDEEKNESGL (SEQ ID NO:49), and peptide APNDKYEPFWEDEEKNESGL (SEQ ID NO:50). Any of these PAR1-derived peptides can be used alone or in combination with the PAR3-derived peptides described herein in the methods of the present invention for suppressing inflammation and / or treating inflammatory conditions.

[0064] In addition to the peptides mentioned above, anti-inflammatory compounds suitable for the present invention also include related compounds or derivative compounds derived from the PAR3-derived and PAR1-derived anti-inflammatory peptides or polypeptides exemplified herein. These related compounds or derivative compounds include variants, analogs, mimetics, complexes or fusion molecules containing the peptides or polypeptides, as well as other compounds derived from the PAR3-derived and PAR1-derived anti-inflammatory peptides or polypeptides. In some preferred embodiments, the derivative compounds have substantially the same chemical or biological activity as the PAR3-derived and PAR1-derived anti-inflammatory peptides or polypeptides exemplified herein (e.g., P3R peptide and TR47 peptide). Related compounds or derivative compounds can include, for example, peptides or polypeptides having substantially the same sequence, such as conservatively modified variants. Related compounds or derivative compounds also include peptides or polypeptides derived from the non-human orthologous sequences of PAR3 and PAR1, respectively. Related or derivative compounds suitable for the present invention also include variants, analogs, multimers, peptidomimetics, fusions with other molecules (e.g., carrier moieties), or other derivatives that may be derived from the PAR3-derived and PAR1-derived anti-inflammatory polypeptides exemplified herein (e.g., peptide P3R and peptide TR47). These derivative compounds can be subjected to appropriate assays or screening methods to identify anti-inflammatory compounds with optimized activity. In some embodiments, derivative compounds are modified versions of the exemplified peptides resulting from conservative amino acid substitutions. In some other embodiments, derivative compounds are variants resulting from non-conservative substitutions to the extent that they substantially retain the activity of such peptides. Modifications to anti-inflammatory peptides can be made using standard techniques routinely practiced in the art (e.g., U.S. Patent Application Nos. 20080090760 and 20060286636).

[0065] In some embodiments, derivative compounds of the exemplary PAR-3-derived and PAR1-derived anti-inflammatory polypeptides of the present invention (e.g., peptide P3R or peptide TR47) are analogs that contain one or more naturally occurring amino acid derivatives of the 20 standard amino acids, such as 4-hydroxyproline, 5-hydroxylysine, 3-methylhistidine, homoserine, ornithine, or carboxyglutamic acid, and may contain amino acids that are not linked by polypeptide bonds. Similarly, these derivative compounds can also be cyclic polypeptides and other conformationally constrained structures. Various methods for modifying polypeptides to produce analogs and derivatives are widely known in the art: e.g., Roberts and Vellaccio, The Peptides: Analysis, Synthesis, Biology, editors: Gross and Meinhofer, Vol. 5, p. 341, Academic Press, Inc., New York, NY (1983); and Burger's Medicinal Chemistry and Drug Discovery, editor: Manfred E. Wolff, Ch. 15, pp. 619-620, John Wiley & Sons Inc., New York, NY (1995).

[0066] Some other derivative compounds of the exemplified PAR3-derived anti-inflammatory polypeptides and PAR1-derived anti-inflammatory polypeptides are peptide mimetics. Various peptide mimetics based on PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides (e.g., peptide P3R or peptide TR47) substantially retain the activity of the reference peptides. Such peptide mimetics include chemically modified peptides or polypeptides having substantially the same structure as the reference polypeptide or peptide from which the peptide mimetic is derived, polypeptide-like molecules containing non-naturally occurring amino acids, and peptoids (see, for example, Burger's Medicinal Chemistry and Drug Discovery (1995; supra)). For example, a peptide mimetic can have one or more residues chemically derivatized by reaction of a functional side group. In addition to side group derivatization, chemical derivatives can have one or more backbone modifications, including alpha-amino substitutions such as N-methyl, N-ethyl, and N-propyl, and alpha-carbonyl substitutions such as thioester, thioamide, and guanidino. Typically, a peptide mimetic exhibits a significant degree of structural identity when compared with a reference polypeptide, and exhibits characteristics that are recognizable as being derived from or associated with the reference polypeptide, or characteristics that are known to be derived from or associated with the reference polypeptide.Peptide mimetics include organic structures that exhibit similar properties, such as charge and charge spacing characteristics, of the reference polypeptide.Peptide mimetics can also include constrained structures to maintain optimal spacing and charge interactions of amino acid functional groups.

[0067] In some embodiments, the PAR3-derived and PAR1-derived anti-inflammatory peptide or polypeptide derivative compounds described herein are molecules in which the peptide or polypeptide is covalently or non-covalently conjugated to a carrier moiety by any conventional method. A "carrier moiety" ("carrier" or "carrier molecule") is a conjugation partner that can enhance the immunogenicity of a polypeptide. Suitable carriers are typically large, slowly metabolized macromolecules such as proteins; polysaccharides (e.g., latex-functionalized SEPHAROSE™, agarose, cellulose, and cellulose beads); polymeric amino acids (e.g., polyglutamic acid and polylysine); amino acid copolymers; and inactive virus particles or attenuated bacteria (e.g., Salmonella). In various embodiments, the carrier moiety can be a carrier protein, an immunoglobulin, an Fc domain, a PEG molecule, or other polymer. In some embodiments, the carrier moiety is a protein. Integral membrane proteins, such as those from E. coli and other bacteria, are useful conjugation partners. Particularly useful carrier proteins are serum albumin, keyhole limpet hemocyanin (KLH), certain immunoglobulin molecules, thyroglobulin, ovalbumin, bovine serum albumin (BSA), tetanus toxoid (TT), and diphtheria toxoid (CRM). In some other embodiments, the carrier moiety can be a polymer that is not a protein or polypeptide. Examples of such polymers include, for example, carbohydrates such as dextran, mannose, or mannan.

[0068] In some embodiments, the PAR3-derived and PAR1-derived anti-inflammatory peptides, variants, or derivatives described herein are dimerization or multimerization molecules. In some of these embodiments, the dimerization or multimerization of these anti-inflammatory agents can be achieved by covalent linkage to at least one linker moiety. In some embodiments for combination therapy, a PAR3-derived peptide or variant (e.g., P3R or P3R(51-59)) can be conjugated to a PAR1-derived peptide or variant (e.g., TR47 or TR47 8-mer). Homo- or hetero-multimerization of PAR3-derived peptides and / or PAR1-derived peptides can be achieved by various suitable means. For example, these peptides can be covalently linked by recombinant techniques. In some embodiments, the multimerization molecules of the present invention can utilize the carrier moieties mentioned above. In some of these embodiments, a carrier molecule or carrier moiety can be used to conjugate a PAR3-derived peptide (e.g., P3R or P3R(51-59)) to a PAR1-derived peptide (e.g., TR47 or TR47 8-mer). In some embodiments, the peptide or polypeptide can also be a C -C ... 1~12 It can be conjugated with a linking moiety.

[0069] The PAR3-derived peptides and / or PAR1-derived peptides described herein can be linked by other chemical bond linkages, such as disulfide bonds, or by chemical crosslinking. In some other embodiments, the anti-inflammatory peptides described herein can be physically linked in tandem to form polymers of PAR3-derived peptides or PAR1-derived peptides. The peptides comprising such polymers can be spaced apart by peptide linkers. For example, a PAR3-derived peptide can be covalently linked to a PAR1-derived peptide via a glycine linker, as exemplified herein. In various embodiments, the glycine linker can contain from about 2 to about 20 glycine residues. In these embodiments, the PAR3-derived peptide can be linked to either the N-terminus or C-terminus of the PAR1-derived peptide via a linker. In some embodiments, other molecular biology techniques well known in the art can be used to generate peptide polymers. In some embodiments, polyethylene glycol (PEG) can serve as a linker to dimerize two peptide monomers. For example, a single PEG moiety containing two reactive functional groups may be simultaneously attached to the N-terminus of both peptide chains of a peptide dimer. These peptides are referred to herein as "PEGylated peptides." In some embodiments, the peptide monomers of the invention may be oligomerized using the biotin / streptavidin system.

[0070] In any of these conjugation schemes, varying copies of a PAR3-derived peptide (e.g., P3R or P3R(51-59)) and a PAR1-derived peptide (e.g., P3R or P3R(51-59)) can be linked in a heterologous multimerization molecule. In some of these embodiments, multiple copies of the PAR3-derived peptide are attached to a carrier moiety for each copy of the attached PAR1-derived peptide. For example, the multimerization molecule can contain a carrier moiety in which the PAR3-derived peptide and the PAR1-derived peptide are attached at a ratio of at least about 20:1, 15:1, 12:1, 10:1, 8:1, 6:1, 4:1, or 2:1. In some other embodiments, multiple copies of the PAR1-derived peptide are attached to a carrier moiety for each copy of the attached PAR3-derived peptide. For example, the multimerization molecule can contain a carrier moiety that binds PAR1-derived peptides and PAR3-derived peptides in a ratio of at least about 20:1, 15:1, 12:1, 10:1, 8:1, 6:1, 4:1, or 2:1. Depending on the specific dosages to be achieved for the two peptides or their derivative compounds as described herein, any of these conjugation ratios can be used in constructing heterologous multimerization molecules for practicing the methods of the present invention.

[0071] Various peptide stabilization methods known in the art can be used with the methods and compositions described herein.For example, using D-amino acids, using reduced amide bonds for peptide backbone, and using non-peptide bonds, including but not limited to pyrrolinone and sugar mimics, to link side chains can each bring about stabilization.The design and synthesis of sugar-scaffolded peptidomimetics are described in the art (e.g., Hirschmann et al., J.Med.Chem.36,2441-2448,1996).In addition, pyrrolinone-based peptidomimetics provide peptide pharmacophores in a stable background with improved bioavailability properties.See, for example, Smith et al., J.Am.Chem.Soc.122,11037-11038,2000.

