Radiopharmaceutical compositions targeting glypican-3 and uses thereof

Radiopharmaceutical conjugates with GPC3-binding peptides and radionuclides address the limited efficacy of existing therapies by providing targeted treatment and diagnosis for GPC3-overexpressing tumors, enhancing therapeutic outcomes.

WO2024254339A9PCT designated stage expired Publication Date: 2025-10-16RAYZEBIO INC
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
PCT/US2024/032857
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-06-07
Filing Date
2024-06-06
Publication Date
2025-10-16

AI Technical Summary

Technical Problem

Current therapies targeting Glypican-3 (GPC3) expression in tumors, such as the GC33 antibody, have shown limited therapeutic efficacy in phase II clinical trials for hepatocellular carcinoma, highlighting the need for novel GPC3-binding peptides and compositions that can effectively target and treat GPC3-overexpressing cancers.

Method used

Development of radiopharmaceutical conjugates comprising peptides that bind specifically to GPC3, combined with a metal chelator and a radionuclide, to create targeted therapeutic and diagnostic agents for GPC3-overexpressing tumors.

Benefits of technology

The radiopharmaceutical conjugates provide enhanced therapeutic efficacy and diagnostic capabilities by specifically targeting GPC3-overexpressing tumors, offering potential for improved treatment outcomes in cancers like hepatocellular carcinoma.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2024032857_16102025_PF_FP_ABST
    Figure US2024032857_16102025_PF_FP_ABST
Patent Text Reader

Abstract

Provided herein are radiopharmaceuticals and conjugates, and compositions thereof targeting GPC3 and uses thereof. In one aspect, provided herein are conjugates that comprise a peptide with avidity to GPC3 and a metal chelator configured to bind with a radionuclide. The conjugates described herein can further comprise a linker connecting the chelator and the peptide. The conjugates described herein can further comprise a radionuclide. In one aspect, provided herein are radiopharmaceuticals that comprise a peptide and a metal chelator bound to a radionuclide. The conjugates described herein can further comprise a linker connecting the chelator and the peptide. Further provided herein are methods of treating cancer by administering the described radiopharmaceuticals, conjugates, compositions thereof.
Need to check novelty before this filing date? Find Prior Art

Description

RADIOPHARMACEUTICAL COMPOSITIONS TARGETING GLYPICAN-3 AND USES THEREOF CROSS REFERENCE TO RELATED APPLICATIONS

[0001] This application claims the benefit of U.S. Provisional Application No.63 / 506,721, filed on June 7, 2023, which is incorporated herein by reference in its entirety. JOINT RESEARCH AGREEMENT

[0002] Subject matter disclosed herein was developed, and the claimed invention was made by, or on behalf of, one or more parties to a Joint Research Agreement (JRA), within the meaning of 35 U.S.C. § 100(h) and 37 C.F.R. § 1.9(e), that was in effect on or before the effective filing date of the claimed invention. Said one or more parties to the JRA consist of PeptiDream, Inc. (Kanagawa, Japan) and RayzeBio, Inc. (San Diego, CA, U.S.A.). The claimed invention was made as a result of activities undertaken within the scope of said Joint Research Agreement. SEQUENCE LISTING

[0003] The present application contains a Sequence Listing which has been submitted electronically in .xml format as part of the specification and is incorporated herein by reference in its entirety. Said XML file, created on June 5, 2024, is named 59541-732_601_SL.xml, and is 689,382 bytes in size. TECHNICAL FIELD

[0004] In one aspect, the present disclosure relates to radiopharmaceutical conjugates comprising peptides that bind to Glypican-3 (GPC3) and to compositions comprising such radiopharmaceutical conjugates and uses thereof. In one aspect, the present disclosure relates to the use of said radiopharmaceutical conjugates in preventing, suppressing or treating a disease or disorder characterized by either overexpression or decreased expression of GPC3 in diseased tissue, such as in a tumor when GPC3 is overexpressed. BACKGROUND

[0005] Glypican-3 (GPC3) is a heparan sulfate (HS) glycoprotein, belonging to the sulfate heparan proteoglycan family, and which is anchored on the cell membrane surface by phosphatidylinositol (GPI) anchor. The GPC3 core protein comprises 580 amino acids, with a molecular weight of about 70 kDa. It is cut by furin (Furin), generating a 40 kDa N-terminal subunit and a 30 kDa C-terminal subunit, connected to each other by a disulfide bond. GPC3’s two HS side chain is combined at the position close to the C end (Takahiro Nishida, Hiroaki Kataoka. Glypican 3-Targeted Therapy in Hepatocellular Carcinoma, Cancer 2019; 11 (9): 1339).

[0006] GPC3 can play an important role in the cell proliferation of embryo layer tissue. Deletion of GPC3 gene can cause excessive growth syndrome, namely Simpson-Golabi-Behmel syndrome (SGBS). GPC3 can be clearly expressed throughout the entire fetal stage, and after birth to adult stage, except forplacental, breast, mesodermal, ovarian, lung and kidney tissue with weak expression, other normal tissues have no obvious expression.

[0007] Abnormal GPC3 expression has been found in multiple tumour tissues of adult, such as hepatocellular carcinoma (HCC), lung squamous carcinoma, gastric cancer, ovarian cancer and so on. Especially highly expressed in HCC cells, GPC3 improves autocrine / paracrine canonical Wnt signal transmission, and promotes growth and invasion of HCC cells (Capurro MI, Xiang Y-Y, Lobe C, Filmus J. Glypican-3 promotes the growth of hepatocellular carcinoma by-stimulating canonical Wnt signaling; Cancer Res 2005, 65(14): 6245-54.). Immunohistochemical staining detection shows that about 70% of HCC patient tumor tissue exhibits high GPC3 protein expression (Capurro M, Wanless IR, Sherman M, et al. Glypican-3: a novel serum and histochemical marker for hepatocellular carcinoma; Gastroenterology 2003, 125(1) :89-97). Thus, GPC3 is considered as a candidate target for tumor treatment.

[0008] Codrituzumab (also known as GC33 antibody) is a recombinant humanized monoclonal antibody developed in Japan by Chugai Pharmaceutical Co., which binds to the region of GPC3 protein proximal membrane end. GC33 antibody targets GPC3 positive HCC cells, and can generate antibody dependent cell toxicity (ADCC). In phase I clinical trials, Codrituzumab shows good immune tolerance. The HCC patient can generate an anti-tumour effect (Ikeda M, Ohkawa S, Okusaka T, et al. Japanese phase I study of GC33, a-antibody against glypican-3 for advanced hepatocellular carcinoma. Cancer Sci.2014, 105, 455-462). However, in the phase II clinical trial with 185 late-stage liver cancer patients, the therapeutic efficacy of Codrituzumab was not impressive compared with the control group.

[0009] Therefore, novel GPC3-binding peptides and compositions comprising the GPC3-binding peptide are both useful and desired. SUMMARY

[0010] In one aspect, disclosed herein is a radiopharmaceutical or a pharmaceutically acceptable salt thereof, the radiopharmaceutical comprising: (a) a peptide of Formula (I-1),wherein: R1is -NH2or -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4;each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis -S-, -CH2-, or -O-; X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring, or cycloalkyl or heterocycloalkyl group, or X5 is a peptoid; X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted; X8 is A, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G or A, or an N-alkylated variant thereof, or a D-amino acid; and X11 is an amino acid comprising an aromatic ring; and (b) a metal chelator bound to a radionuclide, wherein the metal chelator is covalently attached to the peptide.

[0011] In some embodiments, the radiopharmaceutical is selected from Table 3A or Table 3B.

[0012] In one aspect, disclosed herein is a conjugate or a pharmaceutically acceptable salt thereof, the conjugate comprising: (a)a peptide of Formula (I-1),wherein: R1is -NH2or -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4;each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis -S-, -CH2-, or -O-; X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring, or cycloalkyl or heterocycloalkyl group, or X5 is a peptoid; X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted; X8 is A, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G or A, or an N-alkylated variant thereof, or a D-amino acid; and X11 is an amino acid comprising an aromatic ring; and (b) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is covalently attached to the peptide.

[0013] In some embodiments, the conjugate is selected from Table 9.

[0014] In one aspect, the present disclosure relates to a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence including deletion, substitution, and / or addition of one or several (e.g., 1-6) amino acids in the amino acid sequence of SEQ ID NO: 1: MeK-MeI-D-MeQ-F4COO-I-I-Y-MeNal27N-G-3Py6Ph-MeC (SEQ ID NO: 1), wherein the peptide consists of 10 to 12 amino acid residues; and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0015] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the radiopharmaceutical conjugate comprises a radionuclide bound to the metal chelator. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide. In some embodiments, the peptide is a cyclic peptide. In some embodiments, the peptide is a monocyclic peptide.

[0016] In one aspect, the present disclosure relates to a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I), X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12Formula (I) wherein, X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring (e.g., W, F, Y, or a variant thereof), cycloalkyl, or heterocycloalkyl group, or X5 is a peptoid (e.g., Cha4cH, Cha4tH, A1mor, Atp, Cha4cOMe); X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted (e.g., X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg); X8 is a, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G, A, or a D-amino acid (e.g., da, ds, de, or dp); X11 is an amino acid comprising an aromatic ring (e.g., F, Y, or a variant thereof); and, X12 is N-alkylated cysteine (e.g., MeC); and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0017] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide. In some embodiments, the peptide is a monocyclic peptide. In some embodiments, the peptide has an amino acid sequence according to Formula (I), or a pharmaceutically acceptable salt thereof, X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein, X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa, MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb); X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa;X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, KAc, Hgn, MeY, or DapCOpipzaa; X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa; X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, Yae, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa; X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe; X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg; X8 is A, I, L, V, Y, F4OMe, F4COO, F4OEt, F4u, F4Me, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa; X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeW7N, MeF3C4Me, or MeF3Me4C; X10 is G, A, or a D-amino acid (e.g., da, ds, de, or dp); X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, or F4CONdMe; and X12 is MeC.

[0018] In one aspect, the present disclosure relates to a radiopharmaceutical conjugate comprising: (a) a peptide having avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide has an amino acid sequence of Formula (I), X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein, X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid;X5 iswherein: Rn5is hydrogen or C1-3alkyl; ring A5 is an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl; each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX5-heterocycloalkyl, -LX5-cycloalkyl, -LX5-aryl, or -LX5-heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O, =S, or =N(Ra); LX5is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa- , wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a; kx5 is 0, 1, 2, or 3; mx5 is 0, 1, 2, 3, 4, or 5; *X4 represents the point of attachment to X4; and *X6 represents the point of attachment to X6; X6 iswherein; Rn6is hydrogen or C1-3alkyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX6- heterocycloalkyl, -LX6-cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; or Rn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a; LX6is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a;*X5 represents the point of attachment to X5; and *X7 represents the point of attachment to X7; X7 iswherein: Rn7is hydrogen or C1-3alkyl ; RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, cycloalkyl, or heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a; *X6 represents the point of attachment to X6; and *X8 represents the point of attachment to X8; X8 iswherein; Rn8is hydrogen or C1-3alkyl; ring A8 is an aryl or heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX8-heterocycloalkyl, -LX8-cycloalkyl, -LX8-aryl, or -LX8-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O, =S, or =N(Ra); LX8is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a; kx8 is 0, 1, 2, or 3; mx8 is 0, 1, 2, 3, 4, or 5; *X7 represents the point of attachment to X7; and*X9 represents the point of attachment to X9; X9 is, wherein: Rn9is hydrogen or C1-3alkyl; ring A9 is an aryl or heteroaryl; each RX9is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O, =S, or =N(Ra); kx9 is 0, 1, 2, or 3; mx9 is 0, 1, 2, 3, 4, or 5; *X8 represents the point of attachment to X8; and *X10 represents the point of attachment to X10; X10 is glycine or a D-amino acid (e.g., da, ds, de, or dp); X11 iswherein: Rn11is hydrogen or C1-3alkyl; ring A11 is an aryl or heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX11- heterocycloalkyl, -LX11-cycloalkyl, -LX11-aryl, or -LX11-heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O, =S, or =N(Ra); LX11is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a;kx11 is 0, 1, 2, 3, 4, or 5; mx11 is 0, 1, 2, 3, 4, or 5; *X10 represents the point of attachment to X10; and, *X12 represents the point of attachment to X12; X12 is N-alkylated cysteine; each of RX5a, RX6a, RX7a, RX8a, RX9a, and RX11ais independently halogen, C1-6alkyl, C1- C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2- C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, - S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, - NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, - NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), - P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re. each Rais independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; each Reis independently halogen, -CN, -OH, -O-C1-C6alkyl, -SF5, -S(=O)C1-C6alkyl, - S(=O)2C1-C6alkyl, -S(=O)2NH2, -S(=O)2-halogen, -S(=O)2NHC1-C6alkyl, - S(=O)2N(C1-C6alkyl)2, -NH2, -NHC1-C6alkyl, -N(C1-C6alkyl)2, -NHC(=NH)NH2, - NHC(=O)OC1-C6alkyl, -C(=O)C1-C6alkyl, -C(=O)OH, C1-C6alkyl-C(=O)OH, - C(=O)OC1-C6alkyl, -C(=O)NH2, -C(=O)N(C1-C6alkyl)2, -C(=O)NHC1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, or C1-C6heteroalkyl; or two Reare taken together to form =O; and each Rcand Rdare independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; or Rcand Rdare taken together with the atom to which they are attached to form a heterocycloalkyl optionally substituted with one or more Re; and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0019] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide. In some embodiments, thepeptide is a monocyclic peptide.

[0020] In some embodiments of the radiopharmaceutical conjugate, the peptide of Formula (I) has a structure of Formula (I-1):wherein, R1is selected from the group consisting of -NH2and -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis selected from the group consisting of -S-, -CH2-, or -O-; and wherein X1 to X11 have the definitions described in Formula (I).

[0021] In some embodiments of the radiopharmaceutical conjugate, the peptide of Formula (I) has a structure of Formula (I-2):

[0022] In some embodiments, the radiopharmaceutical conjugate comprises a peptide having an amino acid sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 1-72 or a sequence with up to 1, 2, 3, 4, or 5 substitutions by a conserved variant compared to any one of the sequences selected from SEQ ID NOs: 1-72. In some embodiments, the radiopharmaceutical conjugate comprises a peptide having an amino acid sequence with up to 1, 2, 3, 4, or 5 substitutions by a conserved variant compared to any one of the sequences selected from SEQ ID NOs: 1-72. In some embodiments, the radiopharmaceutical conjugate comprises a peptide having an amino acid sequence that is at least 90% identical to a sequence selected from SEQ ID NOs: 1-72. In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72.