[0072] In some embodiments, derivative compounds of the exemplified anti-inflammatory peptides or polypeptides of PAR3 and PAR1 include various modifications within the sequence, such as terminal NH2 acylation (e.g., acetylation) or thioglycolic acid amidation, terminal carboxylamidation (e.g., terminal carboxylamidation with ammonia, methylamine, and similar terminal modifications). The amino and / or carboxy termini of the polypeptides described herein can also be modified. Terminal modifications are useful for reducing susceptibility to proteinase digestion and thus can be useful for extending the half-life of the polypeptide in solution, particularly in biological fluids where proteases may be present. Amino-terminal modifications include methylation (e.g., -NHCH3 or -N(CH3)2), acetylation (e.g., with acetic acid or its halogenated derivatives (e.g., α-chloroacetic acid, α-bromoacetic acid, or α-iodoacetic acid)), addition of a benzyloxycarbonyl (Cbz) group, or blocking the amino terminus with any blocking group containing a carboxylate functional group defined by RCOO- or a sulfonyl functional group defined by R-SO2- (where R is selected from the group consisting of alkyl, aryl, heteroaryl, alkylaryl, etc., and similar groups). Desamino acids can also be incorporated at the N-terminus (so that the N-terminal amino group is absent) to reduce susceptibility to proteases or to constrain the conformation of the peptide compound. In some embodiments, the N-terminus is acetylated with acetic acid or acetic anhydride.

[0073] Carboxy-terminal modifications include replacing the free acid with a carboxamide group or forming a cyclic lactam at the carboxy terminus to introduce structural constraints. To reduce susceptibility to proteases or to constrain the conformation of the peptide, the peptides described herein can also be cyclized or desamino or descarboxy residues can be incorporated at the terminus of the peptide, thereby eliminating the terminal amino or carboxyl group. Various methods for synthesizing cyclic peptides are known in the art, for example, in U.S. Patent Application No. 20090035814 and Muralidharan and Muir, Nat. Methods, 3:429-38, 2006. The C-terminal functional groups of the peptides described herein include amide, amide lower alkyl, amide di(lower alkyl), lower alkoxy, hydroxy, and carboxy, as well as lower ester derivatives thereof, and pharmaceutically acceptable salts thereof.

[0074] The PAR3-derived and PAR1-derived anti-inflammatory peptide or polypeptide compounds described herein also serve as structural models for non-peptide compounds with similar biological activity.Various techniques are available for constructing compounds with the same or similar desired biological activity as the PAR3-derived peptides and PAR1-derived peptides, but with more favorable activity in terms of solubility, stability, and susceptibility to hydrolysis and proteolysis.See, for example, Morgan and Gainor, Ann. Rep. Med. Chem. 24:243-252, 1989.These techniques include, but are not limited to, replacing the peptide backbone with a backbone composed of phosphonates, amidates, carbamates, sulfonamides, secondary amines, and N-methylamino acids.

[0075] IV. Synthesis of PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides and related compounds The PAR3-derived anti-inflammatory polypeptides and PAR1-derived anti-inflammatory polypeptides described herein, including their variants and derivatives, can be chemically synthesized and purified by standard chemical or biochemical methods widely known in the art.Some methods for producing analog or derivative compounds of PAR3-derived anti-inflammatory polypeptides and PAR1-derived anti-inflammatory polypeptides are described above.Other methods that can be used to produce the anti-inflammatory polypeptides of the present invention and their derivative compounds include, for example, solid-phase peptide synthesis.For example, peptides can be synthesized using t-Boc (tert-butyloxycarbonyl) protecting group or FMOC (9-flourenyl methyloxycarbonyl) protecting group described in the art. See, for example, Merrifield, J. Am. Chem. Soc. 85:2149-2154, 1963; "Peptide synthesis and applications", Methods in molecular biology, Vol. 298, edited by John Howl; "Chemistry of Peptide Synthesis", N. Leo Benoiton, 2005, CRC Press (ISBN-13:978-1574444544); and "Chemical Approaches to the Synthesis of Peptides and Proteins", P. Lloyd-Williams et al., 1997, CRC Press (ISBN-13:978-0849391422), Methods in Enzymology, Vol. 289: Solid-Phase Peptide Synthesis, JN Abelson, M. I. Simon, G. B. Fields (editors), Academic Press; 1st Edition (1997) (ISBN-13:978-0121821906); U.S. Patent Nos. 4,965,343 and 5,849,954.

[0076] In some embodiments, peptides can be obtained by solid-phase synthesis using a peptide synthesizer. A variety of commercially available peptide synthesizers are available for solid-phase peptide synthesis. For example, the Advanced Chemtech Model 396 Multiple Peptide Synthesizer and the Applied Biosystems Model 432A Peptide Synthesizer are suitable. Commercial companies that offer custom synthetic peptide manufacturing services exist, such as Abbiotec, Abgent, AnaSpec Global Peptide Services, LLC., Invitrogen, and rPeptide, LLC.

[0077] In some embodiments, PAR3-derived anti-inflammatory polypeptides and PAR1-derived anti-inflammatory polypeptides and their derivatives can also be synthesized and purified by molecular methods widely known in the art. Recombinant polypeptides can be expressed in bacterial cells, mammalian cells, insect cells, yeast cells, or plant cells. For example, conventional polymerase chain reaction (PCR) cloning techniques can be used to clone polynucleotides encoding PAR3-derived peptides or polypeptides or PAR1-derived peptides or polypeptides using the full-length cDNA sequence of PAR3 or PAR1 as a template for PCR cloning. Alternatively, the sense and antisense strands of the encoding nucleic acid can be synthetically produced and then annealed together to form a double-stranded encoding nucleic acid. Ideally, restriction enzyme digestion recognition sites should be designed at the ends of the sense and antisense strands to facilitate ligation into cloning vectors or other vectors. Alternatively, an A overhang at the 3' end can be included for TA cloning purposes, which are widely known in the art. Such encoding nucleic acids with an A-overhang at the 3' end can be easily ligated into Invitrogen's topoisomerase-assisted TA vectors (e.g., pCR-TOPO, pCR-Blunt II-TOPO, pENTR / D-TOPO, and pENTR / SD / D-TOPO). The encoding nucleic acids can be cloned into general-purpose cloning vectors, such as pUC19 vector, pBR322 vector, pBluescript vector (Stratagene Inc.), or pCR-TOPO obtained from Invitrogen Inc. The resulting recombinant vector carrying a polynucleotide encoding a PAR3 or PAR1 peptide can then be used for further molecular biological manipulations. These include, for example, site-directed mutagenesis for variant PAR1 peptides and / or to reduce the immunogenic properties of the peptide or to improve protein expression in heterologous expression systems.The coding sequence can also be subcloned into a protein expression vector or viral vector for synthesis of a fusion protein containing the PAR1 peptide, and for protein synthesis in various protein expression systems, including expression systems based on host cells selected from the group consisting of mammalian cell lines, insect cell lines, yeast cells, bacterial cells, and plant cells.

[0078] In some related embodiments, the present invention provides isolated or substantially purified polynucleotides (DNA or RNA) encoding the PAR3-derived anti-inflammatory polypeptides and PAR1-derived anti-inflammatory polypeptides described herein, including heterologous multimers (e.g., dimers) containing both PAR3-derived and PAR1-derived peptides. Expression vectors for expressing polynucleotides encoding these polypeptides and engineered host cells harboring the vectors are also provided herein. A polynucleotide encoding an anti-inflammatory polypeptide (e.g., a P3R(51-59) / TR47 8-mer multimer) is operably linked to a promoter in the expression vector. The expression construct can further include a secretion sequence to facilitate purification of the peptide from cell culture medium. Host cells into which the vectors are introduced can be any of a variety of expression host cells widely known in the art, such as bacterial (e.g., E. coli) cells, yeast cells, or mammalian cells.

[0079] Recombinant protein expression in different host cells can be constitutive or inducible with inducers, such as copper sulfate, sugars (e.g., galactose), methanol, methylamine, thiamine, tetracycline, or IPTG. After expressing the protein in the host cells, the host cells are lysed to release the expressed protein for purification. A preferred purification method is affinity chromatography, such as ion-metal affinity chromatography using nickel, cobalt, or zinc affinity resins for histidine-tagged peptides. Methods for purifying histidine-tagged recombinant proteins are described by Clontech using their Talon® cobalt resin and by Novagen in their pET System Manual (10th Edition). Another preferred purification strategy is by immunoaffinity chromatography; for example, an anti-Myc antibody-conjugated resin can be used to affinity purify Myc-tagged peptides. Enzymatic digestion with serine proteases (e.g., thrombin and enterokinase) cleaves the peptide and releases it from the histidine tag or Myc tag, thereby releasing the recombinant peptide from the affinity resin while leaving the histidine tag or Myc tag bound to the affinity resin.

[0080] Cell-free expression systems can also be used to produce the anti-inflammatory polypeptides of the present invention. Cell-free expression systems offer several advantages over traditional cell-based expression methods, including the ease of modifying reaction conditions to promote protein folding, reduced sensitivity to product toxicity, and suitability for high-throughput strategies, such as rapid expression screening or large-scale protein production due to reduced reaction volumes and process times. Cell-free expression systems can use plasmid or linear DNA. Furthermore, improvements in translation efficiency have resulted in yields of over one milligram of protein per milliliter of reaction mix. One example of a cell-free translation system capable of producing high-yield proteins is described by Spirin et al. (Science 242:1162, 1988). This method uses a continuous-flow design of a feeding buffer containing amino acids, adenosine triphosphate (ATP), and guanosine triphosphate (GTP) throughout the reaction mixture, with continuous removal of the translated polypeptide product. In this system, E. coli lysate is used to provide the cell-free continuous feeding buffer. This continuous flow system is compatible with both prokaryotic and eukaryotic expression vectors. An example of large-scale cell-free protein production is described in: Chang et al., Science 310:1950-3, 2005.

[0081] Other commercially available cell-free expression systems include the Expressway™ Cell-Free Expression System (Invitrogen), in which an E. coli-based in vitro system is utilized for efficient coupled transcription and translation reactions to produce up to milligram quantities of active recombinant protein in a tube reaction format; the Rapid Translation System (RTS) (Roche Applied Science), in which an E. coli-based in vitro system is also used; and the TNT-Coupled Reticulocyte Lysate System (Promega), in which a rabbit reticulocyte-based in vitro system is used.

[0082] V. Suppression of Inflammation and Treatment of Inflammatory Conditions The anti-inflammatory PAR3-derived peptides and PAR1-derived peptides and derivative compounds described herein, including variants, analogs, and peptidomimetics, can be used in a variety of therapeutic or prophylactic applications to inhibit or suppress unwanted inflammation and to treat a variety of inflammatory diseases or disorders. In some embodiments, a subject in need of treatment is administered a therapeutically effective amount of a PAR3-derived anti-inflammatory peptide or polypeptide or derivative compound described herein. In some embodiments, a subject in need of treatment is administered a therapeutically effective amount of a PAR1-derived anti-inflammatory peptide or polypeptide or derivative compound described herein. In some embodiments, a subject in need of treatment is administered both a PAR3-derived anti-inflammatory peptide or polypeptide or derivative compound and a PAR3-derived anti-inflammatory peptide or polypeptide or derivative compound as described herein. As detailed herein, the combination of both compounds can achieve a synergistic effect in suppressing or inhibiting inflammation even at very low dosages. As described in more detail below, anti-inflammatory peptides (e.g., P3R or TR47), with or without homo- or hetero-multimerization (conjugation or fusion), can be formulated into pharmaceutical compositions for therapeutic or prophylactic uses as disclosed herein.

[0083] In one aspect, the present invention provides a method for suppressing inflammation and treating subjects suffering from inflammatory diseases. The PAR3-derived and PAR1-derived anti-inflammatory peptides, variants, and mimetics described herein can be used to suppress or improve symptoms associated with unwanted inflammation and to treat various diseases or disorders associated with or mediated by unwanted inflammatory responses. These include conditions characterized by or associated with unwanted immune activation or immune responses, such as allograft rejection, autoimmune diseases (e.g., lupus and multiple sclerosis), allergic reactions (e.g., asthma), epidermal inflammatory conditions (eczema), rheumatoid arthritis, sterile inflammation, and hay fever. Specific diseases or disorders include, for example, graft-versus-host disease, rheumatoid arthritis, systemic lupus erythematosus, Hashimoto's thyroidis, multiple sclerosis, myasthenia gravis, neuromyelitis optica (NMO), type I or type II diabetes and disorders associated therewith, vasculitis, pernicious anemia, Sjogren's syndrome, uveitis, psoriasis, Graves' ophthalmopathy, alopecia areata, and the like, allergic diseases such as allergic asthma, atopic dermatitis, allergic rhinitis / conjunctivitis, allergic contact dermatitis, inflammatory diseases optionally with an underlying abnormal response such as inflammatory bowel disease, Crohn's disease or ulcerative colitis, intrinsic asthma, inflammatory lung injury, inflammatory liver injury, inflammatory glomerular injury, atherosclerosis, osteoarthritis, irritant contact dermatitis and further eczematous dermatitis, seborrheic dermatitis, skin manifestations of immune-mediated disorders, inflammatory eye diseases, keratoconjunctivitis, and acute respiratory distress syndrome. Conditions characterized by or accompanied by unwanted immune activation or immune responses also include various viral infections, including, for example, infections with chikungunya virus, HIV-1, coronaviruses, and influenza viruses.

[0084] In various embodiments, the method of the present invention relates to the treatment of inflammatory disorders and infectious diseases.The inflammatory disorders that may be suitable for the prognostic method of the present invention include any disease or condition that involves abnormal inflammation, particularly the disorders that are mediated by the type I IFN amplification pathway and cytokine storm, or the disorders that involve the type I IFN amplification pathway and cytokine storm.These include, for example, asthma, autoimmune disease, chronic inflammation, chronic prostatitis, glomerulonephritis, hypersensitivity, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, transplant rejection and vasculitis. Examples of specific inflammatory disorders include rheumatoid arthritis, systemic lupus erythematosus, acute respiratory distress syndrome (ARDS), alopecia areata, anklosing spondylitis, antiphospholipid syndrome, autoimmune Addison's disease, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, autoimmune lymphoproliferative syndrome (ALPS), autoimmune thrombocytopenic purpura (ATP), Blehcet's disease, and disease), bullous pemphigoid, cardiomyopathy, celiac sprue dermatitis, chronic fatigue syndrome-immunodeficiency syndrome (CFIDS), chronic inflammatory demyelinating polyneuropathy, cicatricial pemphigoid, cold agglutinin disease, CREST syndrome, Crohn's disease, Degos disease, dermatomyositis, juvenile dermatomyositis, discoid lupus, essential mixed cryoglobulinemia, fibromyalgia-fibromyositis, Graves' disease, Guillain-Barré, Hashimoto's thyroiditis, idiopathic pulmonary fibrosis, idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, insulin-dependent diabetes mellitus (type 1), juvenile arthritis, Meniere's disease, mixed connective tissue disease , multiple sclerosis, myasthenia gravis, pemphigus vulgaris, pernicious anemia, polyarteritis nodosa, polychondritis, polyglandular syndrome, polymyalgia rheumatica, polymyositis and dermatomyositis, primary agammaglobulinemia, primary biliary cirrhosis, psoriasis, Raynaud's phenomenon, Reiter's syndrome, rheumatic fever, sarcoidosis, scleroderma, sepsis, Sjogren's syndrome, stiff man syndrome, systemic inflammatory response syndrome (SIRS), Takayasu's arteritis, temporal arteritis / giant cell arteritis, ulcerative colitis, uveitis, vasculitis, vitiligo, and Wegener's granulomatosis.

[0085] In some embodiments, the unwanted inflammation or inflammatory condition to be treated involves, is mediated by, or is manifested by the activation of caspase 1. In some embodiments, the unwanted inflammation or inflammatory condition to be treated involves, is mediated by, or is manifested by the activation of caspase 1. In some embodiments, the unwanted inflammation or inflammatory condition to be treated involves, is mediated by, or is manifested by the formation of inflammasomes. In some embodiments, the subject to be treated is a subject suffering from, or suspected of having, a condition or disorder that has been shown to be amenable to treatment by APC. These include, for example, ischemia / reperfusion in the brain, heart, and kidney; inflammation of the lung, kidney, and gastrointestinal tract; sepsis; Ebola virus; diabetes; and total body lethal irradiation. See, for example, Griffin et al., Blood 125:2898-2907, 2015.

[0086] In some embodiments, the therapeutic methods of the present invention involve administering to a subject a pharmaceutical composition containing a PAR3-derived anti-inflammatory peptide described herein (e.g., P3R). In some embodiments, the methods require administering to a subject a pharmaceutical composition containing a PAR1-derived anti-inflammatory peptide described herein (e.g., TR47). In some other embodiments, a subject in need of treatment is administered a combination of a PAR3-derived anti-inflammatory peptide described herein and a PAR1-derived anti-inflammatory peptide described herein. In some of these embodiments, the PAR3-derived anti-inflammatory peptide and the PAR1-derived anti-inflammatory peptide are administered to the subject simultaneously. In some other embodiments, the two peptides can be administered sequentially to the subject. In various embodiments, the two peptides can each be independently conjugated to a carrier moiety as described above. In some embodiments, the simultaneously administered PAR3-derived peptide and PAR1-derived peptide are conjugated to each other, for example, by covalent peptide fusion. In these embodiments, the PAR3-derived peptide can be fused to either the N-terminus or C-terminus of the PAR1-derived peptide. In some of these embodiments, the two peptides can be connected via a linker moiety, e.g., a linker peptide or spacer peptide, hi some embodiments, the two peptides can be conjugated in various ratios to a carrier moiety, e.g., a carrier protein, an Fc domain, or a PEG molecule, as described above.

[0087] Preferably, the various therapeutic methods of the present invention relate to treating mammalian subjects. In some of these embodiments, the subject is a human patient. Some embodiments of the present invention relate to inhibiting or suppressing unwanted inflammation or inflammatory responses that accentuate or accompany any of the inflammatory diseases or disorders described herein. Some embodiments of the present invention relate to treating human subjects suffering from or suspected of having an autoimmune disorder. Examples of autoimmune disorders and related diseases that are suitable for the methods of the present invention include, for example, acute disseminated encephalomyelitis (ADEM), Addison's disease, alopecia areata, ankylosing spondylitis, antiphospholipid syndrome (APS), autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune inner ear disease, bullous pemphigoid, Behcet's disease, celiac disease, Chagas' disease, chronic obstructive pulmonary disease, Crohn's disease, dermatomyositis, type 1 diabetes, diabetes-related inflammation, endometriosis, Goodpasture's syndrome, Graves' disease, graft-versus-host disease (GVHD), Guillain-Barré syndrome (GBM), and others. S), Hashimoto's thyroiditis, hidradenitis suppurativa, Kawasaki disease, idiopathic thrombocytopenic purpura, interstitial cystitis, lupus erythematosus, mixed connective tissue disease, morphea, multiple sclerosis (MS), myasthenia gravis, narcolepsy, neuromyotonia, pemphigus vulgaris, pernicious anemia, psoriasis, psoriatic arthritis, polymyositis, primary biliary cirrhosis, rheumatoid arthritis, schizophrenia, scleroderma, Sjögren's syndrome, stiff-person syndrome, temporal arteritis (also known as "giant cell arteritis"), ulcerative colitis, vasculitis, vitiligo, microscopic polyangiitis, glomerulonephritis, and Wegener's granulomatosis.

[0088] In some embodiments, the subject to be treated by the method of the present invention is a subject suffering from or suspected of having neuroinflammation. Subjects with either acute or chronic neuroinflammation are suitable for treatment. Neuroinflammation is known to contribute to acute and chronic neuropathologies. These include stroke, post-traumatic brain injury, Alzheimer's disease, amyotrophic lateral sclerosis, Parkinson's disease, Huntington's disease, frontotemporal dementia, dementia with Lewy bodies, cerebral malaria, and prion diseases. Other central nervous system pathologies with excessive inflammation include CNS infectious diseases, such as Zika virus, HIV virus, West Nile virus, coronavirus infection, and bacterial infections that cause meningitis. See, for example, Voet et al., EMBO Mol. Med. 11:e10248, 2019; Heneka et al., Nat. Rev. Neurosci. 19:610-621, 2018; Ismael et al., Sci. Rep. 8:5971, 2018. Treatment with the methods of the present invention may be beneficial for curing or ameliorating the symptoms of various neuropathologies associated with neuroinflammation. By substantially suppressing or inhibiting the underlying inflammation in the listed conditions, subjects suffering from any of these neuropathologies may derive significant benefit from treatment with the methods of the present invention. In some other embodiments, the subject to be treated with the methods of the present invention is a subject suffering from or at risk of developing malarial inflammation. Malaria, caused by infection of red blood cells by the Plasmodium parasite, is a highly inflammatory disease with characteristic periodic fever caused by the synchronous rupture of infected red blood cells and the release of daughter parasites. By substantially suppressing or inhibiting the underlying inflammation, subjects suffering from malaria can derive significant benefit from treatment with the methods of the present invention.