[0023] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal ch l t r is bound to the peptide of Formula (I) or SEQ IDNO: 1. In some embodiments, the radiopharmaceutical conjugate further comprises a linker that connects a peptide with a metal chelator. In some embodiments, the linker is attached to the peptide via a non- terminal amino acid residue of the peptide. In some embodiments, the linker is attached to the peptide via the N terminus of the peptide. In some embodiments, the linker is attached to the peptide via the C terminus of the peptide. In some embodiments, the linker is attached to the 1stamino acid residue (or X1), the 2ndamino acid residue (or X2), the 3rdamino acid residue (or X3), the 4thamino acid residue (or X4), the 8thamino acid residue (or X8), or the 12thamino acid residue (or X12). In some embodiments, the linker comprises 3 to 30 intervening non-hydrogen, organic atoms between the metal chelator and the peptide. In some embodiments, the linker comprises one or more amino acid residues. In some embodiments, the linker is a bond. In some embodiments, the metal chelator comprises DOTA, DOTA- GA, pBn-DOTA, pBn-SCN-DOTA, NH2-DOTA, NH2-DOTA-GA, p-NCS-Bn-DOTA-GA, p-NH2-Bn- oxo-DO3A, p-SCN-Bn-oxo-DO3A, NOTA, NODA-GA, NH2-NODA-GA, p-NCS-Bn-NODA-GA, p- NH2-Bn-NOTA, p-SCN-Bn-NOTA, NCS-MP-NODA, NH2-MPAA-NODA, PCTA, p-NH2-Bn-PCTA, p-SCN-Bn-PCTA, p-SCN-Bn-HEHA, H2-MACROPA-NCS, H1-MACROPA, H2-MACROPA-NH2, H4-OCTAPA, tetra-(S, S, S, S)-Me-DOTA, tetra-(S, S, S, S)-Et-DOTA, tetra-(S, S, S, S)-iBu-DOTA, or maleimide-nBu-DOTA. In some embodiments, the metal chelator has a structure ofIn some embodiments, the radiopharmaceutical conjugate further comprises a radionuclide bound to the metal chelator. In some embodiments, the radionuclide is an alpha particle-emitting radionuclide. In some embodiments, the alpha particle-emitting radionuclide is Ac-225, Bi-213, Bi-209, Tb-149, Ra-223, Th-227, Fr-223, Gd-148, Th-229, Pb-212, or Po-213. In some embodiments, the alpha particle-emitting radionuclide is Ac-225. In some embodiments, the radionuclide is a beta particle-emitting radionuclide. In some embodiments, the beta particle-emitting radionuclide is Cu-67, Lu-177, Y-90, Rh-105, Yb-175, Tm-167, Pm-153, Sm-153, or In-111. In some embodiments, the beta particle-emitting radionuclide is lutetium-177. In some embodiments, the radionuclide is a positron- emitting radionuclide. In some embodiments, the positron-emitting radionuclide is Ga-68, Cu-62, Cu-64, Zr-89, Tb-152.

[0024] In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide, wherein the radionuclide is bound to the peptide of Formula (I) or SEQ ID NO: 1. In some embodiments, the radiopharmaceutical conjugate further comprises a linker that connects a peptide with the covalently bound radionuclide. In some embodiments, the radionuclide is covalently bound to an amino acid comprising an aromatic ring. In some embodiments, the radionuclide is attached to the 5thamino acid or X5, the 8thamino acid or X8, the 9thamino acid or X9, or the 11thamino acid or X11. In some embodiments, the radionuclide is covalently bound to a residualizing agent attached to the peptide,wherein the residualizing agent has the structure of:wherein R* is the covalently bound radionuclide. In some embodiments, the covalently bound radionuclide is18F,74As,76Br,123I,124I,125I,131I, or211At.

[0025] In one aspect, the present disclosure relates to a pharmaceutical composition comprising a radiopharmaceutical conjugate, or a pharmaceutically acceptable salt thereof, as described herein , a pharmaceutically acceptable excipient or carrier. In one aspect, the present disclosure relates to a pharmaceutical composition comprising a radiopharmaceutical or pharmaceutically acceptable salt thereof, as described herein, and a pharmaceutically acceptable excipient or carrier.

[0026] In one aspect, the present disclosure relates to a method of treating a disease or disorder characterized by overexpression of glypican 3 (GPC3) in a subject in need of treatment, the method comprising administering to the subject a therapeutically effective amount of a radiopharmaceutical or pharmaceutically acceptable salt thereof, as described herein, or a pharmaceutical composition as described herein. In one aspect, the present disclosure relates to a method of treating a disease or disorder characterized by overexpression of GPC3 in a subject in need of treatment, the method comprising: administering to the subject a first radiopharmaceutical or pharmaceutically acceptable salt thereof; and administering to the subject a therapeutically effective amount of a second radiopharmaceutical or pharmaceutically acceptable salt thereof, wherein: the first radiopharmaceutical or pharmaceutically acceptable salt thereof is described herein, and wherein the radionuclide is a diagnostic radionuclide; and the second radiopharmaceutical or pharmaceutically acceptable salt thereof is described herein, and wherein the radionuclide is a therapeutic radionuclide. In one aspect, the present disclosure relates to a method of diagnosing a disease or disorder characterized by overexpression of GPC3 in a subject in need thereof, comprising administering to the subject a radiopharmaceutical or pharmaceutically acceptable salt thereof, or pharmaceutical composition as described herein; and imaging the subject, thereby determining expression level of GPC3 in the subject, wherein the radionuclide is suitable for use as an imaging isotope. In one aspect, the present disclosure relates to a method of treating a disease or disorder characterized by overexpression of GPC3, in a subject in need of treatment, the method comprising administering to the subject the radiopharmaceutical conjugate or pharmaceutically acceptable salt thereof as described herein. In some embodiments, the disease or disorder is cancer. In some embodiments, the cancer is selected from hepatocellular carcinoma, squamous cell carcinoma of the lung, lung adenocarcinoma, germ cell tumors, hepatoblastoma, wilms tumor, malignant rhabdoid tumors, rhabdomyosarcoma, liposarcoma, thyroid cancers, pancreatic cancer, small bowel cancer, small cell neuroendocrine carcinoma (SCNC), hormonally treated, castration resistant prostatic adenocarcinoma, ovarian cancer, gastric cancer, esophageal carcinoma and malignant melanoma.

[0027] In one aspect, the present disclosure relates to a kit, tester, or composition for determining the expression level of GPC3 in a sample, wherein the kit, tester, or composition comprises the radiopharmaceutical or conjugate or pharmaceutically acceptable salt thereof as described herein. In some embodiments, the kit, tester, or composition is adapted for use in a method of diagnosing a disease or disorder characterized by an overexpression or a decreased expression of GPC3. In some embodiments, the sample is from a subject suspected of having a disease or disorder characterized by an overexpression or a decreased expression of GPC3.

[0028] In one aspect, the present disclosure relates to the use of the radiopharmaceutical, or conjugate, or pharmaceutically acceptable salt thereof as described herein in the manufacture of a medicament for diagnosing and / or treating a disease or disorder characterized by an overexpression or a decreased expression of GPC3.

[0029] In one aspect, the present disclosure relates to the use of the radiopharmaceutical, or conjugate, or pharmaceutically acceptable salt thereof as described herein for use in diagnosing and / or treating a disease or disorder characterized by an overexpression or a decreased expression of GPC3. INCORPORATION BY REFERENCE

[0030] All publications, patents, and patent applications mentioned in this specification are herein incorporated by reference for the specific purposes identified herein. BRIEF DESCRIPTION OF THE DRAWINGS

[0031] All features of embodiments which are described in this disclosure are not mutually exclusive and can be combined with one another. For example, elements of one embodiment can be utilized in the other embodiments without further mention. A detailed description of specific embodiments is provided herein below with reference to the accompanying drawings in which:

[0032] FIG.1 illustrates a flow chart of HepG2 cells, which have GPC3 on the cell surface, stained with biotinylated peptides followed by Streptavidin, R-Phycoerythrin Conjugate.

[0033] FIG.2 illustrates a flow chart of Huh-7 cells, which have GPC3 on the cell surface, stained with biotinylated peptides followed by Streptavidin, R-Phycoerythrin Conjugate.

[0034] FIG.3 illustrates a flow chart of SK-Hep1 cells, which was a negative control cell line, stained with biotinylated peptides followed by Streptavidin, R-Phycoerythrin Conjugate.

[0035] FIG.4A illustrates exemplary metal chelators of the present disclosure, wherein represents the attachment point of a metal chelator to the remaining conjugate. FIG. 4B illustrates the same metal chelators as FIG. 4A, except that a part of the linker or the peptide covalently connected to the metal chelator is shown in the dashed circle

[0036] FIG.5A illustrates exemplary metal chelators of the present disclosure, wherein represents the attachment point of a metal chelator to the remaining conjugate. FIG. 5B illustrates the same metal chelators as FIG. 5A, except that a part of the linker or the peptide covalently connected to the metal chelator is shown in the dashed circle

[0037] FIG.6A illustrates exemplary metal chelators of the present disclosure, whereinrepresents the attachment point of a metal chelator to the remaining conjugate. FIG. 6B illustrates the same metal chelators as FIG. 6A, except that a part of the linker or the peptide covalently connected to the metal chelator is shown in the dashed circle

[0038] FIG.7A illustrates exemplary metal chelators of the present disclosure, whereinrepresents the attachment point of a metal chelator to the remaining conjugate. FIG. 7B illustrates the same metal chelators as FIG. 7A, except that a part of the linker or the peptide covalently connected to the metal chelator is shown in the dashed circle

[0039] FIG. 8 illustrates the structures of representative metal chelators.

[0040] FIG. 9 illustrates the structures of representative metal chelators.

[0041] FIG. 10 illustrates the structures of representative metal chelators.

[0042] FIG. 11 illustrates the structures of representative metal chelators.

[0043] FIG. 12 illustrates the structures of representative metal chelators.

[0044] FIG. 13 illustrates the structures of representative metal chelators.

[0045] FIG. 14 illustrates the structures of representative metal chelators.

[0046] FIG. 15 illustrates the structures of representative metal chelators.

[0047] FIG. 16 illustrates the structures of representative metal chelators.

[0048] FIG. 17 illustrates the structures of representative metal chelators.

[0049] FIG. 18 illustrates the structures of representative metal chelators.

[0050] FIG. 19 illustrates the structures of representative metal chelators.

[0051] FIG. 20 illustrates the structures of representative metal chelators.

[0052] FIG. 21 illustrates the structures of representative metal chelators.

[0053] FIG. 22 illustrates the structures of representative metal chelators.

[0054] FIG.23A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-45), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0055] FIG.23B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-45), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0056] FIG.23C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-45), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0057] FIG.24A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-30), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0058] FIG.24B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-30), or a negative control,followed by Streptavidin, R-Phycoerythrin Conjugate.

[0059] FIG.24C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-30), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0060] FIG.25A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-1), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0061] FIG.25B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-1), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0062] FIG.25C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (PLD-1), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0063] FIG.26A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-3), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0064] FIG.26B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-3), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0065] FIG.26C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-3), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0066] FIG.27A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-5), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0067] FIG.27B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-5), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0068] FIG.27C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-5), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0069] FIG.28A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-6), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0070] FIG.28B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-6), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0071] FIG.28C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface,stained with a biotinylated GPC3-binding peptide of the invention (Mod-6), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0072] FIG.29A illustrates a flow chart of SK-Hep1 cells, which do not have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-7), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0073] FIG.29B illustrates a flow chart of Huh-7 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-7), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate.

[0074] FIG.29C illustrates a flow chart of HepG2 cells, which have GPC3 expression on the cell surface, stained with a biotinylated GPC3-binding peptide of the invention (Mod-7), or a negative control, followed by Streptavidin, R-Phycoerythrin Conjugate. DETAILED DESCRIPTION

[0075] It should be understood that both the general descriptions and the detailed description below are merely illustrative and descriptive and do not limit the present technology of the present application. Those of skill in the art will recognize that there are numerous variations and modifications of this present disclosure, which are encompassed within its scope.

[0076] Although various features of the present disclosure may be described in the context of a single embodiment, the features may also be provided separately or in any suitable combination. Conversely, although the present disclosure may be described herein in the context of separate embodiments for clarity, the present disclosure may also be implemented in a single embodiment.

[0077] The headings used in the present specification are for structural purposes only and must not be construed as limiting the subject matter described.

[0078] In the present specification, the use of the singular form includes the plural form unless otherwise specified. In the present specification, the use of “or (or)” means “and / or (and / or)” unless otherwise stated. Furthermore, terms such as “element” or “component” encompass both an element and a component including one unit and an element and a component including two or more subunits unless when otherwise specified.

[0079] The recitation herein of numerical ranges by endpoints is intended to include all numbers subsumed within that range (e.g., a recitation of 1 to 5 includes 1, 1.5, 2, 2.75, 3, 3.80, 4, 4.32, and 5).

[0080] All terms are intended to be understood as they would be understood by a person skilled in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the disclosure pertains.

[0081] The following definitions supplement those in the art and are directed to the current application and are not to be imputed to any related or unrelated case, e.g., to any commonly owned patent or application. Although any methods and materials similar or equivalent to those described herein can be used in the practice for testing of the present disclosure, the preferred materials and methods are described herein. Accordingly, the terminology used herein is for the purpose of describing particular embodimentsonly, and is not intended to be limiting. I. Definitions

[0082] As used herein and in the appended claims, the singular forms “a,” “an,” and “the” include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to “an agent” includes a plurality of such agents, and reference to “the cell” includes reference to one or more cells (or to a plurality of cells) and equivalents thereof known to those skilled in the art, and so forth. When ranges are used herein for physical properties, such as molecular weight, or chemical properties, such as chemical formulae, all combinations and subcombinations of ranges and specific embodiments therein are intended to be included.

[0083] The term “about” or “approximately” can mean within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within 1 or more than 1 standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to 20%, up to 15%, up to 10%, up to 5%, or up to 1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, within 5- fold, or within 2-fold, of a value.

[0084] As used herein, the term “conjugate” is used interchangeably with “radiopharmaceutical conjugate”. A conjugate described herein may comprise a radionuclide. In some embodiments, a conjugate described herein does not comprise a radionuclide.

[0085] As used herein, the term “radiopharmaceutical” refers to a conjugate comprising a radionuclide. In some embodiments, the radionuclide is a covalently bound to the conjugate. In some embodiments, the radionuclide is bound to the conjugate through a metal chelator.

[0086] The term “comprising” (and related terms such as “comprise” or “comprises” or “having” or “including”) are to be construed in an open, inclusive sense, that is, as “including, but not limited to.” The term “comprising” (and related terms such as “comprise” or “comprises” or “having” or “including”) is not intended to exclude that in other certain embodiments, for example, an embodiment of any composition of matter, composition, method, or process, or the like, described herein, “consist of” or “consist essentially of” the described features.

[0087] "Amino" refers to the –NH2radical.

[0088] "Cyano" refers to the -CN radical.

[0089] "Nitro" refers to the -NO2radical.

[0090] "Oxo" refers to the =O radical.

[0091] "Imino" refers to the =N-H radical.

[0092] "Oximo" refers to the =N-OH radical.

[0093] "Hydrazino" refers to the =N-NH2radical.

[0094] “Hydroxy” or “hydroxyl” refers to the -OH radical.

[0095] “Hydroxyamino” refers to the -NH-OH radical.

[0096] “Acyl” refers to a substituted or unsubstituted alkylcarbonyl, substituted or unsubstituted alkenylcarbonyl, substituted or unsubstituted alkynylcarbonyl, substituted or unsubstituted cycloalkylcarbonyl, substituted or unsubstituted heterocycloalkylcarbonyl, substituted or unsubstituted arylcarbonyl, substituted or unsubstituted heteroarylcarbonyl, amide, or ester, wherein the carbonyl atom of the carbonyl group is the point of attachment. Unless stated otherwise specifically in the specification, an alkylcarbonyl group, alkenylcarbonyl group, alkynylcarbonyl group, cycloalkylcarbonyl group, amide group, or ester group is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like.

[0097] “Alkyl” refers to an optionally substituted straight-chain, or optionally substituted branched- chain saturated hydrocarbon monoradical. An alkyl group can have from one to about twenty carbon atoms, from one to about ten carbon atoms, or from one to six carbon atoms. Examples include, but are not limited to, methyl, ethyl, n-propyl, isopropyl, 2-methyl-1-propyl, 2-methyl-2-propyl, 2-methyl-1-butyl, 3-methyl- 1-butyl, 2-methyl-3-butyl, 2,2-dimethyl-1-propyl, 2-methyl-1-pentyl, 3-methyl-1-pentyl, 4-methyl-1- pentyl, 2-methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 2,2-dimethyl-1-butyl, 3,3-dimethyl-1- butyl, 2-ethyl-1-butyl, n-butyl, isobutyl, sec-butyl, t-butyl, n-pentyl, isopentyl, neopentyl, tert-amyl, and hexyl, and longer alkyl groups, such as heptyl, octyl, and the like. Whenever it appears herein, a numerical range such as “C1-C6alkyl” means that the alkyl group consists of 1 carbon atom, 2 carbon atoms, 3 carbon atoms, 4 carbon atoms, 5 carbon atoms or 6 carbon atoms, although the present definition also covers the occurrence of the term “alkyl” where no numerical range is designated. In some embodiments, the alkyl is a C1-C10alkyl, a C1-C9alkyl, a C1-C8alkyl, a C1-C7alkyl, a C1-C6alkyl, a C1-C5alkyl, a C1-C4alkyl, a C1- C3alkyl, a C1-C2alkyl, or a C1alkyl. Unless stated otherwise specifically in the specification, an alkyl group is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, the alkyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, -NO2, or -C≡CH. In some embodiments, the alkyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or -OMe. In some embodiments, the alkyl is optionally substituted with halogen.