[0089] VI. Screening Methods for Identifying Anti-inflammatory Agents The PAR3-derived anti-inflammatory peptides and / or PAR1-derived anti-inflammatory peptides and in vitro assays described herein can be used to identify novel agents with anti-inflammatory activity. In some embodiments, the present invention relates to methods using exemplified peptides (e.g., P3R and / or TR47) as positive controls to screen candidate agents for anti-inflammatory activity. Any known screening method or screening platform for identifying anti-inflammatory agents can be adapted to incorporate the anti-inflammatory peptides described herein as positive controls. These include animal models or other in vivo platforms, ex vivo screening methods, and in vitro screening methods.Such methods have been described in the art, for example, in del Palacio et al., J. Biomole. Screening 21:567-578, 2016; Jiang et al., PLoS One. 9:e96214, 2014; Hall et al., Disease Models & Mechanisms 7:1069-1081, 2014; Phanse et al., J. App. Pharm. Sci. 2:19-33, 2012; Giddings and Maitra, J. Biomole. Screening 15:1204-1210, 2010; Singh et al., Clinical Chemistry 51:2252-2256, 2005; Maurer et al. al.,J.Anal.Toxicol.25:237-44,2001;Alener&Bingoul,Intl.J.Crude Drug Res.26:197-207,1988;Famaey and Whitehouse,Biochem.Pharmacol.24:1609-1616,1975;VanArman,Clin.Pharmacol.Ther.16:900-904,1974;Carrano et al.,J.Pharm.Sci.61:1450-1454,1972;Riesterer et al.,Agents and Action 2,27-32,1971;Winter et al.,Fed.Proc.23,284,1964;andWinter and Portar,J.Amer.Pharm.Sci.Ed.46:515-519,1957.

[0090] Some screening methods of the present invention involve the use of in vitro cultured cell lines to monitor inflammation-related activity. In some of these embodiments, the inflammation-related activity being monitored is related to the assembly and activation of inflammasomes and the inflammasome-dependent activation of caspase 1, such as the enzymatic activity of caspase 1 or the secretion of IL-1β. Inflammasomes are large intracellular multiprotein complexes that play an essential role in inflammation-driven disease states. Inflammasomes can involve the activation of caspase 1, which is known to catalyze the maturation and processing of interleukin (IL)-1β and pro-IL-1β. Neutralization of IL-1β with a monoclonal antibody in the canakinumab (CANTOS) trial for atherosclerotic disease (see, e.g., Ridker et al., N. Engl. J. Med. 377:1119-1131, 2017) demonstrated that inflammation was reduced without concomitant changes in lipid levels, thereby reducing the risk of atherothrombosis, providing strong evidence implicating a pathological role for IL-1β in widespread inflammation, particularly cardiovascular disease. Inflammasomes play a protective role in host defense; however, activation may also contribute to ischemia-reperfusion injury (I / RI) and autoinflammation. APCs have been shown to limit inflammasome activation after myocardial I / RI in mouse models, thus demonstrating their anti-inflammatory role in the inflammasome process.

[0091] In some embodiments, a cultured human THP-1 cell line is used in the screening methods of the present invention. THP-1 cells are a human monocytic cell line with the ability to differentiate into macrophages. As demonstrated herein, the use of selected agonists in THP-1 cells is an effective in vitro means for inducing inflammasome and / or caspase I activity, and ultimately, inflammation. These screening methods of the present invention involve inducing inflammasome- and / or caspase I-dependent inflammation in THP-1 cells with an inflammatory-inducing agent (e.g., LPS, as exemplified herein) and evaluating the potential anti-inflammatory activity of candidate agents relative to the anti-inflammatory activity of exemplified anti-inflammatory peptides (e.g., P3R or TR47). Novel anti-inflammatory agents can be identified if they are found to have similar or stronger activity in suppressing inflammasome activation and / or caspase I activity that manifest inflammation-related activities or phenotypes, such as inflammation evidenced by caspase 1 activity or IL-1β secretion.

[0092] The candidate drugs that can be used in the screening methods of the present invention can be of any chemical nature. These include, for example, peptides (including polypeptides), beta-turn mimetics, polysaccharides, phospholipids, hormones, prostaglandins, steroids, purine-based compounds, pyrimidine-based compounds, oligomeric N-substituted glycines, oligocarbamates, sugars, fatty acids, as well as derivatives, structural analogs, or combinations thereof. In some embodiments, the candidate drugs to be used in the screening methods of the present invention are small molecule organic compounds. In some of these embodiments, combinatorial libraries of small molecule candidate drugs can be used to screen for therapeutic agents. Such compound libraries are widely known in the art, as described, for example, in Schultz et al., Bioorg. Med. Chem. Lett. 8:2409-2414, 1988; Weller et al., Mol Divers. 3:61-70, 1997; Fernandes et al., Curr. Opin. Chem. Biol. 2:597-603, 1998; and Sittampalam et al., Curr. Opin. Chem. Biol. 1:384-91, 1997. Candidate drugs include acyclic and unbranched small organic molecules, as well as other organic compounds, such as aromatic compounds, heterocyclic compounds, and benzodiazepines.

[0093] In some embodiments, the candidate agents to be screened in the methods of the invention are PAR3- or PAR1-derived peptides or polypeptides, variants, analogs, peptidomimetics, or other related or derivative compounds described herein. In some of these embodiments, the candidate agents to be screened by the methods of the invention are those that bind to the Met domain of human PAR3 as described herein. 1 ~Arg 41 The deleted extracellular domain (SEQ ID NO: 3) or Met of human PAR1 1 ~Arg 46The candidate agent can be a peptide or polypeptide variant, derivative compound, or mimetic compound that mimics the N-terminal sequence of the deleted extracellular domain (SEQ ID NO: 6). For example, the candidate agent can be a polypeptide derived from SEQ ID NO: 3 or SEQ ID NO: 6 with various C-terminal or internal deletions. In some embodiments, the P3R peptide (SEQ ID NO: 4) or TR47 peptide (SEQ ID NO: 7) can be used as a scaffold to generate a library of variant peptides or analog peptides and peptidomimetics. A library of candidate agents based on a reference peptide or polypeptide (e.g., a P3R peptide) can be easily generated using routine methods as described herein. Compared to a reference peptide (e.g., P3R or TR47) or reference polypeptide (e.g., SEQ ID NO: 3 or SEQ ID NO: 6), the candidate agent can also be a library of variant peptides or polypeptides containing one or more amino acid substitutions.

[0094] Methods for preparing libraries containing diverse populations of peptides, peptoids, and peptide mimetics are widely known in the art, and various libraries are commercially available. See, for example, Ecker and Crooke, Biotechnology 13:351-360, 1995; and Blondelle et al., Trends Anal. Chem. 14:83-92, 1995; and the references cited therein. See also Goodman and Ro, Peptidomimetics for Drug Design, "Burger's Medicinal Chemistry and Drug Discovery," Vol. 1 (M.E. Wolff, ed.; John Wiley & Sons, 1995), pp. 803-861; and Gordon et al., J. Med. Chem. 37:1385-1401 (1994). Those skilled in the art will understand that peptides can be produced directly in vitro or expressed from nucleic acids that can be produced in vitro. Libraries of peptide molecules can also be generated, for example, by constructing a cDNA expression library from mRNA collected from a tissue of interest. Methods for generating such libraries are well known in the art (see, for example, Sambrook et al., Molecular Cloning: A Laboratory Manual (Cold Spring Harbor Laboratory Press, 1989)).

[0095] Various methods for designing peptide derivatives and peptide mimetics and screening for functional peptide mimetics are widely known to those skilled in the art.One basic method for designing molecules that mimic known proteins or peptides is to first identify the active region(s) of the known protein (for example, in the case of antibody-antigen interaction, identify the region(s) of the antibody that allows binding to the antigen), and then search for mimetics that mimic this active region.Although the active region of known polypeptides is relatively small, mimetics are expected to be smaller (for example, in terms of molecular weight) than proteins, be correspondingly easier and cheaper to synthesize, and / or have various advantages in terms of stability or other favorable pharmacokinetic aspects.Such mimetics can be used as an easy-to-use alternative to reference polypeptides (for example, SEQ ID NO: 3) or reference peptides (for example, P3R) as agents for interacting with target molecules (for example, PAR3). For example, Reineke et al. (Nat. Biotech. 17; 271-275, 1999) designed mimetic molecules that mimic the binding site of the interleukin-10 protein using a large library of short synthetic peptides, each corresponding to a short section of interleukin-10. The binding of each of these peptides to its target (in this case, the binding of an antibody to interleukin-10) was then examined individually by assay techniques to identify potentially relevant peptides. Phage display libraries of peptides and alanine scanning methods can be used.

[0096] Other methods for designing peptidomimetics for specific peptides or proteins include the method described in European Patent EP 1206494, the SuperMimic program by Goede et al. (BMC Bioinformatics, 7:11, 2006), and the MIMETIC program by Campbell et al. (Microbiol. and Immunol. 46:211-215, 2002). The SuperMimic program is designed to identify suitable locations in a protein for inserting compounds that mimic portions of the protein, or mimetics. This application provides libraries containing peptidomimetic building blocks on the one hand and protein structures on the other. The search for promising peptidomimetic linkers for a given peptide is based on superimposing the peptide with several conformers of the mimetic. New synthetic elements or proteins can be introduced and used for the search. The MIMETIC computer program generates a series of peptides for interaction with a target peptide sequence and is taught by W. Campbell et al. (2002). A thorough discussion of this topic is reviewed in "Peptide Mimetic Design with the Aid of Computational Chemistry" by James R. Damewood Jr. (Reviews in Computational Chemistry, January 2007, Vol. 9, editors: Kenny B. Lipkowitz, Donald B. Boyd, John Wiley & Sons, Inc.) and in Tselios, et. al., Amino Acids, 14:333-341, 1998.

[0097] Once a library of candidate agents is prepared, the candidate agents can be readily screened for optimized or improved anti-inflammatory activity compared to the activity of the reference polypeptide. Candidate agents can be screened for improvements in any of the anti-inflammatory activities of the reference polypeptides disclosed herein, for example, for inhibition or suppression of caspase 1 enzymatic activity or IL-1β secretion (see Examples below). Variant or analog compounds based on the reference PAR3- or PAR1-derived anti-inflammatory peptides (e.g., P3R or TR47) optimized by such screening methods can be used in various therapeutic applications described herein.

[0098] VII. Therapeutic Compositions and Dosages The present invention provides therapeutic or pharmaceutical compositions for use in practicing the therapeutic or prophylactic methods described herein. The PAR3-derived and / or PAR1-derived anti-inflammatory peptides and related compounds (e.g., variants, derivatives, and mimetics) having anti-inflammatory activity described herein, as well as other therapeutic agents disclosed herein, can be administered directly to a subject in need of treatment. However, these therapeutic compounds are preferably administered to a subject in a pharmaceutical composition comprising the peptide, variant, or mimetic, and / or other active agent in a unit dosage form together with a pharmaceutically acceptable carrier, diluent, or excipient. Accordingly, the present invention provides pharmaceutical or therapeutic compositions comprising one or more of the anti-inflammatory peptide or derivative compounds disclosed herein. The present invention also provides the use of these peptides or related compounds in the preparation of pharmaceutical compositions or medicaments for treating or preventing the aforementioned diseases or medical disorders mediated by or involving unwanted inflammation.

[0099] Some compositions of the present invention contain one PAR3-derived anti-inflammatory peptide or related compounds (e.g., variants, derivatives, and mimetics) as described herein. Some of these compositions are pharmaceutical compositions containing a therapeutically effective amount or dosage of a PAR3-derived anti-inflammatory peptide (e.g., P3R) or derivative compound described herein and a pharmaceutically acceptable carrier. Some compositions of the present invention contain one PAR1-derived anti-inflammatory peptide or related compounds as described herein. Some of these compositions are pharmaceutical compositions containing a therapeutically effective amount or dosage of a PAR1-derived anti-inflammatory peptide (e.g., TR47) or derivative compound described herein and a pharmaceutically acceptable carrier.

[0100] Furthermore, some other compositions of the present invention contain both PAR3-derived anti-inflammatory peptides or related compounds and PAR1-derived anti-inflammatory peptides or related compounds as described herein. Some of these compositions are pharmaceutical compositions containing a therapeutically effective amount or dosage of both the PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides described herein or related compounds or derivative compounds described herein, in addition to a pharmaceutically acceptable carrier. As described above, the PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides can be provided as separate peptides in the composition, whether in monomeric or multimeric form. Alternatively, these peptides can be conjugated to each other as heterodimers or heteromultimers in the composition as described above. In various embodiments, the monomeric peptides, heterodimeric or homodimeric peptides, and heteromultimeric or homomultimeric peptides in the composition can be further conjugated to one or more carrier moieties described herein by covalent or non-covalent linkage. In some of the compositions, the PAR3-derived peptide or related compound and the PAR1-derived peptide or related compound can be conjugated to the carrier moiety in various ratios as described herein.

[0101] Pharmaceutically acceptable carriers are agents that are not biologically or otherwise undesirable. These agents can be administered to a subject together with the PAR3-derived peptide and / or the PAR1-derived peptide without causing any undesirable biological effects or interacting in a harmful manner with any of the components of the pharmaceutical composition. The composition can further contain other therapeutic agents suitable for treating or preventing unwanted inflammation or inflammatory disorders. Pharmaceutical carriers enhance, stabilize, or facilitate the preparation of the composition. Pharmaceutically acceptable carriers include physiologically compatible solvents, dispersion media, coatings, antibacterial and antifungal agents, isotonic agents, and absorption delaying agents. The pharmaceutically acceptable carrier used must be suitable for the various administration routes described herein. Further guidance for selecting appropriate pharmaceutically acceptable carriers is provided in the art, for example, Remington: The Science and Practice of Pharmacy, Mack Publishing Co., 20th Edition, 2000. In addition to the anti-inflammatory peptide and a pharmaceutically acceptable carrier, the pharmaceutical compositions of the present invention can further contain other active or inactive agents for suppressing information and known drugs for treating specific inflammatory disorders. For example, the pharmaceutical compositions can include known anti-inflammatory and analgesic agents.

[0102] Examples of such agents include glucocorticoids, nonsteroidal anti-inflammatory drugs (NSAIDs), cetaminophen, opiates, diproqualone, and lidocaine (topical).

[0103] Pharmaceutical compositions containing the PAR3-derived anti-inflammatory peptides and / or PAR1-derived anti-inflammatory peptides or derivative compounds described herein and / or other therapeutic agents can be administered by various methods known in the art, for example, orally. The route and / or mode of administration vary depending on the desired results. Depending on the route of administration, the active therapeutic agent may be coated with a material to protect the compound from the action of acids and other natural conditions that may inactivate the agent. Conventional pharmaceutical practices may be used to provide a suitable formulation for administering such compositions to a subject. Any appropriate route of administration may be used. These include, but are not limited to, oral, intravenous, parenteral, transdermal, subcutaneous, intraperitoneal, intramuscular, intracranial, intraorbital, intraventricular, pulmonary, intracapsular, and intraspinal administration. Depending on the specific condition of the subject to be treated, either systemic or localized delivery of the therapeutic agent may be used in the treatment.

[0104] When administered in vivo to a subject, pharmaceutical compositions typically contain a therapeutically effective amount or dosage of an active anti-inflammatory compound. A therapeutically effective amount is the total amount of anti-inflammatory compound that achieves the desired anti-inflammatory effect. Effective dosages or doses vary depending on many factors, including the means of administration, the target site, the patient's physiological condition, whether the patient is human or animal, other medications being administered, and whether the treatment is prophylactic or therapeutic. Typically, the patient is human; however, non-human mammals can also be treated. Treatment dosages must be titrated to optimize safety and efficacy. As a general guideline, dosages range from about 0.0001 to 100 mg / kg of host body weight, more usually from 0.01 to 5 mg / kg of host body weight. For example, dosages can be 1 mg / kg or 10 mg / kg of body weight, or within the range of 1 to 10 mg / kg.

[0105] In some embodiments, each peptide or derivative compound in the composition is provided at a concentration of at least 10 nM, 25 nM, 50 nM, 100 nM, 250 nM, 500 nM, 1 μM, 2.5 μM, 5 μM, 10 μM, 25 μM, or more. Depending on the specific circumstances, each administration to a subject may comprise a dosage of about 0.5 ml, 1 ml, 2.5 ml, 5 ml, 10 ml, 25 ml, 50 ml, 100 ml, or more of the composition. In some embodiments, the dosage for each administered peptide or derivative compound may range from about 10 ng to 1 g, 100 ng to 100 mg, 1 μg to 10 mg, or 30 to 300 μg per patient. In some embodiments, the dosage for each administered anti-inflammatory peptide or derivative is adjusted to achieve a plasma concentration of 1 to 1000 μg / ml, and in some embodiments, a plasma concentration of 25 to 300 μg / ml. In some embodiments, the dosage for each administered anti-inflammatory peptide or derivative can be adjusted to achieve a plasma concentration of about 0.01 μg / ml to about 1.6 μg / ml, preferably about 0.01 μg / ml to about 0.5 μg / ml. It is also within the skill of the art to initiate dosing at a level lower than required to achieve the desired therapeutic effect and gradually increase the dosage until the desired effect is achieved. It is also within the skill of the art to determine the optimal concentration of the variant to achieve the desired effect in the in vitro and ex vivo preparations of the present invention. Depending on the results of initial assays, the optimal concentration can range, for example, from about 1 to 1,000 nM, or from about 1 to 200 μM, depending on the general properties of the compound.

[0106] Exemplary treatment regimens involve administration once daily, once every other day, once weekly, once every two weeks, once monthly, or once every three to six months. In some methods, two or more anti-inflammatory peptides (e.g., P3R and TR47) or their respective derivatives are administered simultaneously; in such cases, the dosage of each administered therapeutic peptide falls within the ranges indicated. Pharmaceutical compositions are typically administered multiple times. As noted above, the interval between doses can be as long as one week, one month, or even one year. The interval can also be irregular, as indicated by measuring the blood level of the anti-inflammatory peptide or peptide-containing derivative compound (e.g., a conjugate containing a peptide and a carrier moiety) in the patient. Alternatively, the PAR3-derived peptide and / or PAR1-derived peptide can be administered as a sustained-release formulation, requiring less frequent administration. The dosage and frequency of administration can also vary depending on the half-life of the administered compound in the patient. Dosage and frequency of administration can vary depending on whether the treatment is preventive or therapeutic. In preventive use, a relatively small dosage is administered at relatively infrequent intervals over a long period of time. Some patients continue to receive treatment for the rest of their lives. In therapeutic use, a relatively large dosage at relatively short intervals is sometimes required until the progression of the disease slows or ends, preferably until the patient shows partial or complete improvement in the symptoms of the disease. Thereafter, the patient can be administered a preventive management regime.

[0107] Some methods of the present invention involve administering a combination of PAR3-derived anti-inflammatory peptides and PAR1-derived anti-inflammatory peptides or their respective derivative compounds described herein.As exemplified herein by peptide P3R and peptide TR47, a very low dose of one of these two peptides is sufficient to achieve a synergistic effect.Therefore, in some embodiments, each of these two peptides is provided in a pharmaceutical composition at a concentration of at most about 500nM, 250nM, 50nM, 25nM, 10nM, 5nM, 2.5nM, 1nM or less. In some embodiments, administration of the pharmaceutical composition provides each of these two peptides at a daily dosage of at most about 0.25 mg / kg host body weight, 0.1 mg / kg host body weight, 0.05 mg / kg host body weight, 0.025 mg / kg host body weight, 0.01 mg / kg host body weight, 0.005 mg / kg host body weight, 0.0025 mg / kg host body weight, 0.001 mg / kg host body weight, 0.0005 mg / kg host body weight, 0.00025 mg / kg host body weight or less.Depending on the average body weight of the subject (human or non-human animal, adult or juvenile), an appropriate amount (volume) of the composition is administered to the subject to achieve the desired total daily dosage described herein.Therefore, for example, an average body weight of 75 kg can be used to calculate the total amount of peptide for each daily administration for adult subjects or animals of similar weight. Similarly, average body weights of 60 kg, 50 kg, 40 kg, 30 kg, 20 kg, 15 kg, 10 kg, 7.5 kg, 5 kg or less may be used to calculate the total amount of peptide for each daily administration to non-adult or similar weight animals in different age groups (e.g., 15-18 years, 11-14 years, 7-10 years, 4-6 years, 2-3 years, 1-2 years, or younger age groups).