[0098] “Alkylene” refers to a straight or branched divalent hydrocarbon chain. Unless stated otherwise specifically in the specification, an alkylene group may be optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, an alkylene is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, an alkylene is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or -OMe. In some embodiments, the alkylene is optionally substituted with halogen. In some embodiments, the alkylene is -CH2-, -CH2CH2-, -CH2CH2CH2-, or -CH2CH(CH3)CH2-. In some embodiments, the alkylene is -CH2-. In some embodiments, the alkylene is -CH2CH2-. In some embodiments, the alkylene is -CH2CH2CH2-.

[0099] “Alkenyl” refers to an optionally substituted straight-chain, or optionally substituted branched- chain hydrocarbon monoradical having one or more carbon-carbon double-bonds. In some embodiments, an alkenyl group has from two to about ten carbon atoms, or two to about six carbon atoms. The groupmay be in either the cis or trans configuration about the double bond(s), and should be understood to include both isomers. Examples include, but are not limited to, ethenyl (-CH=CH2), 1-propenyl (-CH2CH=CH2), isopropenyl [-C(CH3)=CH2], butenyl, 1,3-butadienyl, and the like. Whenever it appears herein, a numerical range such as “C2-C6alkenyl” means that the alkenyl group may consist of 2 carbon atoms, 3 carbon atoms, 4 carbon atoms, 5 carbon atoms, or 6 carbon atoms, although the present definition also covers the occurrence of the term “alkenyl” where no numerical range is designated. In some embodiments, the alkenyl is a C2-C10alkenyl, a C2-C9alkenyl, a C2-C8alkenyl, a C2-C7alkenyl, a C2-C6alkenyl, a C2-C5alkenyl, a C2-C4alkenyl, a C2-C3alkenyl, or a C2alkenyl. Unless stated otherwise specifically in the specification, an alkenyl group is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, an alkenyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, or - NO2. In some embodiments, an alkenyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or - OMe. In some embodiments, the alkenyl is optionally substituted with halogen.

[0100] The term “alkenylene” or “alkenylene chain” refers to an optionally substituted straight or branched divalent hydrocarbon chain in which at least one carbon-carbon double bond is present linking the rest of the molecule to a radical group. In some embodiments, the alkenylene is –CH=CH-, - CH2CH=CH-, or –CH=CHCH2-. In some embodiments, the alkenylene is –CH=CH-. In some embodiments, the alkenylene is –CH2CH=CH-. In some embodiments, the alkenylene is –CH=CHCH2-.

[0101] “Alkynyl” refers to an optionally substituted straight-chain or optionally substituted branched- chain hydrocarbon monoradical having one or more carbon-carbon triple-bonds. In some embodiments, an alkynyl group has from two to about ten carbon atoms, more preferably from two to about six carbon atoms. Examples include, but are not limited to, ethynyl, 2-propynyl, 2-butynyl, 1,3-butadiynyl, and the like. Whenever it appears herein, a numerical range such as “C2-C6alkynyl” means that the alkynyl group may consist of 2 carbon atoms, 3 carbon atoms, 4 carbon atoms, 5 carbon atoms, or 6 carbon atoms, although the present definition also covers the occurrence of the term “alkynyl” where no numerical range is designated. In some embodiments, the alkynyl is a C2-C10alkynyl, a C2-C9alkynyl, a C2-C8alkynyl, a C2- C7alkynyl, a C2-C6alkynyl, a C2-C5alkynyl, a C2-C4alkynyl, a C2-C3alkynyl, or a C2alkynyl. Unless stated otherwise specifically in the specification, an alkynyl group is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, an alkynyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, an alkynyl is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or -OMe. In some embodiments, the alkynyl is optionally substituted with halogen. The term “alkynylene” refers to an optionally substituted straight-chain or optionally substituted branched-chain divalent hydrocarbon having one or more carbon-carbon triple-bonds.

[0102] “Alkylamino” refers to a radical of the formula -N(Ra)2where Rais an alkyl radical as defined, or two Ra, taken together with the nitrogen atom, can form a substituted or unsubstituted C2-C7heterocyloalkyl ring. Unless stated otherwise specifically in the specification, an alkylamino group may be optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy,aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, an alkylamino is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, an alkylamino is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or -OMe. In some embodiments, the alkylamino is optionally substituted with halogen.

[0103] “Alkoxy” refers to a radical of the formula -ORa where Ra is an alkyl radical as defined. Unless stated otherwise specifically in the specification, an alkoxy group may be optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, an alkoxy is optionally substituted with oxo, halogen, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, an alkoxy is optionally substituted with oxo, halogen, -CN, -CF3, -OH, or -OMe. In some embodiments, the alkoxy is optionally substituted with halogen.

[0104] “Aminoalkyl” refers to an alkyl radical, as defined above, that is substituted by one or more amines. In some embodiments, the alkyl is substituted with one amine. In some embodiments, the alkyl is substituted with one, two, or three amines. Hydroxyalkyl include, for example, aminomethyl, aminoethyl, aminopropyl, aminobutyl, or aminopentyl. In some embodiments, the hydroxyalkyl is aminomethyl.

[0105] The term “aryl” refers to a radical comprising at least one aromatic ring wherein each of the atoms forming the ring is a carbon atom. Aryl groups can be optionally substituted. Examples of aryl groups include, but are not limited to phenyl, and naphthyl. In some embodiments, the aryl is phenyl. Depending on the structure, an aryl group can be a monoradical or a diradical (i.e., an arylene group). Unless stated otherwise specifically in the specification, the term “aryl” or the prefix “ar-”(such as in “aralkyl”) is meant to include aryl radicals that are optionally substituted. In some embodiments, an aryl group comprises a partially reduced cycloalkyl group defined herein (e.g., 1,2-dihydronaphthalene). In some embodiments, an aryl group comprises a fully reduced cycloalkyl group defined herein (e.g., 1,2,3,4- tetrahydronaphthalene). When aryl comprises a cycloalkyl group, the aryl is bonded to the rest of the molecule through an aromatic ring carbon atom. An aryl radical can be a monocyclic or polycyclic (e.g., bicyclic, tricyclic, or tetracyclic) ring system, which may include fused, spiro or bridged ring systems. Unless stated otherwise specifically in the specification, an aryl may be optionally substituted, for example, with halogen, amino, alkylamino, aminoalkyl, nitrile, nitro, hydroxyl, alkyl, alkenyl, alkynyl, haloalkyl, heteroalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, -S(O)2NH-C1-C6alkyl, and the like. In some embodiments, an aryl is optionally substituted with halogen, methyl, ethyl, -CN, -CF3, -OH, - OMe, -NH2, -NO2, -S(O)2NH2, -S(O)2NHCH3,-S(O)2NHCH2CH3, -S(O)2NHCH(CH3)2, -S(O)2N(CH3)2, or -S(O)2NHC(CH3)3. In some embodiments, an aryl is optionally substituted with halogen, methyl, ethyl, - CN, -CF3, -OH, or -OMe. In some embodiments, the aryl is optionally substituted with halogen. In some embodiments, the aryl is substituted with alkyl, alkenyl, alkynyl, haloalkyl, or heteroalkyl, wherein each alkyl, alkenyl, alkynyl, haloalkyl, heteroalkyl is independently unsubstituted, or substituted with halogen, methyl, ethyl, -CN, -CF3, -OH, -OMe, -NH2, or -NO2.

[0106] The term “cycloalkyl” refers to a monocyclic or polycyclic non-aromatic radical, wherein each of the atoms forming the ring (i.e. skeletal atoms) is a carbon atom. In some embodiments, cycloalkyls aresaturated or partially unsaturated. In some embodiments, cycloalkyls are spirocyclic or bridged compounds. In some embodiments, cycloalkyls are fused with an aromatic ring (in which case the cycloalkyl is bonded through a non-aromatic ring carbon atom). Cycloalkyl groups include groups having from 3 to 10 ring atoms. Representative cycloalkyls include, but are not limited to, cycloalkyls having from three to ten carbon atoms, from three to eight carbon atoms, from three to six carbon atoms, or from three to five carbon atoms. Monocyclic cycloalkyl radicals include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. In some embodiments, the monocyclic cycloalkyl is cyclopentyl. In some embodiments, the monocyclic cycloalkyl is cyclopentenyl or cyclohexenyl. In some embodiments, the monocyclic cycloalkyl is cyclopentenyl. Polycyclic radicals include, for example, adamantyl, 1,2- dihydronaphthalenyl, 1,4-dihydronaphthalenyl, tetrainyl, decalinyl, 3,4-dihydronaphthalenyl-1(2H)-one, spiro[2.2]pentyl, norbornyl and bicycle[1.1.1]pentyl. Unless otherwise stated specifically in the specification, a cycloalkyl group may be optionally substituted. Representative cycloalkyls include, but are not limited to, cycloalkyls having from three to fifteen carbon atoms (e.g., C3-C15fully saturated cycloalkyl or C3-C15cycloalkenyl), from three to ten carbon atoms (e.g., C3-C10fully saturated cycloalkyl or C3-C10cycloalkenyl), from three to eight carbon atoms (e.g., C3-C8fully saturated cycloalkyl or C3-C8cycloalkenyl), from three to six carbon atoms (e.g., C3-C6fully saturated cycloalkyl or C3-C6cycloalkenyl), from three to five carbon atoms (e.g., C3-C5fully saturated cycloalkyl or C3-C5cycloalkenyl), or three to four carbon atoms (e.g., C3-C4fully saturated cycloalkyl or C3-C4cycloalkenyl). In some embodiments, the cycloalkyl is a 3- to 6-membered cycloalkyl. In some embodiments, the cycloalkyl is a 5- to 6- membered cycloalkyl. Monocyclic cycloalkyls include, for example, cyclopropyl, cyclobutyl, cyclopentyl, cyclohexyl, cycloheptyl, and cyclooctyl. Polycyclic cycloalkyls or carbocycles include, for example, adamantyl, norbornyl, decalinyl, bicyclo[3.3.0]octane, bicyclo[4.3.0]nonane, cis-decalin, trans-decalin, bicyclo[2.1.1]hexane, bicyclo[2.2.1]heptane, bicyclo[2.2.2]octane, bicyclo[3.2.2]nonane, and bicyclo[3.3.2]decane, and 7,7-dimethyl-bicyclo[2.2.1]heptanyl. Partially saturated cycloalkyls include, for example, cyclopentenyl, cyclohexenyl, cycloheptenyl, and cyclooctenyl. Unless stated otherwise specifically in the specification, a cycloalkyl is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, alkyl, alkenyl, alkynyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, a cycloalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, a cycloalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, or -OMe. In some embodiments, the cycloalkyl is optionally substituted with halogen.

[0107] “Halo” or “halogen” refers to bromo, chloro, fluoro, or iodo. In some embodiments, halogen is fluoro or chloro. In some embodiments, halogen is fluoro.

[0108] “Haloalkyl” refers to an alkyl radical, as defined above, that is substituted by one or more halogens. In some embodiments, the alkyl is substituted with one, two, or three halogens. In some embodiments, the alkyl is substituted with one, two, three, four, five, or six halogens. Haloalkyl can include, for example, iodoalkyl, bromoalkyl, chloroalkyl, and fluoroalkyl. For example, "fluoroalkyl" refers to an alkyl radical, as defined above, that is substituted by one or more fluoro radicals, as defined above, forexample, trifluoromethyl, difluoromethyl, fluoromethyl, 2,2,2-trifluoroethyl, 1-fluoromethyl-2-fluoroethyl, and the like. In some embodiments, the alkyl part of the fluoroalkyl radical is optionally substituted as defined above for an alkyl group.

[0109] “Heteroalkyl” refers to an alkyl group in which one or more skeletal atoms of the alkyl are selected from an atom other than carbon, e.g., oxygen, nitrogen (e.g., -NH-, -N(alkyl)-), sulfur, or combinations thereof. A heteroalkyl is attached to the rest of the molecule at a carbon atom of the heteroalkyl. In one aspect, a heteroalkyl is a C1-C6heteroalkyl wherein the heteroalkyl is comprised of 1 to 6 carbon atoms and one or more atoms other than carbon, e.g., oxygen, nitrogen (e.g. -NH-, -N(alkyl)-), sulfur, or combinations thereof wherein the heteroalkyl is attached to the rest of the molecule at a carbon atom of the heteroalkyl. Examples of such heteroalkyl are, for example, –CH2-O-CH2-, –CH2-N(alkyl)- CH2-, –CH2-N(aryl)-CH2-, -OCH2CH2O-, –OCH2CH2OCH2CH2O-, or –OCH2CH2OCH2CH2OCH2CH2O-. Unless stated otherwise specifically in the specification, a heteroalkyl is optionally substituted for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, alkyl, alkenyl, alkynyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, a heteroalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, a heteroalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, or -OMe. In some embodiments, the heteroalkyl is optionally substituted with halogen.

[0110] As used herein, a “heteroalkylene” refers to divalent heteroalkyl group. Examples of such heteroalkylene are, for example, -CH2-O-CH2-, -CH2-N(alkyl)-CH2-, -CH2-N(aryl)-CH2-, -OCH2CH2O-, - OCH2CH2OCH2CH2O-, or -OCH2CH2OCH2CH2OCH2CH2O-.

[0111] The term “heterocycloalkyl” refers to a cycloalkyl group that includes at least one hetero ring atom, e.g., a heteroatom selected from nitrogen, oxygen, and sulfur. Unless stated otherwise specifically in the specification, the heterocycloalkyl radical may be a monocyclic, or bicyclic ring system, which may include fused (when fused with an aryl or a heteroaryl ring, the heterocycloalkyl is bonded through a non- aromatic ring atom) or bridged ring systems. The nitrogen, carbon or sulfur atoms in the heterocyclyl radical may be optionally oxidized. The nitrogen atom may be optionally quaternized. The heterocycloalkyl radical is partially or fully saturated. Examples of heterocycloalkyl radicals include, but are not limited to, dioxolanyl, thienyl[1,3]dithianyl, tetrahydroquinolyl, tetrahydroisoquinolyl, decahydroquinolyl, decahydroisoquinolyl, imidazolinyl, imidazolidinyl, isothiazolidinyl, isoxazolidinyl, morpholinyl, octahydroindolyl, octahydroisoindolyl, 2-oxopiperazinyl, 2-oxopiperidinyl, 2-oxopyrrolidinyl, oxazolidinyl, piperidinyl, piperazinyl, 4-piperidonyl, pyrrolidinyl, pyrazolidinyl, quinuclidinyl, thiazolidinyl, tetrahydrofuryl, trithianyl, tetrahydropyranyl, thiomorpholinyl, thiamorpholinyl, 1-oxo-thiomorpholinyl, 1,1-dioxo-thiomorpholinyl. Representative heterocycloalkyls include, but are not limited to, heterocycloalkyls having from two to fifteen carbon atoms (e.g., C2-C15fully saturated heterocycloalkyl or C2-C15heterocycloalkenyl), from two to ten carbon atoms (e.g., C2-C10fully saturated heterocycloalkyl or C2-C10heterocycloalkenyl), from two to eight carbon atoms (e.g., C2-C8fully saturated heterocycloalkyl or C2-C8heterocycloalkenyl), from two to seven carbon atoms (e.g., C2-C7fully saturated heterocycloalkyl or C2-C7heterocycloalkenyl), from two to six carbon atoms (e.g., C2-C6fully saturatedheterocycloalkyl or C2-C7heterocycloalkenyl), from two to five carbon atoms (e.g., C2-C5fully saturated heterocycloalkyl or C2-C5heterocycloalkenyl), or two to four carbon atoms (e.g., C2-C4fully saturated heterocycloalkyl or C2-C4heterocycloalkenyl). The term heterocycloalkyl also includes all ring forms of carbohydrates, including but not limited to monosaccharides, disaccharides and oligosaccharides. Unless otherwise noted, heterocycloalkyls have from 2 to 12 carbons in the ring. In some embodiments, heterocycloalkyls have from 2 to 10 carbons in the ring. In some embodiments, heterocycloalkyls have from 2 to 10 carbons in the ring and 1 or 2 N atoms. In some embodiments, heterocycloalkyls have from 2 to 10 carbons in the ring and 3 or 4 N atoms. In some embodiments, heterocycloalkyls have from 2 to 12 carbons, 0-2 N atoms, 0-2 O atoms, 0-2 P atoms, and 0-1 S atoms in the ring. In some embodiments, heterocycloalkyls have from 2 to 12 carbons, 1-3 N atoms, 0-1 O atoms, and 0-1 S atoms in the ring. It is understood that when referring to the number of carbon atoms in a heterocycloalkyl, the number of carbon atoms in the heterocycloalkyl is not the same as the total number of atoms (including the heteroatoms) that make up the heterocycloalkyl (i.e. skeletal atoms of the heterocycloalkyl ring). Unless stated otherwise specifically in the specification, a heterocycloalkyl is optionally substituted, for example, with oxo, halogen, amino, nitrile, nitro, hydroxyl, alkyl, alkenyl, alkynyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, a heterocycloalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, a heterocycloalkyl is optionally substituted with oxo, halogen, methyl, ethyl, -CN, -CF3, -OH, or -OMe. In some embodiments, the heterocycloalkyl is optionally substituted with halogen.

[0112] “Heteroaryl” refers to a ring system radical comprising carbon atom(s) and one or more ring heteroatoms selected from the group consisting of nitrogen, oxygen, phosphorous, and sulfur, and at least one aromatic ring. In some embodiments, heteroaryl is monocyclic, bicyclic or polycyclic. Illustrative examples of monocyclic heteroaryls include pyridinyl, imidazolyl, pyrimidinyl, pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, pyridazinyl, triazinyl, oxadiazolyl, thiadiazolyl, furazanyl, indolizine, indole, benzofuran, benzothiophene, indazole, benzimidazole, purine, quinolizine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, 1,8-naphthyridine, and pteridine. Illustrative examples of monocyclic heteroaryls include pyridinyl, imidazolyl, pyrimidinyl, pyrazolyl, triazolyl, pyrazinyl, tetrazolyl, furyl, thienyl, isoxazolyl, thiazolyl, oxazolyl, isothiazolyl, pyrrolyl, pyridazinyl, triazinyl, oxadiazolyl, thiadiazolyl, and furazanyl. Illustrative examples of bicyclic heteroaryls include indolizine, indole, benzofuran, benzothiophene, indazole, benzimidazole, purine, quinolizine, quinoline, isoquinoline, cinnoline, phthalazine, quinazoline, quinoxaline, 1,8-naphthyridine, and pteridine. In some embodiments, heteroaryl is pyridinyl, pyrazinyl, pyrimidinyl, thiazolyl, thienyl, thiadiazolyl or furyl. In some embodiments, a heteroaryl contains 0-6 N atoms in the ring. In some embodiments, a heteroaryl contains 1-4 N atoms in the ring. In some embodiments, a heteroaryl contains 4-6 N atoms in the ring. In some embodiments, a heteroaryl contains 0-4 N atoms, 0-1 O atoms, 0-1 P atoms, and 0-1 S atoms in the ring. In some embodiments, a heteroaryl contains 1-4 N atoms, 0-1 O atoms, and 0-1 S atoms in the ring. In some embodiments, heteroaryl is a C1- C9heteroaryl. In some embodiments, monocyclic heteroaryl is a C1-C5heteroaryl. In some embodiments,monocyclic heteroaryl is a 5-membered or 6-membered heteroaryl. In some embodiments, a bicyclic heteroaryl is a C6-C9heteroaryl. In some embodiments, a heteroaryl group comprises a partially reduced cycloalkyl or heterocycloalkyl group defined herein (e.g., 7,8-dihydroquinoline). In some embodiments, a heteroaryl group comprises a fully reduced cycloalkyl or heterocycloalkyl group defined herein (e.g., 5,6,7,8-tetrahydroquinoline). When heteroaryl comprises a cycloalkyl or heterocycloalkyl group, the heteroaryl is bonded to the rest of the molecule through a heteroaromatic ring carbon or hetero atom. A heteroaryl radical can be a monocyclic or polycyclic (e.g., bicyclic, tricyclic, or tetracyclic) ring system, which may include fused, spiro or bridged ring systems. Unless stated otherwise specifically in the specification, a heteroaryl is optionally substituted, for example, with halogen, amino, nitrile, nitro, hydroxyl, alkyl, alkenyl, alkynyl, haloalkyl, alkoxy, aryl, cycloalkyl, heterocycloalkyl, heteroaryl, and the like. In some embodiments, a heteroaryl is optionally substituted with halogen, methyl, ethyl, -CN, - CF3, -OH, -OMe, -NH2, or -NO2. In some embodiments, a heteroaryl is optionally substituted with halogen, methyl, ethyl, -CN, -CF3, -OH, or -OMe. In some embodiments, the heteroaryl is optionally substituted with halogen.

[0113] The term “moiety” refers to a specific segment or functional group of a molecule. Chemical moieties are often recognized chemical entities embedded in or appended to a molecule.

[0114] The terms “treat,” “prevent,” “ameliorate,” and “inhibit,” as well as words stemming therefrom, as used herein, do not necessarily imply 100% or complete treatment, prevention, amelioration, or inhibition. Rather, there are varying degrees of treatment, prevention, amelioration, and inhibition of which one of ordinary skill in the art recognizes as having a potential benefit or therapeutic effect. In this respect, the disclosed methods can provide any amount of any level of treatment, prevention, amelioration, or inhibition of the disorder in a mammal. For example, a disorder, including symptoms or conditions thereof, may be reduced by, for example, about 100%, about 90%, about 80%, about 70%, about 60%, about 50%, about 40%, about 30%, about 20%, or about 10%. Furthermore, the treatment, prevention, amelioration, or inhibition provided by the methods disclosed herein can include treatment, prevention, amelioration, or inhibition of one or more conditions or symptoms of the disorder, e.g., cancer or an inflammatory disease.

[0115] In certain embodiments, “treating” includes the concepts of “alleviating,” which refers to lessening the frequency of occurrence or recurrence, or the severity, of any symptoms or other ill effects related to a disorder and / or the associated side effects. In certain embodiments, the term “treating” also encompasses the concept of “managing” which refers to reducing the severity of a particular disease or disorder in a patient or delaying its recurrence, e.g., lengthening the period of remission in a patient who had suffered from the disease.

[0116] In certain embodiments, the term “prevent” or “preventing” as related to a disease or disorder can refer to a compound that in a statistical sample, reduces the occurrences of the disorder or condition in the treated sample relative to an untreated control sample, or delays the onset or reduces the severity of one or more symptoms of the disorder or condition relative to the untreated control sample.

[0117] The term "therapeutically effective amount" as used herein refers to an amount effective at the dosage and duration necessary to achieve the desired therapeutic result. A therapeutically effective amountof the composition may vary depending on factors such as the individual's condition, age, sex, and weight, and the ability of the protein to elicit the desired response of the individual. A therapeutically effective amount can also be an amount that exceeds any toxic or deleterious effect of the composition that would have a beneficial effect on the treatment.

[0118] The term “optional” or “optionally” means that the subsequently described event or circumstance may or may not occur, and that the description includes instances where said event or circumstance occurs and instances in which it does not. For example, “optionally substituted alkyl” means either “alkyl” or “substituted alkyl” as defined above. Further, an optionally substituted group may be un-substituted (e.g., -CH2CH3), fully substituted (e.g., -CF2CF3), mono-substituted (e.g., -CH2CH2F) or substituted at a level anywhere in-between fully substituted and mono-substituted (e.g., -CH2CHF2, -CH2CF3, -CF2CH3, - CFHCHF2, etc.).

[0119] As used herein, the term "substituent" means positional variables on the atoms of a core molecule that are substituted at a designated atom position, replacing one or more hydrogens on the designated atom, provided that the designated atom's normal valency is not exceeded, and that the substitution results in a stable compound. Combinations of substituents and / or variables are permissible only if such combinations result in stable compounds. A person of ordinary skill in the art should note that any carbon as well as heteroatom with valences that appear to be unsatisfied as described or shown herein is assumed to have a sufficient number of hydrogen atom(s) to satisfy the valences described or shown. In certain instances one or more substituents having a double bond (e.g., "oxo" or "=O") as the point of attachment may be described, shown or listed herein within a substituent group, wherein the structure may only show a single bond as the point of attachment to the core structure. A person of ordinary skill in the art would understand that, while only a single bond is shown, a double bond is intended for those substituents.

[0120] For the purpose of the disclosure, one event of “substitution” of an amino acid or an amino sequence is not considered two separate events of one deletion plus one addition. Thus, for the avoidance of doubt, as an example, a sequence change of “up to two deletion, substitution and / or addition” includes one deletion and one substitution, one deletion and one addition (at a different position), one substitution and one addition, one deletion only, one substitution only, one addition only, two deletions, two substitutions, two additions, etc. The deletion, addition, or substitution position may be at one or both ends of the peptide, or in the middle of the peptide.

[0121] The term “optionally substituted” or “substituted” means that the referenced group is optionally substituted with one or more additional group(s). For example, “optionally substituted” or “substituted” can mean that the referenced group is optionally substituted with one or more substituents individually and independently selected from D, halogen, -CN, -NH2, -NH(alkyl), -N(alkyl)2, -OH, -CO2H, -CO2alkyl, - C(=O)NH2, -C(=O)NH(alkyl), -C(=O)N(alkyl)2, -S(=O)2NH2, -S(=O)2NH(alkyl), -S(=O)2N(alkyl)2, alkyl, cycloalkyl, fluoroalkyl, heteroalkyl, alkoxy, fluoroalkoxy, heterocycloalkyl, aryl, heteroaryl, aryloxy, alkylthio, arylthio, alkylsulfoxide, arylsulfoxide, alkylsulfone, and arylsulfone. In some other embodiments, optional substituents are independently selected from D, halogen, -CN, -NH2, -NH(CH3), -N(CH3)2, -OH, -CO2H, -CO2(C1-C4alkyl), -C(=O)NH2, -C(=O)NH(C1-C4alkyl), -C(=O)N(C1-C4alkyl)2, -S(=O)2NH2, -S(=O)2NH(C1-C4alkyl), -S(=O)2N(C1-C4alkyl)2, C1-C4alkyl, C3-C6cycloalkyl, C1-C4fluoroalkyl, C1- C4heteroalkyl, C1-C4alkoxy, C1-C4fluoroalkoxy, -SC1-C4alkyl, -S(=O)C1-C4alkyl, and -S(=O)2C1-C4alkyl. In some embodiments, an “optionally substituted” group is independently substitued with 1-6 substituents selected from halogen, -CN, oxo, -OH, -SF5, -SH, -S(=O)C1-C3alkyl, -S(=O)2C1-C3alkyl, -S(=O)2NH2, - S(=O)2NHC1-C3alkyl, -S(=O)2N(C1-C3alkyl)2, -S(=O)(=NC1-C3alkyl)(C1-C3alkyl), -NH2, -NHC1-C3alkyl, -N(C1-C3alkyl)2, -N=S(=O)(C1-C3alkyl)2, -C(=O)C1-C3alkyl, -C(=O)OH, -C(=O)OC1-C3alkyl, -C(=O)NH2, -C(=O)NHC1-C3alkyl, -C(=O)N(C1-C3alkyl)2, -P(=O)(C1-C3alkyl)2, C1-C6alkyl, C1-C6alkoxy, C1- C6haloalkyl, C1-C6haloalkoxy, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, aryl, heteroaryl, heterocycloalkyl and cycloalkyl. In some embodiments, an “optionally substituted” group is independently substitued with 1-6 substituents selected from halogen, -CN, oxo, -OH, -SF5, -SH, -S(=O)C1-C3alkyl, - S(=O)2C1-C3alkyl, -S(=O)2NH2, -S(=O)2NHC1-C3alkyl, -S(=O)2N(C1-C3alkyl)2, -S(=O)(=NC1- C3alkyl)(C1-C3alkyl), -NH2, -NHC1-C3alkyl, -N(C1-C3alkyl)2, -N=S(=O)(C1-C3alkyl)2, -C(=O)C1-C3alkyl, -C(=O)OH, -C(=O)OC1-C3alkyl, -C(=O)NH2, -C(=O)NHC1-C3alkyl, -C(=O)N(C1-C3alkyl)2, -P(=O)(C1- C3alkyl)2, C1-C3alkyl, C1-C3alkoxy, C1-C3haloalkyl, C1-C3haloalkoxy, C1-C3hydroxyalkyl, C1- C3aminoalkyl, C1-C3heteroalkyl, 5-6 membered heterocycloalkyl and C3-C6cycloalkyl. In some embodiments, an “optionally substituted” group is independently substitued with 1-6 substituents selected from halogen, oxo, -OH, -NH2, -NHC1-C3alkyl, -N(C1-C3alkyl)2, -C(=O)OH, -C(=O)NH2, C1-C3alkyl, C1- C3alkoxy, C1-C3haloalkyl, C1-C3haloalkoxy, C1-C3hydroxyalkyl, C1-C3aminoalkyl, C1-C3heteroalkyl, and C3-C6cycloalkyl. In some embodiments, optional substituents are independently selected from D, halogen, -CN, -NH2, -OH, -NH(CH3), -N(CH3)2, -NH(cyclopropyl), -CH3, -CH2CH3, -CF3, -OCH3, and -OCF3. In some embodiments, substituted groups are substituted with one or two of the preceding groups. In some embodiments, an optional substituent on an aliphatic carbon atom (acyclic or cyclic) includes oxo (=O). When indicating the number of substituents, the term “one or more” means from one substituent to the highest possible number of substitutions, i.e. replacement of one hydrogen up to replacement of all hydrogens by substituents. In some embodiments, an “optionally substituted” group is unsubstituted. In some embodiments, an “optionally substituted” group is independently substitued with 1-6 substituents. In some embodiments, an “optionally substituted” group is independently substitued with 1-3 substituents. In some embodiments, an “optionally substituted” group is independently substitued with 1-2 substituents.

[0122] The term “unsubstituted” means that the specified group bears no substituents.

[0123] Certain compounds described herein may exist in tautomeric forms, and all such tautomeric forms of the compounds being within the scope of the disclosure.

[0124] Unless otherwise stated, structures depicted herein are also meant to include all stereochemical forms of the structure; i.e., the R and S configurations for each asymmetric center. Therefore, single stereochemical isomers as well as enantiomeric and diastereomeric mixtures of the present compounds are within the scope of the disclosure.

[0125] The term “peptide” as used herein refers to a compound that includes two or more amino acids. A peptide described herein can comprise one or more unnatural amino acids. The term “peptide” also encompasses peptide mimetics. In the present disclosure, the term “amino acid” is used in its broadestmeaning and it embraces not only natural amino acids but also derivatives thereof and artificial amino acids. For example, the term “amino acid” encompasses unnatural amino acids.