[0108] In some other embodiments, a pharmaceutical composition can contain one peptide (e.g., a PAR3-derived peptide) or derivative compound at a dosage that is much greater than the dosage of the other peptide (e.g., a PAR1-derived peptide) or derivative compound. For example, a composition to be administered to a subject can contain one peptide (e.g., a P3R or P3R variant or derivative) at a concentration of at least about 10 nM, 25 nM, 50 nM, 100 nM, 250 nM, 500 nM, 1 μM, 2.5 μM, 5 μM, 10 μM, 25 μM, or more. The other peptide (e.g., TR47 or TR47 variant or derivative) in such a composition can be at a concentration of at most about 500 nM, 250 nM, 50 nM, 25 nM, 10 nM, 5 nM, 2.5 nM, 1 nM, or less. In some of these embodiments, the dosage of one of the two peptides to be administered to a subject can be at least about 0.01 mg / kg, 0.025 mg / kg, 0.05 mg / kg, 0.1 mg / kg, 0.25 mg / kg, 0.5 mg / kg, 1 mg / kg, 2.5 mg / kg, 5 mg / kg, 10 mg / kg, 25 mg / kg, or more of host body weight per day. The dosage of the other peptide in the pharmaceutical composition for these embodiments can be at most about 0.25 mg / kg host body weight, 0.1 mg / kg host body weight, 0.05 mg / kg host body weight, 0.025 mg / kg host body weight, 0.01 mg / kg host body weight, 0.005 mg / kg host body weight, 0.0025 mg / kg host body weight, 0.001 mg / kg host body weight, 0.0005 mg / kg host body weight, 0.00025 mg / kg host body weight, or less per day. Again, the total amount of peptide in the composition for use in these embodiments can be determined according to the average body weight of the subject. For example, an average body weight of 75 kg can be used to calculate the total amount of peptide for each daily administration to an adult subject or an animal of similar weight.Similarly, average body weights of 60 kg, 50 kg, 40 kg, 30 kg, 20 kg, 15 kg, 10 kg, 7.5 kg, 5 kg or less may be used to calculate the total amount of peptide for each daily administration to non-adult or similar weight animals in different age groups (e.g., 15-18 years, 11-14 years, 7-10 years, 4-6 years, 2-3 years, 1-2 years, or younger age groups).

[0109] The pharmaceutical composition of the present invention can be prepared according to the method widely known and routinely practiced in the art.For example, see Goodman & Gilman's The Pharmacological Bases of Therapeutics, edited by Hardman et al., McGraw-Hill Professional (10th edition, 2001); Remington: The Science and Practice of Pharmacy, edited by Gennaro, Lippincott Williams & Wilkins (20th edition, 2003); Pharmaceutical Dosage Forms and Drug Delivery Systems, edited by Ansel et al., Lippincott Williams & Wilkins (7th edition, 1999); and Sustained and Controlled Release Drug Delivery Systems, edited by JR Robinson, Marcel Dekker, Inc., New York, 1978.Pharmaceutical composition is preferably manufactured under GMP conditions.

[0110] [Example] The following examples are provided to further illustrate the present invention, but not to limit its scope. Other variations of the present invention will be readily apparent to those skilled in the art and are encompassed by the appended claims.

[0111] [Example 1] Synergistic anti-inflammatory activity of PAR1- and PAR3-derived peptides We first observed that APC treatment reduced caspase-1 activity in PMA-differentiated human THP1 null cells treated with LPS and ATP (Figure 1A). APC exhibits biased signaling by cleaving PAR1 at the non-canonical residue Arg46, and TR47, a 20-amino acid peptide derived from PAR1 that mimics the novel N-terminus resulting from Arg46 cleavage, induces protective signaling in endothelial cells in vitro and reduces vascular leakage in vivo. TR47 at 50 μM was initially tested based on previously published in vivo data. We found that 50 μM TR47, as well as lower concentrations, similarly reduced caspase-1 activity, whereas scrambled TR47 or peptides (SFLLRN or TFLLRN) resembling the novel N-terminal amino acid sequence generated by thrombin cleavage of PAR3 at Arg41 had no effect on caspase-1 activity (Figure 1A). Protective signaling by APC can occur after PAR3 is cleaved at Arg41 in endothelial cells, and the PAR3-derived peptide P3R results in protective effects in vivo and reduced neutrophil extracellular trap formation in vitro. Similar to APC and TR47, the P3R peptide reduced caspase-1 activity. The control peptide P3K, a PAR3 peptide representing thrombin cleavage at Lys38, did not significantly alter caspase-1 activity in THP1 cells (Figure 1B).

[0112] We hypothesized that low concentrations of either TR47 or P3R are insufficient to exert anti-inflammatory activity by reducing caspase-1 activity, but that combining these two GPCR agonists might cooperatively reduce caspase-1 activity. When TR47 at less than 10 nM was incubated with THP1 cells in the presence of 500 nM P3R prior to the induction of caspase-1 activity, a reduction in caspase-1 activity was observed, in contrast to the effect of TR47 in the absence of P3R after normalization to caspase-1 inhibition conditions (Figure 1C & Figure 1D). Furthermore, when P3R at concentrations of 500 nM or less was incubated with 1 nM TR47, a significant reduction in normalized caspase-1 activity was observed, in contrast to P3R in the absence of TR47 (Figure 1E). Whether the intracellular signaling initiated by APC, TR47, P3R, or peptide combinations is similar or conserved across various human cell types remains to be resolved. The anti-inflammatory synergistic effects of TR47 and P3R suggest that PAR1 and PAR3 may exist as a heterodimeric GPCR complex within the interactome that promotes anti-inflammatory intracellular signaling. Linking these two GPCR agonist peptides may hold therapeutic promise in selected inflammatory diseases.

[0113] Further studies were conducted to further substantiate the observed synergistic activity. In these studies, additional variants of PAR peptides generated and shown to retain anti-inflammatory activity (FIGS. 4, 5, and 7A) were examined for retention of cooperativity for anti-inflammatory activity (FIG. 7), as shown for the combination of PAR1-derived TR47 and PAR3-derived P3R (FIGS. 1D-1E). As an example of such a study, the PAR3 peptide P3(51-65) (also known herein as peptide "P3R51-65"), which is anti-inflammatory alone at relatively high concentrations, e.g., 50 μM, is examined. When tested at concentrations of 0 to 16 nM in the presence or absence of 1 nM peptide P1(47-66) (also known as peptide "TR47"), only in the presence of 1 nM P1(47-66) was there a significant reduction in caspase-1 activity (Figure 7D), as observed for peptide P3(42-65) (also known as peptide "P3R" herein) (Figure 1E). These findings (Figures 7B-7D) indicate that various variants of PAR3 peptide ligands from the N-terminus, or varying the sequence or length, can result in a cooperative and synergistic anti-inflammatory response.

[0114] The data in Figures 7B-7D show that combinations of various PAR1- and PAR3-derived peptides result in enhanced anti-inflammatory activity compared to the anti-inflammatory activity of any single peptide used in a given combination tested. This highlights the value of combining various different PAR1- and PAR3-derived peptides relative to each peptide alone in terms of biological potency. These data demonstrate that various variants of the sequence or length of PAR peptides can be made and still result in a cooperative, synergistic anti-inflammatory response (Figures 1D-1E, and 7B-7D).

[0115] [Example 2] Mechanism of anti-inflammatory activity of PAR1- and PAR3-derived peptides NLRP3 is a canonical sensor protein central to inflammasome formation, and notably, mutations in NLRP3 lead to chronic autoinflammatory diseases in humans. 23 Inhibition of NLRP3 using NLRP3-deficient (defNLRP3) THP1 cells or the NLRP3 inhibitor MCC950 for THP1 null cells resulted in a significant reduction in caspase-1 activity across all treatments tested (Figures 2A and 2B). These data indicate that NLRP3 is required to generate caspase-1 activity, which is inhibited by APC, TR47, and P3R.

[0116] Due to the non-canonical biased signaling induced by APC, EPCR is a critical APC-binding cellular receptor required for the non-canonical cleavage of PAR1 and PAR3. Blocking EPCR with the anti-EPCR monoclonal antibody RCR-252 prior to APC or TR47 treatment resulted in a significant loss in their inhibition of caspase-1 activity, whereas P3R studies showed a trend toward loss, but not significance (Figure 2C). To examine whether PAR3 contributes to the anti-inflammatory effects of APC, TR47, and P3R, a blocking antibody was used to inhibit PAR3 prior to treatment. 16、26 Blockade of PAR3 highly significantly reduced the anti-inflammatory activity of APC and P3R, but less significantly reduced the activity of TR47 (Figure 2D). APC-initiated signaling through PAR1 is widely recognized as essential for its beneficial effects in many cell types. Blocking monoclonal antibodies (WEDE15 and ATAP2) or the small molecule antagonist of PAR1, SCH79797 (SCH) 17Inhibition of PAR1 with either SCH79797 or WEDE15 significantly inhibited APC-mediated reduction of caspase-1 activity (Figure 2E). The effect of TR47 was inhibited by SCH79797 and WEDE15, but not by ATAP2; however, the epitope of WEDE15 partially contains the TR47 sequence. None of these PAR1-targeting inhibitors statistically significantly reduced the anti-inflammatory activity of the PAR3 peptide agonist P3R (Figure 2E & F).

[0117] IL-1β is a key cytokine produced by the NLRP3 inflammasome. The production and release of IL-1β by THP1 cells subjected to the protocol described above for caspase-1 activity was significantly suppressed by APC, TR47, P3R, and the combination of TR47 and P3R (Figure 3). This confirms that these agents are anti-inflammatory based on the reduction of two widely recognized inflammatory biomarkers.

[0118] [Example 3] Structural requirements for the anti-inflammatory activity of PAR1- and PAR3-derived peptides To clarify the relationship between peptide sequence and activity, we next sought to test peptides of various lengths, starting from the N- or C-terminus. First, we used the previously described 13-mer P3Rmed (P3Rm). 16Starting with P3R, various P3R peptide variants were tested. At 50 μM, a significant reduction in caspase-1 activity was observed, similar to that observed with the 24-mer P3R (residues 42–65; 24-mer), and this effect was lost at 2 μM (Figure 4A–C). Subsequently, when the peptides were shortened from the N-terminus, both P3R 51–65 and P3R 51–59 exhibited a similar reduction in caspase-1 activity at 50 μM that was lost at 2 μM (Figure 4). Peptides further shortened by three or eight amino acids (P3R 54–59 or P3R 59–65, respectively) only partially reduced caspase-1 activity at 50 μM (Figure 4A). This suggests that the Phe,Pro,Phe sequence may be essential for anti-inflammatory activity (Fig. 4C) and that the cryptic N-terminus for PAR3 after APC-mediated cleavage may not be an essential signaling moiety, potentially challenging the PAR activation and signaling paradigm, at least for PAR3.