[0126] The term “peptoid” as used herein refers to an N-substituted glycine. A peptoid can be optionally substituted. A peptoid can optionally comprise additional substitutions at the alpha-carbon.

[0127] As used herein, the term “unnatural amino acid” refers to an amino acid other than the 20 canonical amino acids. The 20 canonical amino acids refer to alanine (ala or A), arginine (arg or R), asparagine (asn or N), aspartic acid (asp or D), cysteine (cys or C), glutamine (gln or Q), glutamic acid (glu or E), glycine (gly or G), histidine (his or H), isoleucine (ile or I), leucine (leu or L), lysine (lys or K), methionine (met or M), phenylalanine (phe or F), proline (pro or P), serine (ser or S), threonine (thr or T), tryptophan (trp or W), tyrosine (tyr or Y), and valine (val or V).

[0128] The term “protein” as used herein refers to a polypeptide (i.e., a string of at least 3 amino acids linked to one another by peptide bonds). Proteins can include moieties other than amino acids (e.g., may be glycoproteins, proteoglycans, etc.) and / or can be otherwise processed or modified. A protein can be a complete polypeptide as produced by and / or active in a cell (with or without a signal sequence). In some embodiments, a protein is or comprises a characteristic portion such as a polypeptide as produced by and / or active in a cell. A protein can include more than one polypeptide chain. For example, polypeptide chains can be linked by one or more disulfide bonds or associated by other means.

[0129] The term “peptide mimetic” or “mimetic” refers to biologically active compounds that mimic the biological activity of a peptide or a protein but are no longer entirely peptidic in chemical nature, e.g.,, they can contain non-peptide bonds (that are, bonds other than amide bonds between amino acids). As used herein, the term peptide mimetic is used in a broader sense to include molecules that are no longer completely peptidic in nature, such as pseudo-peptides, semi-peptides and peptoids. Whether completely or partially non-peptide, peptide mimetics described herein can provide a spatial arrangement of reactive chemical moieties that closely resemble the three-dimensional arrangement of active groups in the subject amino acid sequence or subject molecule on which the peptide mimetic is based. As a result of this similar active-site geometry, the peptide mimetic can have effects on biological systems that are similar to the biological activity of the subject entity.

[0130] In some embodiments, the peptide mimetics are substantially similar in both three-dimensional shape and biological activity to the subject amino acid sequence or subject molecule on which the peptide mimetic is based. An example is described in the paper “Tritiated D-ala1-Peptide T Binding”, Smith C. S. et al., Drug Development Res., 15, pp.371-379 (1988). A second method is altering cyclic structure for stability, such as N to C interchain imides and lactams (Ede et al. in Smith and Rivier (Eds.) “Peptides: Chemistry and Biology”, Escom, Leiden (1991), pp. 268-270). An example of this is provided in conformationally restricted thymopentin-like compounds, such as those disclosed in US4457489. A third method is to substitute peptide bonds in the subject entity by pseudopeptide bonds that confer resistance to proteolysis.

[0131] The term “organic atoms” refers to atoms which would be found in organic compounds, such as carbon, hydrogen, nitrogen, oxygen, surfur, phosphorus, fluorine, chlorine, bromine, or iodine

[0132] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub-range from the group consisting of 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, or 50, as well as all intervening decimal values between the aforementioned integers such as, for example, 1.1, 1.2, 1.3, 1.4, 1.5, 1.6, 1.7, 1.8, and 1.9. With respect to sub-ranges, “nested sub-ranges” that extend from either end point of the range are specifically contemplated. For example, a nested sub-range of an exemplary range of 1 to 50 may comprise 1 to 10, 1 to 20, 1 to 30, and 1 to 40 in one direction, or 50 to 40, 50 to 30, 50 to 20, and 50 to 10 in the other direction.

[0133] As used herein, C1-Cx(or C1-x) includes C1-C2, C1-C3... C1-Cx. By way of example only, a group designated as “C1-C4” indicates that there are one to four carbon atoms in the moiety, i.e. groups containing 1 carbon atom, 2 carbon atoms, 3 carbon atoms or 4 carbon atoms. Thus, by way of example only, “C1-C4alkyl” indicates that there are one to four carbon atoms in the alkyl group, i.e., the alkyl group is selected from among methyl, ethyl, propyl, iso-propyl, n-butyl, iso-butyl, sec-butyl, and t-butyl. Also, by way of example, C0-C2alkylene includes a direct bond, -CH2-, and -CH2CH2- linkages.

[0134] The term “cyclized” or “cyclization” as used herein means that two amino acids apart from each other by at least one amino acid bind directly or bind indirectly to each other in one peptide to form a cyclic structure in the molecule. In some cases, the two amino acids bind via a linker or the like.

[0135] The term “subject” or “patient” encompasses mammals. Examples of mammals include, but are not limited to, any member of the Mammalian class: humans, non-human primates such as chimpanzees, and other apes and monkey species; farm animals such as cattle, horses, sheep, goats, swine; domestic animals such as rabbits, dogs, and cats; laboratory animals including rodents, such as rats, mice and guinea pigs, and the like. In one aspect, the mammal is a companion animal such as a dog or a cat. In one aspect, the mammal is a human.

[0136] Percent sequence identity can be calculated using computer programs or direct sequence comparison. Preferred computer program methods to determine identity between two sequences include, but are not limited to, the GCG program package, FASTA, BLASTP, and TBLASTN (see, e.g., D. W. Mount, 2001, Bioinformatics: Sequence and Genome Analysis, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y.). The BLASTP and TBLASTN programs are publicly available from NCBI and other sources. The Smith Waterman algorithm can also be used to determine percent identity. Exemplary parameters for amino acid sequence comparison include the following: 1) algorithm from Needleman and Wunsch (J. Mol. Biol., 48:443-453 (1970)); 2) BLOSSUM62 comparison matrix from Hentikoff and Hentikoff (Proc. Nat. Acad. Sci. USA., 89:10915-10919 (1992)) 3) gap penalty=12; and 4) gap length penalty=4. A program useful with these parameters can be publicly available as the “gap” program (Genetics Computer Group, Madison, Wis.). The aforementioned parameters are the default parameters for polypeptide comparisons (with no penalty for end gaps). Alternatively, polypeptide sequence identity can be calculated using the following equation: % identity – (the number of identical residues) / (alignment length in amino acid residues)*100. For this calculation, alignment length includes internal gaps but doesnot include terminal gaps.

[0137] It is appreciated that certain features of the disclosure, which are, for clarity, described in the context of separate embodiments, can also be provided in combination in a single embodiment. Conversely, various features of the disclosure, which are, for brevity, described in the context of a single embodiment, can also be provided separately or in any suitable subcombination. For example, a conjugate of this disclosure can comprise any peptide ligand described herein (e.g., a peptide ligand of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), or Table 1), any metal chelator described herein (e.g., a metal chelator selected from FIGs 4A, 5A, 6A, 7A, 4B, 5B, 6B, 7B and 8-22), optionally a linker described herein (e.g., a linker of Formula (II-1), (II-1a), or (II-1b)), and optionally a radionuclide described herein (e.g., a radionuclide of Table 7). For another example, a peptide of Formula (I) (or any other Formulae such as (III-1) and (III-2)) can comprise X1 to X12 amino acids as described herein, and any combinations of the embodiments of amino acids are encompassed by this disclosure (even though, in some cases, they are described in the context of separate embodiments).

[0138] Unless special definitions are given, the terminology used in relation to analytical chemistry, synthetic organic chemistry, and medical chemistry and pharmaceutical chemistry described in the present specification, as well as their procedures and techniques, are well known and commonly used in the field of the present art. Standard techniques may be used for chemical synthesis and chemical analysis. Those defined from among such techniques and procedures can be found in, for example, “K.J. Jensen, P.T. Shelton, S.L. Pedersen, Peptide Synthesis and Applications, 2nd Edition, Springer, 2013” and the like, and these are incorporated into the present specification by reference for all purposes. All patents, applications, published applications, and other publications, and other data referred to throughout the entire disclosure, when permitted, are incorporated into the present specification by reference. II. Radiopharmaceutical Conjugates

[0139] Provided herein are radiopharmaceutical conjugates that have avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, and pharmaceutical compositions comprising the conjugates. The conjugates and compositions can be useful for treating cancer. The conjugates and compositions can also be useful in imaging and disease diagnosis.

[0140] In one aspect, described herein is a conjugate that comprises a peptide that has avidity for Glypican 3 (GPC3) and a metal chelator that is configured to bind with a radionuclide. In some embodiments, the GPC3 is a human GPC3. The peptide can be cyclic or acyclic, and it can be monocyclic, bicyclic or polycyclic. In one aspect, described herein is a conjugate that comprises a cyclic peptide and a metal chelator that is configured to bind with a radionuclide. In some embodiments, the peptide (such as cyclic peptide) is configured to bind to a target. A conjugate described herein can further comprises a linker that covalently attaches the peptide to the metal chelator. In some embodiments, the conjugate comprises a radionuclide such as225Ac bound to the metal chelator.

[0141] In another aspect, described herein is a conjugate that comprises a peptide that has avidity for Glypican 3 (GPC3) and a covalently bound radionuclide. In some embodiments, the GPC3 is a humanGPC3. The peptide can be cyclic or acyclic, and it can be monocyclic, bicyclic or polycyclic. In one aspect, described herein is a conjugate that comprises a cyclic peptide and a metal chelator that is configured to bind with a radionuclide. In some embodiments, the peptide (such as cyclic peptide) is configured to bind to a target. A conjugate described herein can further comprises a linker that links the covalent radionuclide to the peptide. In some embodiments, the conjugate comprises a covalent radionuclide such as131I bound.

[0142] In one aspect, described herein is a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence including deletion, substitution, and / or addition of one or several (e.g., 1-6) amino acids in the amino acid sequence of SEQ ID NO: 1: MeK-MeI-D-MeQ-F4COO-I-I-Y-MeNal27N-G-3Py6Ph-MeC (SEQ ID NO: 1), wherein the peptide consists of 10 to 12 amino acid residues; and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0143] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide. In some embodiments, the radiopharmaceutical conjugate comprises a radionuclide bound to the metal chelator.

[0144] In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide.

[0145] In some embodiments, the peptide is a cyclic peptide.

[0146] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is covalently linked to the peptide. In some embodiments, a radionuclide is bound to the metal chelator. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide. In some embodiments, the peptide comprises an amino acid sequence with deletion of 2 or fewer amino acids in the amino acid SEQ ID NO: 1. In some embodiments, 1 amino acid is deleted from SEQ ID NO: 1. In some embodiments, the 1 amino acid deleted form SEQ ID NO: 1 is the MeI at position 2. In some embodiments, the 1 amino acid deleted form SEQ ID NO: 1 is the D at position 3. In some embodiments, 1, 2, 3, 4, or 5 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 1, 2, or 3 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 1 or 2 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 1 amino acid is added to the peptide of SEQ ID NO: 1. In some embodiments, 2 amino acids are added to the peptide of SEQ ID NO: 1.

[0147] In one aspect, described herein is a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I), X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein,X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring (e.g., W, F, Y, or a variant thereof), cycloalkyl, or heterocycloalkyl group, or X5 is a peptoid (e.g., Cha4cH, Cha4tH, A1mor, Atp, Cha4cOMe); X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted (e.g., X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg); X8 is an A, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G, A, or a D-amino acid (e.g., da, ds, de, or dp); X11 is an amino acid comprising an aromatic ring (e.g., F, Y, or a variant thereof); and, X12 is N-alkylated cysteine (e.g., MeC); and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0148] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide. In some embodiments, the radiopharmaceutical conjugate comprises a radionuclide bound to the metal chelator. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide.

[0149] In one aspect, described herein is a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I), X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein, X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa, MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb); X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa;X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, KAc, Hgn, MeY, or DapCOpipzaa; X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa; X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, Yae, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa; X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe; X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg; X8 is A, I, L, V, Y, F4OMe, F4COO, F4OEt, F4u, F4Me, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa; X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeW7N, MeF3C4Me, or MeF3Me4C; X10 is G, A, or a D-amino acid (e.g., da, ds, de, or dp); X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, or F4CONdMe; and X12 is MeC; and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0150] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide. In some embodiments, the radiopharmaceutical conjugate comprises a radionuclide bound to the metal chelator. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide.

[0151] In one aspect, described herein is a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I), X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein,X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 iswherein: Rn5is hydrogen or C1-3alkyl; ring A5 is an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl; each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX5-heterocycloalkyl, -LX5-cycloalkyl, -LX5-aryl, or -LX5-heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O, =S, or =N(Ra); LX5is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa- , wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a; kx5 is 0, 1, 2, or 3; mx5 is 0, 1, 2, 3, 4, or 5; *X4 represents the point of attachment to X4; and *X6 represents the point of attachment to X6; X6 iswherein; Rn6is hydrogen or C1-3alkyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX6- heterocycloalkyl, -LX6-cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; orRn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a; LX6is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a; *X5 represents the point of attachment to X5; and *X7 represents the point of attachment to X7; X7 iswherein: Rn7is hydrogen or C1-3alkyl ; RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, cycloalkyl, or heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a; *X6 represents the point of attachment to X6; and *X8 represents the point of attachment to X8; X8 iswherein; Rn8is hydrogen or C1-3alkyl; ring A8 is an aryl or heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX8-heterocycloalkyl, -LX8-cycloalkyl, -LX8-aryl, or -LX8-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O, =S, or =N(Ra);LX8is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a; kx8 is 0, 1, 2, or 3; mx8 is 0, 1, 2, 3, 4, or 5; *X7 represents the point of attachment to X7; and *X9 represents the point of attachment to X9; X9 iswherein: Rn9is hydrogen or C1-3alkyl; ring A9 is an aryl or heteroaryl; each RX9is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O, =S, or =N(Ra); kx9 is 0, 1, 2, or 3; mx9 is 0, 1, 2, 3, 4, or 5; *X8 represents the point of attachment to X8; and *X10 represents the point of attachment to X10; X10 is glycine or a D-amino acid (e.g., da, ds, de, or dp); X11 iswherein: Rn11is hydrogen or C1-3alkyl; ring A11 is an aryl or heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX11- heterocycloalkyl, -LX11-cycloalkyl LX11-aryl, or -LX11-heteroaryl, wherein each of thealkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O, =S, or =N(Ra); LX11is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a; kx11 is 0, 1, 2, 3, 4, or 5; mx11 is 0, 1, 2, 3, 4, or 5; *X10 represents the point of attachment to X10; and, *X12 represents the point of attachment to X12; X12 is N-alkylated cysteine; each of RX5a, RX6a, RX7a, RX8a, RX9a, and RX11ais independently halogen, C1-6alkyl, C1- C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2- C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, - S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, - NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, - NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), - P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re. each Rais independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; each Reis independently halogen, -CN, -OH, -O-C1-C6alkyl, -SF5, -S(=O)C1-C6alkyl, - S(=O)2C1-C6alkyl, -S(=O)2NH2, -S(=O)2-halogen, -S(=O)2NHC1-C6alkyl, - S(=O)2N(C1-C6alkyl)2, -NH2, -NHC1-C6alkyl, -N(C1-C6alkyl)2, -NHC(=NH)NH2, - NHC(=O)OC1-C6alkyl, -C(=O)C1-C6alkyl, -C(=O)OH, C1-C6alkyl-C(=O)OH, - C(=O)OC1-C6alkyl, -C(=O)NH2, -C(=O)N(C1-C6alkyl)2, -C(=O)NHC1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, or C1-C6heteroalkyl; or two Reare taken together to form =O; and each Rcand Rdare independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; or Rcand Rdare taken together with the atom to which they are attached to form a heterocycloalkyl optionally substituted with one or more Re; and(b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0152] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide. In some embodiments, the radiopharmaceutical conjugate comprises a radionuclide bound to the metal chelator. In some embodiments, the radiopharmaceutical conjugate comprises a covalently bound radionuclide.

[0153] In one aspect, described herein is a radiopharmaceutical conjugate with structure of, whereinrepresents a linker.

[0154] In some embodiments, the radiopharmaceutical conjugate comprises a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the metal chelator is covalently linked to the peptide. In some embodiments, the conjugate further comprises a linker that connects the peptide with the metal chelator. In some embodiments, the linker covalently connects the peptide with the metal chelator. In some embodiments, the linker covalently attaches the metal chelator to the N-terminus of the peptide. In some embodiments, the linker covalently attaches the metal chelator to the C-terminus of the peptide. In some embodiments, the linker is attached to the peptide via a non-terminal amino acid residue of the peptide. In some embodiments, the linker is attached to amino acid X1. In some embodiments, the linker is attached to amino acid X2. In some embodiments, the linker is attached to amino acid X3. In some embodiments, the linker is attached to amino acid X4. In some embodiments, the linker is attached to amino acid X5. In some embodiments, the linker is attached to amino acid X6. In some embodiments, the linker is attached to amino acid X7. In some embodiments, the linker is attached to amino acid X8. In some embodiments, the linker is attached to amino acid X9. In some embodiments, the linker is attached to amino acid X10. In some embodiments, the linker is attached to amino acid X11. In some embodiments, the linker is attached to amino acid X12. In some embodiments, the linker is attached to amino acid X1, X2, X3, X4, X8, or X12. In some embodiments, the linker is attached to a lysine of the peptide. In some embodiments, the linker comprises one or more amino acid residues. In some embodiments, the linker comprises a lysine residue, an alanine residue, a glycine residue, a D-phenylalanine residue, a histidine residue, a dAtb residue, or a D-glutamate residue. In some embodiments, the linker comprises 2 amino acids selected from the group consisting of lysine, alanine, glycine, D-phenylalanine, histidine, dAtb, and D-glutamate. In some embodiments, the linker is a C1-6heteroalkylene. In some embodiments, the linker is a bond.

[0155] In one aspect, described herein is a radiopharmaceutical conjugate with structure ofwhereinrepresents a linker; and R* is a covalently bound radionuclide.

[0156] In some embodiments, the radioph eutical conjugate comprises a covalently boundradionuclide. In some embodiments, the conjugate further comprises a linker that connects the peptide with the covalently bound radionuclide. In some embodiments, the linker covalently connects the peptide with the covalently bound radionuclide. In some embodiments, the linker covalently attaches the covalently bound radionuclide to the N-terminus of the peptide. In some embodiments, the linker covalently attaches the covalently bound radionuclide to the C-terminus of the peptide. In some embodiments, the linker is attached to the peptide via a non-terminal amino acid residue of the peptide. In some embodiments, the linker is attached to amino acid X1. In some embodiments, the linker is attached to amino acid X2. In some embodiments, the linker is attached to amino acid X3. In some embodiments, the linker is attached to amino acid X4. In some embodiments, the linker is attached to amino acid X5. In some embodiments, the linker is attached to amino acid X6. In some embodiments, the linker is attached to amino acid X7. In some embodiments, the linker is attached to amino acid X8. In some embodiments, the linker is attached to amino acid X9. In some embodiments, the linker is attached to amino acid X10. In some embodiments, the linker is attached to amino acid X11. In some embodiments, the linker is attached to amino acid X12. In some embodiments, the covalently bound radionuclide is directly covalently bound to an amino acid comprising an aromatic ring. In some embodiments, the covalent radionuclide is directly covalently bound to X5, X8, X9, X4, or X11. In some embodiments, the linker is a bond.

[0157] In some embodiments, described herein is a conjugate comprising: (a) a targeting moiety that comprises a monocyclic peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, and (b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide, or (ii) a covalently bound radionuclide. In some embodiments, described herein is a conjugate comprising: a monocyclic peptide that is configured to bind with GPC3 and a metal chelator configured to bind with a radionuclide. In some embodiments, described herein is a conjugate comprising: a monocyclic peptide that is configured to bind with GPC3 and a covalently bound radionuclide. In some embodiments, the monocyclic peptide is cyclized by a non-disulfide bond. In some embodiments, the monocyclic peptide does not comprise a disulfide bond. In some embodiments, the monocyclic peptide comprises 5 to 20 amino acid residues. In some embodiments, the monocyclic peptide comprises 7 to 14 amino acid residues. A conjugate described herein can further comprises a linker that covalently attaches the cyclic peptide to the metal chelator or covalent radionuclide. In some embodiments, the conjugate comprises a radionuclide such as225Ac bound to the metal chelator, or131I bound to the cyclic peptide..

[0158] In some embodiments, a herein-described conjugate comprises two or more peptides (i.e., a first peptide, a second peptide, etc.). For example, the conjugate can comprise two different peptides, wherein both of the peptides are configured to bind to the same target (e.g., GPC3), either at the same binding site or at different binding sites. For another example, the conjugate can comprise two different peptides, wherein the two peptides are configured to bind to different targets (including GPC3). For yet another example, the conjugate can comprise two identical peptides.

[0159] In some embodiments, a herein-described conjugate is in a salt form. In some embodiments, a herein-described conjugate is in a free-base form.

[0160] In some embodiments, the metal chelator is conjugated to the peptide, either directly or indirectlythrough a linker. In some embodiments, the metal chelator is conjugated to the peptide, either covalently or non-covalently.

[0161] In some embodiments, a conjugate of the present disclosure is selected from Tables 2, 3A-3B and 9. In some embodiments, a conjugate of the present disclosure comprises a peptide of Table 1, a chelator selected from FIGs 4-22, and a radionuclide of Table 7. Radiopharmaceutical Conjugate Having GPC3 Avidity

[0162] Glypican-3 (GPC3) is a protein that in humans is encoded by the GPC3 gene. GPC3 may be upregulated in multiple cancers, often correlating with disease progression, metastasis and poor prognosis e.g., in solid tumors such as hepatocellular, lung, gastric, and ovarian.

[0163] GPC3 belongs to the sulfate heparin proteoglycan family, and which is anchored on the cell membrane surface by phosphatidylinositol (GPI) anchor.

[0164] GPC3 can play an important role in the cell proliferation of embryo layer tissue. Deletion of GPC3 gene can cause excessive growth syndrome, namely Simpson-Golabi-Behmel syndrome (SGBS). GPC3 can be expressed throughout the entire fetal stage, and after birth to adult stage, except for placental, breast, mesodermal, ovarian, lung and kidney tissue with weak expression, other normal tissues have no obvious expression.

[0165] In some embodiments, the radiopharmaceutical conjugate of the present disclosure binds to GPC3. In some embodiments, the radiopharmaceutical conjugate has GPC3 antagonistic activity. In some embodiments, the radiopharmaceutical conjugate binds to human GPC3 (hGPC3) and has hGPC3 antagonistic activity, such as inhibiting the ability of GPC3 to promote or stabilize Wnt / Frizzled interaction and / or downstream signaling.

[0166] As used herein, the term “GPC3” refers to any form of GPC3 and a variant thereof for retaining at least a part of the activity of GPC3. The GPC3 includes all the native sequences of GPC3 in mammals such as, for example, humans, dogs, cats, horses, and cows, unless otherwise specifically described as human GPC3 (hGPC3). One exemplification of GPC3 is hGPC3 (Gene ID:2719), which is human GPC3 and is a protein having an amino acid sequence (SEQ ID NO: 398, Isoform 1, P51654-1): MAGTVRTACLVVAMLLSLDFPGQAQPPPPPPDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQV CLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNA MFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDI NECLRGARRDLKVFGNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRM WYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVL LGLFSTIHDSIQYVQKNAGKLTTTIGKLCAHSQQRQYRSAYYPEDLFIDKKVLKVAHVEHEETLS SRRRELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLHEL KMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVLDKNLDEEGFESGDCGDDEDECIGGSGDGMI KVKNQLRFLAELAYDLDVDDAPGNSQQATPKDNEISTFHNLGNVHSPLKLLTSMAISVVCFFFL VH.

[0167] As used herein, the expression “has avidity for GPC3” or “binds to GPC3” indicates the activityof binding to GPC3. Binding site of the peptide of the present disclosure on the GPC3 is not limited, the peptide can bind to anywhere on the GPC3 protein. Binding to GPC3 may be measured by any method for measuring known intermolecular binding. In a non-limiting manner, for example, this may be determined by competitive binding assays such as surface plasmon resonance (SPR) assays, scatter analysis and / or radioimmunoassays (RIA), enzyme immunoassays (EIA), and sandwich and competitive assays, and in any suitable manner which is known, including different variants of the examples given that are known in the technical field.

[0168] In one aspect, the binding affinity of the radiopharmaceutical conjugate of the present disclosure is at most 100 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some implementations, the Kd of the peptides of the radiopharmaceutical conjugates disclosed herein is 100 nM or less, 50 nM or less, 30 nM or less, 20 nM or less, 10 nM or less, 5 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1 nM or less, 0.9 nM or less, 0.5 nM or less, 0.4 nM or less, 0.3 nM or less, 0.2 nM or less, 0.1 nM or less, 0.09 nM or less, 0.08 nM or less, 0.07 nM or less, 0.06 nM or less, 0.05 nM or less, 0.04 nM or less, 0.03 nM or less, 0.02 nM or less, 0.01 nM or less.

[0169] In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 1, 5, 10, 50, 100, 200, 500, 1000, 5000 or 10,000 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 100nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 1 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 2 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 5 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, a radiopharmaceutical conjugate described herein has a binding affinity to a human GPC3 of at most 10 nM as determined by Kd in surface plasmon resonance (SPR) analysis.

[0170] In one aspect, the binding affinity of the peptide or radiopharmaceutical conjugate of the present disclosure is at most 100 nM as determined by Kd in surface plasmon resonance (SPR) analysis. In some embodiments, the Kd of the peptide or radiopharmaceutical conjugate of the present disclosure is 100 nM or less, 50 nM or less, 30 nM or less, 20 nM or less, 10 nM or less, 5 nM or less, 4 nM or less, 3 nM or less, 2 nM or less, 1 nM or less, 0.9 nM or less, 0.5 nM or less, 0.4 nM or less, 0.3 nM or less, 0.2 nM or less, 0.1 nM or less, 0.09 nM or less, 0.08 nM or less, 0.07 nM or less, 0.06 nM or less, 0.05 nM or less, 0.04 nM or less, 0.03 nM or less, 0.02 nM or less, 0.01 nM or less. GPC3 Peptide Binding Ligand

[0171] In one aspect, the disclosure relates to a radiopharmaceutical conjugate comprising a peptide (e.g., a binding peptide) that has avidity for Glypican-3 (GPC3). The GPC3 can be a mammalian GPC3. TheGPC3 can be a human GPC3. The GPC3 can be a wild-type or mutated GPC3. In some embodiments, the conjugate of the disclosure comprises two or more peptides, which can be the same or different. The peptide can be linear or cyclic. In some embodiments, the peptide is monocyclic. The peptide can comprise any suitable number of amino acid residues. In some embodiments, the peptide comprises from 5 to 50, 6 to 40, 7 to 30, 8 to 25, 12 to 25, or 9 to 20 amino acid residues. In some embodiments, the peptide comprises from 5 to 14 amino acid residues. In some embodiments, the peptide comprises from 7 to 12 amino acid residues. In some embodiments, the peptide comprises from 8 to 12 amino acid residues. In some embodiments, the peptide comprises from 8 to 10 amino acid residues. In some embodiments, the peptide comprises from 7 to 13 amino acid residues. In some embodiments, the peptide comprises from 12 to 15 amino acid residues. In some embodiments, the peptide comprises from 13 to 14 amino acid residues. In some embodiments, the peptide comprises 6 amino acid residues. In some embodiments, the peptide comprises 7 amino acid residues. In some embodiments, the peptide comprises 8 amino acid residues. In some embodiments, the peptide comprises 9 amino acid residues. In some embodiments, the peptide comprises 10 amino acid residues. In some embodiments, the peptide comprises 11 amino acid residues. In some embodiments, the peptide comprises 12 amino acid residues. In some embodiments, the peptide comprises 13 amino acid residues. In some embodiments, the peptide comprises 14 amino acid residues. In some embodiments, the peptide comprises 15 amino acid residues. In some embodiments, the peptide comprises 16 amino acid residues. In some embodiments, the peptide consists of 6 amino acid residues. In some embodiments, the peptide consists of 7 amino acid residues. In some embodiments, the peptide consists of 8 amino acid residues. In some embodiments, the peptide consists of 9 amino acid residues. In some embodiments, the peptide consists of 10 amino acid residues. In some embodiments, the peptide consists of 11 amino acid residues. In some embodiments, the peptide consists of 12 amino acid residues. In some embodiments, the peptide consists of 13 amino acid residues. In some embodiments, the peptide consists of 14 amino acid residues. In some embodiments, the peptide consists of 15 amino acid residues. In some embodiments, the peptide consists of 16 amino acid residues. In some embodiments, the conjugate comprises a monocyclic peptide of 6, 7, 8, 9, 10, 11, 12, 13, 14, or 15 amino acid residues. A peptide described herein can be a binding peptide that binds to GPC3. In some embodiments, the binding peptide consists of 6 to 20 amino acid residues. In some embodiments, the binding peptide consists of 7 to 12 amino acid residues. In some embodiments, the binding peptide consists of 10 to 12 amino acid residues. In some embodiments, the binding peptide consists of 8 to 12 amino acid residues. In some embodiments, the binding peptide is monocyclic. In some embodiments, the peptide of the present technology is an isolated peptide. In some embodiments, the peptide of the present technology is a purified peptide.

[0172] In one aspect, described herein is a radiopharmaceutical conjugate comprising: (a) a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence including deletion, substitution, and / or addition of one or several (e.g., 1-6) amino acids in the amino acid sequence of SEQ ID NO: 1: MeK-MeI-D-MeQ-F4COO-I-I-Y-MeNal27N-G-3Py6Ph-MeC (SEQ ID NO: 1), wherein the peptide consists of 10 to 12 amino acid residues; and(b) (i) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide; or (ii) a covalently bound radionuclide.

[0173] In some embodiments, the metal chelator is configured to bind with a radionuclide, wherein the metal chelator is bound to the peptide. In some embodiments, the radionuclide is bound to the metal chelator. In some embodiments, the radionuclide is a covalently bound radionuclide.

[0174] In some embodiments, the peptide comprises an amino acid sequence including a total of at most 6 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the peptide comprises an amino acid sequence including a total of at most 5 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the peptide comprises an amino acid sequence including a total of at most 4 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the peptide comprises an amino acid sequence including a total of at most 3 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the peptide comprises an amino acid sequence including a total of at most 2 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the peptide comprises an amino acid sequence including a total of at most 1 deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO:1. In some embodiments, the amino acid substitution is a conservative amino acid substitution. The deletion, addition, or substitution position may be either the end or middle of the peptide. In some embodiments, the MeI at position 2 is deleted from SEQ ID NO: 1. In some embodiments, the D at position 3 is deleted from SEQ ID NO: 1. In some embodiments, the peptide of SEQ ID NO: 1 is a cyclic peptide. In some embodiments, the peptide is a monocyclic peptide. In some embodiments, 1, 2, 3, 4 or 5 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 1, 2, or 3 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 1 or 2 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 5 amino acids are added to the peptide of SEQ ID NO: 1. In some embodiments, 4 amino acids are added to the peptide of SEQ ID NO: 1 In some embodiments, 3 amino acids are added to the peptide of SEQ ID NO: 1 In some embodiments, 2 amino acids are added to the peptide of SEQ ID NO: 1 In some embodiments, 1 amino acids is added to the peptide of SEQ ID NO: 1 The amino acid addition may be at either the N-terminus, the C-terminus, or the middle of the peptide of SEQ ID NO: 1.