[0119] Next, we sought to define the sequence essential for mediating the TR47-mediated reduction in caspase-1 activity. Our initial experiments demonstrated that the previously published 9-mer of TR47 (NPNDKYEPF; SEQ ID NO: 36) reduced caspase-1 activity at 50 μM, similar to the 20-mer TR47 (Figure 5A). In contrast, when the N-terminus of TR47 was acylated, no reduction in caspase-1 activity was observed at equimolar concentrations, suggesting that the amine-free N-terminus may be essential for TR47-mediated anti-inflammatory activity. Next, we examined further C-terminally shortened TR47 peptides, including the previously published 8-mer TR47 (NPNDKYEP; SEQ ID NO: 35). These significantly reduced caspase-1 activity, similar to the 16-mer TR47. In contrast, the 6-mer TR47 lost its inhibitory activity, suggesting that peptides longer than six amino acids are required for the anti-inflammatory activity of PAR1 (Figure 5B). Next, we sought to test the paradigm that the N-terminal Asn (N) is required for the anti-inflammatory activity of TR47. When one amino acid was deleted from the N-terminus (TR47 N-1), caspase-1 activity was still reduced, whereas when two amino acids were removed (TR47 N-2), there was a loss in the inhibition of caspase-1 activity. Curiously, a decrease in caspase-1 activity was observed when five amino acids were removed from the N-terminus (TR47 N-5), suggesting that the hidden N-terminus of PAR1 after APC-mediated cleavage is not involved in any beneficial signaling effects (Figure 5B). Next, point mutation of the N-terminal residue 47 revealed that the N-terminal charge has a variable effect on the TR47-mediated reduction in caspase-1 activity. Mutations of N→Q (Asn to Gln, a longer carbon-carbon bond in the side chain) or N→A at TR47 yielded peptides that similarly reduced caspase-1 activity. However, mutation of N→D (Asn to Asp) at residue 47 resulted in loss of the reduction in caspase-1 activity (Figure 5B).Finally, a truncated TR peptide, TR48-54, in which both one amino acid from the N-terminus and part of the C-terminus were removed, did not reduce caspase-1 activity, suggesting that both a minimum length requirement for the peptide and potentially different internal recognition sequences are required for the full anti-inflammatory effect of TR47 observed (Figures 5B-C).

[0120] The synergistic anti-inflammatory activity of variant peptides was also investigated. Some exemplary results are shown in Figure 6. These include the synergistic effect observed when the PAR1-derived peptide TR47 was combined with the PAR3-derived peptide P3R variant P3Rm (Figure 6A), and the synergistic effect observed when the PAR1-derived peptide TR47 variant TR47(N-1) was combined with the PAR3-derived peptide P3R (Figure 6B).

[0121] [Example 4] Anti-inflammatory activity of PAR1 peptide / PAR3 peptide conjugates This example describes a study showing that covalent linkage of PAR1 and PAR3 peptides improves anti-inflammatory activity.

[0122] The PAR1 9-mer peptide P1(47-55) (residues 47-55; SEQ ID NO: 36) and the PAR3 peptide P3(51-65) (SEQ ID NO: 9) were used; each of these is anti-inflammatory alone at relatively high concentrations. To demonstrate the anti-inflammatory potency of covalently linked PAR1- and PAR3-derived peptides, a PAR1 / PAR3 fusion peptide ("G10") was generated by covalent linkage using a linker consisting of 10 glycine residues: NPNDKYEPFGGGGGGGGGGFPFSALEGWTGATIT (SEQ ID NO: 61). This fusion peptide, along with its two component peptides, was then tested for anti-inflammatory activity.

[0123] At the concentrations tested (0-500 nM), a significant decrease in caspase-1 activity in the presence of the "G10" peptide was observed at 2-20 nM, whereas neither the isolated PAR1-derived peptide nor the isolated PAR3-derived peptide had any anti-inflammatory effect at 200 nM (Figure 8). As expected, at relatively higher concentrations, the P1(47-55) peptide alone was anti-inflammatory at 500 nM (Figure 8).

[0124] These results further highlight the synergistic activity of the PAR1 and PAR3 agonist peptides: although each of these two peptides is independently anti-inflammatory, the combination is more potent than either peptide alone.

[0125] [Example 5] PAR1 / PAR3 fusion peptide promotes endothelial barrier stability This example describes studies showing that PAR1-derived peptides, PAR3-derived peptides, and a covalently linked PAR1 / PAR3 fusion peptide (the "G10" peptide) inhibit thrombin-induced disruption of the endothelial barrier.

[0126] A transendothelial electrical resistance (TER)-based assay was used to monitor the disruption of endothelial barrier integrity caused by thrombin. The anti-inflammatory vasoprotective effects of different PAR peptides on cultured endothelial cells (EA.hy926) to protect against thrombin-induced vascular leakage were tracked in real time using the iCELLigence instrument (ACEA Biosciences Inc, San Diego, CA). EA.hy926 cells at a density of 10,000 cells / well were pipetted into wells of a gold-plated microelectrode sensor (L8, Acea Biosciences). The increase in electrical resistance was then monitored while the cells grew and spread over the microelectrodes, covering the TER plate, which was connected to a recording instrument that detected changes in TER for each well in real time. The effects of different PAR-derived peptides at the indicated concentrations were examined for dose-response inhibition of the effect of thrombin when each of the peptide dilutions was added 30 min before thrombin addition (0.25 nM final in all wells). The percentage of inhibition was proportional to the increase in the TER signal over time. Cell index values, which reflect the TER signal, were normalized prior to thrombin addition according to the manufacturer's instructions.

[0127] Results from this study are shown in Figure 9. The results indicate that the heterobivalent PAR1:PAR3 agonist peptide, i.e., G10, exhibited remarkable potency for its ability to stabilize endothelial cell barrier integrity, similar to its potent anti-inflammatory activity manifested by its ability to reduce caspase-1 activity (Figure 8), with half-maximal activity observed at approximately 6 nM of the G10 peptide (SEQ ID NO: 61). In Figure 9, the G10 peptide was approximately 8-fold more potent than the long PAR1 peptide TR47 (e.g., compare the effect of G10 at 6 nM (Figure 9E) with the effect of PAR1 peptide P1(47-56) alone at 50 nM (Figure 9A)), and the G10 peptide (Figure 9E) was over 100-fold more effective at protecting endothelial barrier integrity than the PAR3 peptide P3(42-54) alone (Figure 9D). Another PAR3 peptide, namely P3(42-65), containing the sequence 47–55, did not have any significant effect when tested at 5–50 nM (Fig. 9B), compared to the highly significant effect of peptide G10 at 3–50 nM (Fig. 9E).

[0128] [Example 6] Some exemplary methods Caspase-1 assay. 1 × 10 THP1 null cells (wild-type cells) or NLRP3-deficient THP1 (defNLRP3) cells were cultured in a 2000-well plate. 6Cells were plated in 96-well plates at a final concentration of 1000 cells / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Various subsets of wells were selected, and cells were treated with various concentrations of APC, TR47, or P3R in serum-free RPMI at 37°C for 60 minutes. After a DPBS wash, cells were incubated with LPS (lipopolysaccharide) (1 μg / mL) in serum-free RPMI at 37°C for 3 hours to prime inflammasomes. After a DPBS wash, cells were incubated with ATP (5 mM) in the presence or absence of 10 μM YVAD (caspase-1 inhibitor) and 2.5 μM ZVAD (pan-caspase inhibitor) at 37°C for 45 minutes to fully activate caspase-1 activity. A caspase-1 activity assay was then performed according to the manufacturer's instructions (Promega). Caspase-1 activity was monitored as the change in luminescence resulting from substrate hydrolysis and reported as relative luminescence units (RLU). 15 In selected experiments, caspase-1 activity in experimental conditions was normalized to the YVAD (caspase-1 inhibitor) condition and expressed as normalized caspase-1 activity.

[0129] IL-1β ELISA. THP1 cells 1 × 10 6Cells were plated in 96-well plates at a final concentration of 1000kJ / mL and incubated with PMA (0.5 μM) in supplemented RPMI at 37°C for 3 hours. The medium was then changed every 24 hours for 3 days. Selected wells were treated with APC (4 μg / mL), TR47 (50 μM), P3R (50 μM), or a combination of TR47 and P3R (8 nM and 500 nM, respectively) for 1 hour. Cells were then washed with DPBS and subsequently incubated with LPS (1 μg / mL) in serum-free RPMI at 37°C for 3 hours. Cells were washed with DPBS and incubated with ATP (5 mM) for 45 minutes. Cell supernatants were carefully collected and frozen until assayed using an IL-1β Quantikine ELISA according to the manufacturer's instructions (R&D Systems). Absorbance was measured. The concentration of IL-1β was calculated after measurement of a standard curve according to the manufacturer's instructions.

[0130] Although the foregoing invention has been described in some detail by way of illustration and example for purposes of clarity of understanding, it will be readily apparent to those skilled in the art in light of the teachings of the invention that certain changes and modifications can be made without departing from the spirit or scope of the appended claims.

[0131] All publications, databases, GenBank sequences, patents, and patent applications cited herein are hereby incorporated by reference as if each was specifically and individually indicated to be incorporated by reference.