[0175] In one aspect, described herein is a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I): X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein, X1 is any amino acid; X2 is absent or any amino acid; X3 is absent or any amino acid;X4 is any amino acid; X5 is an amino acid comprising an aromatic ring (e.g., W, F, Y, or a variant thereof), cycloalkyl, or heterocycloalkyl group, or X5 is a peptoid (e.g., Cha4cH, Cha4tH, A1mor, Atp, Cha4cOMe); X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted (e.g., X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg); X8 is an A, I, L, V, Y or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G, A, or a D-amino acid (e.g., da, ds, de, or dp); X11 is an amino acid comprising an aromatic ring (e.g., F, Y, or a variant thereof); and, X12 is N-alkylated cysteine (e.g., MeC).

[0176] In some embodiments, the peptide of Formula (I) is a cyclic peptide. In some embodiments, the peptide is a monocyclic peptide.

[0177] In some embodiments, a peptide of Formula (I) is a cyclic peptide. In some embodiments, the cyclic peptide of Formula (I) has the structure of Formula (I-1):wherein, R1is selected from the group consisting of -NH2and -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis selected from the group consisting of -S-, -CH2-, or -O-; and wherein X1 to X11 have the definitions described in Formula (I).

[0178] In some embodiments, a peptide of Formula (I-1) has the structure of Formula (I-2):wherein X1 to X11 have the definitions described in Formula (I).

[0179] In some embodiments, a peptide of Formula (I) is a cyclic peptide and X2 is absent. In some embodiments, the cyclic peptide of Formula (I) has the structure of Formula (I-3):wherein, R1is selected from the group consisting of -NH2and -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis selected from the group consisting of -S-, -CH2-, or -O-; and wherein X1 to X11 have the definitions described in Formula (I).

[0180] In some embodiments, a peptide of Formula (I-3) has the structure of Formula (I-4):wherein X1 to X11 have the definitions described in Formula (I).

[0181] In some embodiments, the peptide of Formula (I) has a structure of Formula (I-5), or a pharmaceutically acceptable salt thereof:wherein X1-X12 have the definition described for Formula (I) and Lcyc is a ring closing group that covalently connecting X1 with X12. In some embodiments, the Lcyc is a group selected from Table 4B. In some embodiments, the Lcyc is formed by reacting the first and the second functional groups in Table 4C.

[0182] In one aspect, described herein is a radiopharmaceutical conjugate comprising: a peptide that has avidity for Glypican 3 (GPC3), or a pharmaceutically acceptable salt thereof, wherein the peptide comprises an amino acid sequence of Formula (I): X1-X2-X3-X4-X5-X6-X7-X8-X9-X10-X11-X12 Formula (I) wherein, X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 iswherein: Rn5is hydrogen or C1-3alkyl; ring A5 is an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl; each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX5-heterocycloalkyl, -LX5-cycloalkyl, -LX5-aryl, or -LX5-heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O, =S, or =N(Ra); LX5is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa- , wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a; kx5 is 0, 1, 2, or 3;mx5 is 0, 1, 2, 3, 4, or 5; *X4 represents the point of attachment to X4; and *X6 represents the point of attachment to X6; X6 iswherein; Rn6is hydrogen or C1-3alkyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX6- heterocycloalkyl, -LX6-cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; or Rn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a; LX6is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a; *X5 represents the point of attachment to X5; and *X7 represents the point of attachment to X7; X7 is, wherein: Rn7is hydrogen or C1-3alkyl ; RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, cycloalkyl, or heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a; *X6 represents the point of attachment to X6; and *X8 represents the point of attachment to X8;X8 iswherein; Rn8is hydrogen or C1-3alkyl; ring A8 is an aryl or heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX8-heterocycloalkyl, -LX8-cycloalkyl, -LX8-aryl, or -LX8-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O, =S, or =N(Ra); LX8is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a; kx8 is 0, 1, 2, or 3; mx8 is 0, 1, 2, 3, 4, or 5; *X7 represents the point of attachment to X7; and *X9 represents the point of attachment to X9; X9 iswherein: Rn9is hydrogen or C1-3alkyl; ring A9 is an aryl or heteroaryl; each RX9is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O, =S, or =N(Ra); kx9 is 0, 1, 2, or 3;mx9 is 0, 1, 2, 3, 4, or 5; *X8 represents the point of attachment to X8; and *X10 represents the point of attachment to X10; X10 is glycine or a D-amino acid (e.g., da, ds, de, or dp); X11 iswherein: Rn11is hydrogen or C1-3alkyl; ring A11 is an aryl or heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX11- heterocycloalkyl, -LX11-cycloalkyl, -LX11-aryl, or -LX11-heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O, =S, or =N(Ra); LX11is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a; kx11 is 0, 1, 2, 3, 4, or 5; mx11 is 0, 1, 2, 3, 4, or 5; *X10 represents the point of attachment to X10; and, *X12 represents the point of attachment to X12; X12 is N-alkylated cysteine; each of RX5a, RX6a, RX7a, RX8a, RX9a, and RX11ais independently halogen, C1-6alkyl, C1- C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2- C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, - S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, - NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, - NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), - P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re.each Rais independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; each Reis independently halogen, -CN, -OH, -O-C1-C6alkyl, -SF5, -S(=O)C1-C6alkyl, - S(=O)2C1-C6alkyl, -S(=O)2NH2, -S(=O)2-halogen, -S(=O)2NHC1-C6alkyl, - S(=O)2N(C1-C6alkyl)2, -NH2, -NHC1-C6alkyl, -N(C1-C6alkyl)2, -NHC(=NH)NH2, - NHC(=O)OC1-C6alkyl, -C(=O)C1-C6alkyl, -C(=O)OH, C1-C6alkyl-C(=O)OH, - C(=O)OC1-C6alkyl, -C(=O)NH2, -C(=O)N(C1-C6alkyl)2, -C(=O)NHC1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, or C1-C6heteroalkyl; or two Reare taken together to form =O; and each Rcand Rdare independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; or Rcand Rdare taken together with the atom to which they are attached to form a heterocycloalkyl optionally substituted with one or more Re.

[0183] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X1 is an N-methylated amino acid. In some embodiments X1 is an N-methylated amino acid comprising a polar side chain (e.g., MeK, MeQ, or a variant thereof).

[0184] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa, MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb). In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa, MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb), each of which is optionally substituted. In some embodiments, X1 is optionally substituted I. In some embodiments, X1 is optionally substituted R. In some embodiments, X1 is optionally substituted Cit. In some embodiments, X1 is optionally substituted F4G. In some embodiments, X1 is optionally substituted 4Py. In some embodiments, X1 is optionally substituted 3Py. In some embodiments, X1 is optionally substituted KCOpipzaa. In some embodiments, X1 is optionally substituted V. In some embodiments, X1 is optionally substituted Eva. In some embodiments, X1 is optionally substituted Q. In some embodiments, X1 is optionally substituted E. In some embodiments, X1 is optionally substituted MeI. In someembodiments, X1 is optionally substituted Ahp. In some embodiments, X1 is optionally substituted F4COO. In some embodiments, X1 is optionally substituted KCOpip4COO. In some embodiments, X1 is optionally substituted MeQdMe. In some embodiments, X1 is optionally substituted MeA. In some embodiments, X1 is optionally substituted MeSMe. In some embodiments, X1 is optionally substituted MeG. In some embodiments, X1 is optionally substituted MeV. In some embodiments, X1 is optionally substituted MeHseMe. In some embodiments, X1 is optionally substituted Aib. In some embodiments, X1 is optionally substituted MeT. In some embodiments, X1 is optionally substituted alI. In some embodiments, X1 is optionally substituted TMe. In some embodiments, X1 is optionally substituted MeKCOpipzaa. In some embodiments, X1 is optionally substituted MeQ. In some embodiments, X1 is optionally substituted Hpr. In some embodiments, X1 is optionally substituted MeTMe. In some embodiments, X1 is optionally substituted MeDapCOpipzaa. In some embodiments, X1 is optionally substituted MeK. In some embodiments, X1 is optionally substituted MeKAc. In some embodiments, X1 is optionally substituted MeK(de). In some embodiments, X1 is optionally substituted MeK(H). In some embodiments, X1 is optionally substituted MeK(df). In some embodiments, X1 is optionally substituted MeK(datb). In some embodiments, X1 is MeQ or a derivative thereof. In some embodiments, X1 is MeK or a derivative thereof.

[0185] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X1 is any amino acid. In some embodiments, X1 is a D-amino acid. In some embodiments, X1 is an L-amino acid. In some embodiments, X1 is an N-alkylated amino acid.. In some embodiments, X1 is an N-methylated amino acid. In some embodiments, X1 does not comprise a cyclic group. In some embodiments, X1 comprises a cyclic group. In some embodiments, X1 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X1 comprises a 5-6 membered heteroaryl group. In some embodiments, X1 comprises a phenyl group. In some embodiments, X1 is a peptoid.

[0186] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X1 has a structure ofwherein: Rn1is hydrogen or C1-3alkyl; RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX1-heterocycloalkyl, - LX1-cycloalkyl, -LX1-aryl, or -LX1-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a; RX1’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX1a; orRn1and RX1’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX1a; LX1is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX1a; each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, - OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X12 represents the point of attachment to X12, or *X12 represents the point of attachment to C(O)(CH2)kxR(e.g., in Formula (I-1) and (I-2)); *X2 represents the point of attachment to X2; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I). In some embodiments, X1 has a structure of.In some embodiments, X1 has a structure of.

[0187] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X1 has a structure of,wherein: Rn1is hydrogen or methyl; RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX1-5-6 membered heterocycloalkyl, -LX1-C4-6cycloalkyl, -LX1-C6-10aryl, or -LX1-5-10 memberedheteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a; RX1’is hydrogen or methyl; or Rn1and RX1’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX1a; LX1is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX1a; each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X12 represents the point of attachment to X12, or *X12 represents the point of attachment to C(O)(CH2)kxR(e.g., in Formula (I-1) and (I-2); *X2 represents the point of attachment to X2; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0188] In some embodiments, Rn1is hydrogen. In some embodiments, Rn1is C1-3alkyl. In some embodiments, Rn1is methyl.

[0189] In some embodiments, RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX1- heterocycloalkyl, -LX1-cycloalkyl, -LX1-aryl, or -LX1-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a.

[0190] In some embodiments, RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX1-5-6 membered heterocycloalkyl, -LX1-C4-6cycloalkyl, -LX1-C6-10aryl, or -LX1-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a. In some embodiments, RX1is hydrogen, C1-6alkyl, C1-6heteroalkyl, -LX1-piperidinyl, -LX1-piperazinyl, -LX1-phenyl, or -LX1-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX1a.

[0191] In some embodiments, RX1is hydrogen. In some embodiments, RX1is optionally substituted C1-6alkyl. In some embodiments, RX1is C1-6alkyl optionally substituted with one or more RX1a. In some embodiments, RX1is optionally substituted C1-6heteroalkyl. In some embodiments, RX1is C1-6heteroalkyl optionally substituted with one or more RX1a. In some embodiments, RX1is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, or C1-6heteroalkyl, wherein each of which is optionally substituted withone or more RX1a. In some embodiments, RX1is C1-6aminoalkyl. In some embodiments, RX1is -(CH)1-6NH2. In some embodiments, RX1is -(CH)4NH2. In some embodiments, RX1is C2-6alkenyl or C2-6alkynyl, wherein each of which is optionally substituted with one or more RX1a. In some embodiments, RX1is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX1a. In some embodiments, RX1is aryl or heteroaryl, wherein each of which is optionally substituted with one or more RX1a. In some embodiments, RX1is cycloalkyl or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX1a. In some embodiments, RX1is -LX1-heterocycloalkyl, -LX1- cycloalkyl, -LX1-aryl, or -LX1-heteroaryl, wherein each of which is optionally substituted with one or more RX1a. In some embodiments, RX1is -LX1-heterocycloalkyl, which is optionally substituted with one or more RX1a. In some embodiments, RX1is -LX1- cycloalkyl, which is optionally substituted with one or more RX1a. In some embodiments, RX1is -LX1-aryl, which is optionally substituted with one or more RX1a. In some embodiments, RX1is -LX1-heteroaryl, which is optionally substituted with one or more RX1a.

[0192] In some embodiments, RX1’is hydrogen. In some embodiments, RX1’is C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX1a. In some embodiments, RX1’is C1-6alkyl. In some embodiments, RX1’is methyl.

[0193] In some embodiments, Rn1and RX1’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX1a.

[0194] In some embodiments, LX1is C1-6alkylene, wherein the alkylene is optionally substituted with one or more RX1a. In some embodiments, LX1is C1-6alkylene. In some embodiments, LX1is C1-6heteroalkylene, wherein the heteroalkylene is optionally substituted with one or more RX1a. In some embodiments, LX1is C1-6heteroalkylene. In some embodiments, LX1is -O-. In some embodiments, LX1is -S-. In some embodiments, LX1is -NRa-. In some embodiments, LX1is -NH-.

[0195] In some embodiments, each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, cycloalkyl, heterocycloalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0196] In some embodiments, each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0197] In some embodiments, each RX1ais independently C1-6alkyl, C1-6alkoxyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, OH, -CN, -NO2, NH2, -C(=O)Ra, -C(=O)ORa, -NRaC(=O)NRcRd, or oxo.

[0198] In some embodiments, Rn1is methyl, RX1’is hydrogen, and RX1is C1-6aminoalkyl. In some embodiments, Rn1is methyl, RX1’is hydrogen, and RX1is C3-6aminoalkyl. In some embodiments, Rn1ismethyl, RX1’is hydrogen, and RX1is C3-6alkyl, which the alkyl is substituted with an amino.

[0199] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X2 is absent or an L-amino acid. In some embodiments, X2 is absent. In some embodiments, X2 is an L-amino acid. In some embodiments, X2 is a N-methylated amino acid.

[0200] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa, each of which is optionally substituted. In some embodiments, X2 is optionally substituted I. In some embodiments, X2 is optionally substituted K. In some embodiments, X2 is optionally substituted Cit. In some embodiments, X2 is optionally substituted F4G. In some embodiments, X2 is optionally substituted 4Py. In some embodiments, X2 is optionally substituted 3Py. In some embodiments, X2 is optionally substituted KCOpipzetOH. In some embodiments, X2 is optionally substituted V. In some embodiments, X2 is optionally substituted KCOpipzaa. In some embodiments, X2 is optionally substituted Eva. In some embodiments, X2 is optionally substituted Q. In some embodiments, X2 is optionally substituted E. In some embodiments, X2 is optionally substituted S. In some embodiments, X2 is optionally substituted MeL. In some embodiments, X2 is optionally substituted HseMe. In some embodiments, X2 is optionally substituted MeY. In some embodiments, X2 is optionally substituted Me3Py. In some embodiments, X2 is optionally substituted Ahp. In some embodiments, X2 is optionally substituted F4COO. In some embodiments, X2 is optionally substituted KCOpip4COO. In some embodiments, X2 is optionally substituted MeQdMe. In some embodiments, X2 is optionally substituted MeA. In some embodiments, X2 is optionally substituted MeSMe. In some embodiments, X2 is optionally substituted MeG. In some embodiments, X2 is optionally substituted MeI. In some embodiments, X2 is optionally substituted MeV. In some embodiments, X2 is optionally substituted MeHseMe. In some embodiments, X2 is optionally substituted MeKAc. In some embodiments, X2 is optionally substituted alI. In some embodiments, X2 is optionally substituted TMe. In some embodiments, X2 is optionally substituted MeKCOpipzaa. In some embodiments, X2 is optionally substituted MeQ. In some embodiments, X2 is optionally substituted Hpr. In some embodiments, X2 is optionally substituted MeTMe. In some embodiments, X2 is optionally substituted. In some embodiments, X2 is optionally substituted MeDapCOpipzaaa.