[0132] Some exemplified polypeptide sequences SEQ ID NO: 1. Human PAR3 MKALIFAAAG LLLLLPTFCQ SGMENDTNNL AKPTLPIKTF RGAPPNSFEE FPFSALEGWT GATITVKIKC PEESASHLHV KNATMGYLTS SLSTKLIPAI YLLVFVVGVP ANAVTLWMLF FRTRSICTTV FYTNLAIADF LFCVTLPFKI AYHLNGNNWV FGEVLCRATT VIFYGNMYCS ILLLACISIN RYLAIVHPFT YRGLPKHTYA LVTCGLVWAT VFLYMLPFFI LKQEYYLVQP DITTCHDVHN TCESSSPFQL YYFISLAFFG FLIPFVLIIY CYAAIIRTLN AYDHRWLWYV KASLLILVIF TICFAPSNII LIIHHANYYY NNTDGLYFIY LIALCLGSLN SCLDPFLYFL MSKTRNHSTA YLTK SEQ ID NO: 2. Human PAR3 Met 1 ~Arg 41 Deletion fragment GAPPNSFEE FPFSALEGWT GATITVKIKC PEESASHLHV KNATMGYLTS SLSTKLIPAI YLLVFVVGVP ANAVTLWMLF FRTRSICTTV FYTNLAIADF LFCVTLPFKI AYHLNGNNWV FGEVLCRATT VIFYGNMYCS ILLLACISIN RYLAIVHPFT YRGLPKHTYA LVTCGLVWAT VFLYMLPFFI LKQEYYLVQP DITTCHDVHN TCESSSPFQL YYFISLAFFG FLIPFVLIIY CYAAIIRTLN AYDHRWLWYV KASLLILVIF TICFAPSNII LIIHHANYYY NNTDGLYFIY LIALCLGSLN SCLDPFLYFL MSKTRNHSTA YLTK SEQ ID NO: 3 Human PAR3 Met 1 ~Arg 41 Deleted extracellular domain GAPPNSFEE FPFSALEGWT GATITVKIKC PEESASHLHV KNATMGYLTS SLST SEQ ID NO: 4. PAR3-derived peptide P3R (first 24 residues of SEQ ID NO: 3) GAPPNSFEE FPFSALEGWT GATIT SEQ ID NO: 5. Human PAR1 Met 1 ~Arg 46 Deletion fragment 47 NPND KYEPFWEDEE 61 KNESGLTEYR LVSINKSSPL QKQLPAFISE DASGYLTSSW LTLFVPSVYT 111 GVFVVSLPLN IMAIVVFILK MKVKKPAVVY MLHLATADVL 151 FVSVLPFKIS YYFSGSDWQF GSELCRFVTA AFYCNMYASI 191 LLMTVISIDR FLAVVYPMQS LSWRTLGRAS FTCLAIWALA 231 IAGVVPLLLK EQTIQVPGLN ITTCHDVLNE TLLEGYYAYY 271 FSAFSAVFFF VPLIISTVCY VSIIRCLSSS AVANRSKKSR ALFLSAAVFC 321 IFIICFGPTN VLLIAHYSFL SHTSTTEAAY FAYLLCVCVS SISCCIDPLI 371 YYYASSECQR YVYSILCCKE SSDPSSYNSS GQLMASKMDT 411 CSSNLNNSIY KKLLT SEQ ID NO: 6. Asn of human PAR1 47 ~Trp 100 (Met 1 ~Arg 46 Deleted extracellular domain) NPND KYEPFWEDEE KNESGLTEYR LVSINKSSPL QKQLPAFISE DASGYLTSSW SEQ ID NO: 7. Human PAR1-derived peptide TR47 (first 20 residues of SEQ ID NO: 6) NPND KYEPFWEDEE KNESGL

Claims

1. 1. A composition for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in a subject, comprising a PAR3-derived anti-inflammatory peptide and a PAR1-derived anti-inflammatory peptide, (1) The PAR3-derived anti-inflammatory peptide consists of the amino acid sequence represented by SEQ ID NO: 4 (P3R), SEQ ID NO: 8 (P3Rm or P3(42-54)), SEQ ID NO: 9 (P3R51-65 or P3(51-65)), or SEQ ID NO: 10 (P3R51-59 or P3(51-59)); and (2) The PAR1-derived anti-inflammatory peptide consists of the amino acid sequence represented by SEQ ID NO: 7 (TR47), SEQ ID NO: 35 (8-mer-TR47), SEQ ID NO: 36 (9-mer-TR47), SEQ ID NO: 43 (16-mer-TR47), SEQ ID NO: 47 (TR47 N-1), SEQ ID NO: 48 (TR47 N-5), SEQ ID NO: 49 (TR47ΔQ), or SEQ ID NO: 50 (TR47ΔA). The composition.

2. 2. The composition of claim 1, wherein the amount of the PAR3-derived peptide and the amount of the PAR1-derived peptide are in a ratio of at least about 2:1, 4:1, 6:1, 8:1, or 10:

1.

3. The composition of claim 1 , wherein the PAR3-derived peptide is conjugated to the PAR1-derived peptide.

4. The composition of claim 3 , wherein the PAR3-derived peptide is conjugated to the PAR1-derived peptide via a linker moiety or a carrier moiety.

5. The composition of claim 4 , wherein the carrier moiety is a carrier protein, an immunoglobulin, an Fc domain, or a PEG molecule.

6. The composition of claim 1, comprising (a) a PAR1-derived peptide comprising or consisting of the sequence shown in SEQ ID NO: 36, and (b) a PAR3-derived peptide comprising the sequence shown in SEQ ID NO: 9 or SEQ ID NO: 10, wherein (a) and (b) are linked via a peptide moiety.

7. 6. The composition of claim 5, comprising or consisting of the sequence set forth in SEQ ID NO:

61.

8. 10. The composition of claim 1, comprising a daily dosage of each of the two peptides of at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight or less, per average body weight of the subject group for which the composition is intended.

9. 10. The composition of claim 1, wherein: (1) one of said two peptides is administered in an amount of at most about 0.25 mg / kg average body weight, 0.1 mg / kg average body weight, 0.05 mg / kg average body weight, 0.025 mg / kg average body weight, 0.01 mg / kg average body weight, 0.005 mg / kg average body weight, 0.0025 mg / kg average body weight, 0.001 mg / kg average body weight, 0.0005 mg / kg average body weight, 0.00025 mg / kg average body weight, or less, per average body weight of a group of subjects for whom said composition is intended. and (2) a daily dosage of the other of the two peptides that is at least about 0.01 mg / kg average body weight, 0.025 mg / kg average body weight, 0.05 mg / kg average body weight, 0.1 mg / kg average body weight, 0.25 mg / kg average body weight, 0.5 mg / kg average body weight, 1 mg / kg average body weight, 2.5 mg / kg average body weight, 5 mg / kg average body weight, 10 mg / kg average body weight, 25 mg / kg average body weight or more per average body weight of a group of subjects for which the composition is intended.

10. 1. Use of an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1) and an anti-inflammatory peptide derived from protease-activated receptor-3 (PAR3) in the manufacture of a medicament for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in said subject, comprising: The PAR1-derived anti-inflammatory peptide consists of the amino acid sequence represented by SEQ ID NO:7 (TR47), SEQ ID NO:35 (8-mer-TR47), SEQ ID NO:36 (9-mer-TR47), SEQ ID NO:43 (16-mer-TR47), SEQ ID NO:47 (TR47 N-1), SEQ ID NO:48 (TR47 N-5), SEQ ID NO:49 (TR47ΔQ), or SEQ ID NO:50 (TR47ΔA); and The above-mentioned use, wherein the PAR3-derived anti-inflammatory peptide consists of the amino acid sequence represented by SEQ ID NO: 4 (P3R), SEQ ID NO: 8 (P3Rm or P3(42-54)), SEQ ID NO: 9 (P3R51-65 or P3(51-65)), or SEQ ID NO: 10 (P3R51-59 or P3(51-59)).

11. 10. The composition of any one of claims 1 to 9, wherein the inflammatory condition is selected from the group consisting of asthma, autoimmune diseases, chronic inflammation, chronic prostatitis, glomerulonephritis, hypersensitivity, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sterile inflammation, transplant rejection, virus-associated inflammation, and vasculitis.

12. The use of claim 10, wherein the inflammatory condition is selected from the group consisting of asthma, autoimmune diseases, chronic inflammation, chronic prostatitis, glomerulonephritis, hypersensitivity, inflammatory bowel disease, pelvic inflammatory disease, reperfusion injury, rheumatoid arthritis, sterile inflammation, graft rejection, viral-associated inflammation and vasculitis.

13. 12. The composition of any one of claims 1 to 9 and 11, wherein the subject is suffering from or suspected of having a condition involving unwanted immune activation or an unwanted immune response.

14. The use described in claim 10, wherein the subject is suffering from or suspected of having a condition involving unwanted immune activation or an unwanted immune response.

15. 14. The composition of claim 13, wherein the condition involving unwanted immune activation or an unwanted immune response is a neuropathological condition, a viral infection or malaria.

16. The use of claim 14, wherein the condition involving unwanted immune activation or an unwanted immune response is a neuropathological condition, a viral infection or malaria.

17. 10. The composition of any one of claims 1 to 9 for administration to a subject by oral, intravenous, parenteral, transdermal, subcutaneous, intraperitoneal, intramuscular, intracranial, intraorbital, intraventricular, intrapulmonary, intracisternal and intraspinal administration.

18. 17. The use according to any one of claims 10 and 16, wherein the medicament is for administration to a subject by oral, intravenous, parenteral, transdermal, subcutaneous, intraperitoneal, intramuscular, intracranial, intraorbital, intraventricular, intrapulmonary, intracisternal and intraspinal administration.

19. A composition for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in a subject, comprising an anti-inflammatory peptide derived from protease-activated receptor-3 (PAR3), wherein the PAR3-derived anti-inflammatory peptide consists of the amino acid sequence represented by SEQ ID NO:8 (P3Rm or P3(42-54)), SEQ ID NO:4 (P3R), SEQ ID NO:9 (P3R51-65 or P3(51-65)), or SEQ ID NO:10 (P3R51-59 or P3(51-59)). The composition.

20. 1. A composition for suppressing unwanted inflammation in a subject and / or treating an inflammatory condition in a subject, comprising an anti-inflammatory peptide derived from protease-activated receptor-1 (PAR1), The PAR1-derived anti-inflammatory peptide (1) consists of the amino acid sequence represented by SEQ ID NO: 36 (9-mer-TR47), SEQ ID NO: 47 (TR47 N-1), or SEQ ID NO: 48 (TR47 N-5), or (2) consists of the amino acid sequence represented by SEQ ID NO: 49 (TR47ΔQ) or SEQ ID NO: 50 (TR47ΔA), The composition.

Citation Information

Patent Citations

  • Protease-activated receptor 3 and its uses

    JP2001510988A

  • Modified par receptor, its preparation and its use in screening for par activity modulating compounds

    JP2005531311A

  • Protease activated receptor-1 (PAR1) derived cytoprotective polypeptides and related methods

    WO2013070256A2

  • Par3 mimetic peptides and uses thereof

    WO2017173346A1