[0201] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X2 is any amino acid. In some embodiments, X2 is a D-amino acid. In some embodiments,X2 is an L-amino acid. In some embodiments, X2 is an N-alkylated amino acid. In some embodiments, X2 is an N-methylated amino acid. In some embodiments, X2 does not comprise a cyclic group. In some embodiments, X2 comprises a cyclic group. In some embodiments, X2 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X2 comprises a 5-6 membered heteroaryl group. In some embodiments, X2 comprises a phenyl group. In some embodiments, X2 is a peptoid.

[0202] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X2 has a structure of,wherein, Rn2is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX2a; RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX2-heterocycloalkyl, -LX2- cycloalkyl, -LX2-aryl, or -LX2-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a; RX2’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX2a; or Rn2and RX2’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX2a; LX2is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX2a; each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X1 represents the point of attachment to X1; *X3 represents the point of attachment to X3; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0203] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X2 has a structure of,wherein: Rn2is hydrogen or methyl; RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX2-5-6 membered heterocycloalkyl, -LX2-C4-6cycloalkyl, -LX2-C6-10aryl, or -LX2-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a; RX2’is hydrogen or methyl; or Rn2and RX2’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX2a; LX2is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX2a; each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, - P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X1 represents the point of attachment to X1; *X3 represents the point of attachment to X3; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0204] In some embodiments, Rn2is hydrogen. In some embodiments, Rn2is C1-3alkyl. In some embodiments, Rn2is methyl.

[0205] In some embodiments, RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX2- heterocycloalkyl, -LX2-cycloalkyl, -LX2-aryl, or -LX2-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a.

[0206] In some embodiments, RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX2-5-6 membered heterocycloalkyl, -LX2-C4-6cycloalkyl, -LX2-C6-10aryl, or -LX2-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a. In some embodiments, RX2is hydrogen,C1-6alkyl, C1-6heteroalkyl, -LX2-piperidinyl, LX2-piperazinyl, -LX2-phenyl, or -LX2-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX2a.

[0207] In some embodiments, RX2is hydrogen. In some embodiments, RX2is optionally substituted C1-6alkyl. In some embodiments, RX2is C1-6alkyl optionally substituted with one or more RX2a. In some embodiments, RX2is optionally substituted C1-6heteroalkyl. In some embodiments, RX2is C1-6heteroalkyl optionally substituted with one or more RX2a. In some embodiments, RX2is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, or C1-6heteroalkyl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is C2-6alkenyl or C2-6alkynyl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is aryl or heteroaryl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is cycloalkyl or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is -LX2-heterocycloalkyl, -LX2-cycloalkyl, -LX2-aryl, or -LX2-heteroaryl, wherein each of which is optionally substituted with one or more RX2a. In some embodiments, RX2is -LX2-heterocycloalkyl, which is optionally substituted with one or more RX2a. In some embodiments, RX2is -LX2- cycloalkyl, which is optionally substituted with one or more RX2a. In some embodiments, RX2is -LX2-aryl, which is optionally substituted with one or more RX2a. In some embodiments, RX2is -LX2-heteroaryl, which is optionally substituted with one or more RX2a.

[0208] In some embodiments, RX2’is hydrogen. In some embodiments, RX2’is C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX2a. In some embodiments, RX2’is C1-6alkyl. In some embodiments, RX2’is methyl.

[0209] In some embodiments, Rn2and RX2’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX2a.

[0210] In some embodiments, LX2is C1-6alkylene, wherein the alkylene is optionally substituted with one or more RX2a. In some embodiments, LX2is C1-6alkylene. In some embodiments, LX2is C1-6heteroalkylene, wherein the heteroalkylene is optionally substituted with one or more RX2a. In some embodiments, LX2is C1-6heteroalkylene. In some embodiments, LX2is -O-. In some embodiments, LX2is -S-. In some embodiments, LX2is -NRa-. In some embodiments, LX2is -NH-.

[0211] In some embodiments, each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, cycloalkyl, heterocycloalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0212] In some embodiments, each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0213] In some embodiments, each RX2ais independently C1-6alkyl, C1-6alkoxyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, OH, -CN, -NO2, NH2, -C(=O)Ra, -C(=O)ORa, -NRaC(=O)NRcRd, or oxo.

[0214] In some embodiments, Rn2is methyl, RX2’is hydrogen, and RX2is C1-6alkyl. In some embodiments, Rn2is methyl, RX2’is hydrogen, and RX2is branched C1-6alkyl. In some embodiments, Rn2is methyl, RX2’is hydrogen, and RX2is branched C3-6alkyl. In some embodiments, RX2is -CH(CH3)CH2CH3.

[0215] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X3 is a polar and / or an L-amino acid. In some embodiments, X3 is an amino acid comprising a hydrophilic side chain (e.g., D, K, Q, or a variant thereof) or an N-methylated variant thereof. In some embodiments, X3 is absent.

[0216] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, KAc, Hgn, MeY, or DapCOpipzaa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, KAc, Hgn, MeY, or DapCOpipzaa, each of which is optionally substituted. In some embodiments, X3 is optionally substituted D. In some embodiments, X3 is optionally substituted Har. In some embodiments, X3 is optionally substituted KCOpipzetOH. In some embodiments, X3 is optionally substituted Cit. In some embodiments, X3 is optionally substituted KCOmeglumine. In some embodiments, X3 is optionally substituted KCOpipzaa. In some embodiments, X3 is optionally substituted A4paa. In some embodiments, X3 is optionally substituted Q. In some embodiments, X3 is optionally substituted A. In some embodiments, X3 is optionally substituted E. In some embodiments, X3 is optionally substituted MeD. In some embodiments, X3 is optionally substituted S. In some embodiments, X3 is optionally substituted N. In some embodiments, X3 is optionally substituted Hgl. In some embodiments, X3 is optionally substituted F4COO. In some embodiments, X3 is optionally substituted KCOpip4COO. In some embodiments, X3 is optionally substituted KAc. In some embodiments, X3 is optionally substituted Hgn. In some embodiments, X3 is optionally substituted MeY. In some embodiments, X3 is optionally substituted DapCOpipzaa.

[0217] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X3 is any amino acid. In some embodiments, X3 is a D-amino acid. In some embodiments, X3 is an L-amino acid. In some embodiments, X3 is an N-alkylated amino acid. In some embodiments, X3 is an N-methylated amino acid. In some embodiments, X3 does not comprise a cyclic group. In some embodiments, X3 comprises a cyclic group. In some embodiments, X3 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X3 comprises a 5-6 membered heteroaryl group. In some embodiments, X3 comprises a phenyl group. In some embodiments, X3 is a peptoid. In some embodiments, X3 is a polar amino acid.

[0218] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2),(IV-1), or (IV-2), X3 has a structure of,wherein: Rn3is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX3a; RX3is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX3-heterocycloalkyl, -LX3-cycloalkyl, - LX3-aryl, or -LX3-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a; RX3’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX3a; or Rn3and RX3’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX3a; LX3is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX3a; each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1- C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X2 represents the point of attachment to X2; *X4 represents the point of attachment to X4; other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0219] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X3 has a structure of, wherein: Rn3is hydrogen or methyl;RX3is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX3-5-6 membered heterocycloalkyl, -LX3-C3-6cycloalkyl, -LX3-C6-10aryl, or -LX3-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a; LX3is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX3a; each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1- C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X2 represents the point of attachment to X2; *X4 represents the point of attachment to X4; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0220] In some embodiments, Rn3is hydrogen. In some embodiments, Rn3is C1-3alkyl. In some embodiments, Rn3is methyl.

[0221] In some embodiments, RX3is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX3- heterocycloalkyl, -LX3-cycloalkyl, -LX3-aryl, or -LX3-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a. In some embodiments, RX3is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX3-5-6 membered heterocycloalkyl, -LX3-C3-6cycloalkyl, -LX3-C6-10aryl, or -LX3-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a.

[0222] In some embodiments, RX3is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX3-5-6 membered heterocycloalkyl, -LX3-C4-6cycloalkyl, -LX3-C6-10aryl, or -LX3-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a. In some embodiments, RX3is hydrogen, C1-6alkyl, C1-6heteroalkyl, -LX3-piperidinyl, LX3-piperazinyl, -LX3-phenyl, or -LX3-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX3a.

[0223] In some embodiments, RX3is hydrogen. In some embodiments, RX3is optionally substituted C1-6alkyl. In some embodiments, RX3is C1-6alkyl optionally substituted with one or more RX3a. In some embodiments, RX3is optionally substituted C1-6heteroalkyl. In some embodiments, RX3is C1-6heteroalkyl optionally substituted with one or more RX3a. In some embodiments, RX3is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, or C1-6heteroalkyl, wherein each of which is optionally substituted withone or more RX3a. In some embodiments, RX3is C2-6alkenyl or C2-6alkynyl, wherein each of which is optionally substituted with one or more RX3a. In some embodiments, RX3is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX3a. In some embodiments, RX3is aryl or heteroaryl, wherein each of which is optionally substituted with one or more RX3a. In some embodiments, RX3is cycloalkyl or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX3a. In some embodiments, RX3is -LX3-heterocycloalkyl, -LX3-cycloalkyl, -LX3-aryl, or -LX3-heteroaryl, wherein each of which is optionally substituted with one or more RX3a. In some embodiments, RX3is -LX3-heterocycloalkyl, which is optionally substituted with one or more RX3a. In some embodiments, RX3is -LX3- cycloalkyl, which is optionally substituted with one or more RX3a. In some embodiments, RX3is -LX3-aryl, which is optionally substituted with one or more RX3a. In some embodiments, RX3is -LX3-heteroaryl, which is optionally substituted with one or more RX3a.

[0224] In some embodiments, RX3’is hydrogen. In some embodiments, RX3’is C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX3a. In some embodiments, RX3’is C1-6alkyl. In some embodiments, RX3’is methyl.

[0225] In some embodiments, Rn3and RX3’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX3a.

[0226] In some embodiments, LX3is C1-6alkylene, wherein the alkylene is optionally substituted with one or more RX3a. In some embodiments, LX3is C1-6alkylene. In some embodiments, LX3is C1-6heteroalkylene, wherein the heteroalkylene is optionally substituted with one or more RX3a. In some embodiments, LX3is C1-6heteroalkylene. In some embodiments, LX3is -O-. In some embodiments, LX3is -S-. In some embodiments, LX3is -NRa-. In some embodiments, LX3is -NH-.

[0227] In some embodiments, each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, cycloalkyl, heterocycloalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0228] In some embodiments, each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0229] In some embodiments, each RX3ais independently C1-6alkyl, C1-6alkoxyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, OH, -CN, -NO2, NH2, -C(=O)Ra, -C(=O)ORa, -NRaC(=O)NRcRd, or oxo.

[0230] In some embodiments, Rn3is hydrogen, RX3’is hydrogen, and RX3is C1-6alkyl optionally substituted with one or more RX3a. In some embodiments, Rn3is hydrogen, RX3’is hydrogen, and RX3is C1-3alkyl optionally substituted with one or more RX3a. In some embodiments, Rn3is hydrogen, RX3’ishydrogen, and RX3is C1-3alkyl substituted with -COOH.

[0231] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X4 is a polar and / or an L-amino acid. In some embodiments, X4 is an N-methylated amino acid, a polar amino acid (e.g., D, K, Q, S, or a variant thereof), or peptoid (e.g. EtG, MeeG, CmG, CmpG CrmG, CeG, or CrpG).

[0232] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV- 1), or (IV-2), X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa, each of which is optionally substituted. In some embodiments, X4 is optionally substituted D. In some embodiments, X4 is optionally substituted Har. In some embodiments, X4 is optionally substituted KCOpipzetOH. In some embodiments, X4 is optionally substituted KCOmeglumine. In some embodiments, X4 is optionally substituted KCOpipzaa. In some embodiments, X4 is optionally substituted A4paa. In some embodiments, X4 is optionally substituted Q. In some embodiments, X4 is optionally substituted A. In some embodiments, X4 is optionally substituted E. In some embodiments, X4 is optionally substituted MeD. In some embodiments, X4 is optionally substituted S. In some embodiments, X4 is optionally substituted N. In some embodiments, X4 is optionally substituted Hgl. In some embodiments, X4 is optionally substituted F4COO. In some embodiments, X4 is optionally substituted KCOpip4COO. In some embodiments, X4 is optionally substituted dd. In some embodiments, X4 is optionally substituted MeQ. In some embodiments, X4 is optionally substituted MeQdMe. In some embodiments, X4 is optionally substituted MeA. In some embodiments, X4 is optionally substituted MeSMe. In some embodiments, X4 is optionally substituted MeG. In some embodiments, X4 is optionally substituted EtG. In some embodiments, X4 is optionally substituted MeeG. In some embodiments, X4 is optionally substituted CmG. In some embodiments, X4 is optionally substituted CmpG. In some embodiments, X4 is optionally substituted CrmG. In some embodiments, X4 is optionally substituted CeG. In some embodiments, X4 is optionally substituted CrpG. In some embodiments, X4 is optionally substituted MeK. In some embodiments, X4 is optionally substituted MeKAc. In some embodiments, X4 is optionally substituted MeHgl. In some embodiments, X4 is optionally substituted Hgn. In some embodiments, X4 is optionally substituted MeDapCOpipzaa. In some embodiments, X4 is optionally substituted MeKCOpipzaa. In some embodiments, X4 is optionally substituted Medd. In some embodiments, X4 is optionally substituted Cit. In some embodiments, X4 is optionally substituted MeCit. In some embodiments, X4 is optionally substituted MeN. In some embodiments, X4 is optionally substituted MeS. In some embodiments, X4 is optionally substituted MeE. In some embodiments, X4 is optionally substituted MeY. In some embodiments, X4 is optionally substituted W5N. In someembodiments, X4 is optionally substituted MeA4paa.

[0233] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X4 is any amino acid. In some embodiments, X4 is a D-amino acid. In some embodiments, X4 is an L-amino acid. In some embodiments, X4 is an N-alkylated amino acid. In some embodiments, X4 is an N-methylated amino acid. In some embodiments, X4 does not comprise a cyclic group. In some embodiments, X4 comprises a cyclic group. In some embodiments, X4 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X4 comprises a 5-6 membered heteroaryl group. In some embodiments, X4 comprises a phenyl group. In some embodiments, X4 is a peptoid. In some embodiments, X4 is a polar amino acid.

[0234] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X4 has a structure of,wherein: Rn4is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX4a; RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX4-heterocycloalkyl, -LX4-cycloalkyl, - LX4-aryl, or -LX4-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a; RX4’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX4a; or Rn4and RX4’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX4a; LX4is C1-6alkylene or C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX4a; each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1- C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X3 represents the point of attachment to X3; *X5 represents the point of attachment to X5; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0235] In some embodiments of a peptide of F ula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2),(IV-1), or (IV-2), X4 has a structure of, wherein: Rn4is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX4a; RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX4-5-6 membered heterocycloalkyl, -LX4-C3-6cycloalkyl, -LX4-C6-10aryl, or -LX4-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a; LX4is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX4a; each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1- C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X3 represents the point of attachment to X3; *X5 represents the point of attachment to X5; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0236] In some embodiments, Rn4is hydrogen. In some embodiments, Rn4is C1-3alkyl. In some embodiments, Rn4is methyl.

[0237] In some embodiments, RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX4- heterocycloalkyl, -LX4-cycloalkyl, -LX4-aryl, or -LX4-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a. In some embodiments, RX4is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX4-5-6 membered heterocycloalkyl, -LX4-C3-6cycloalkyl, -LX4-C6-10aryl, or -LX4-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a.

[0238] In some embodiments, RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX4-5-6 membered heterocycloalkyl, -LX4-C4-6cycloalkyl, -LX4-C6-10aryl, or-LX4-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a. In some embodiments, RX4is hydrogen, C1-6alkyl, C1-6heteroalkyl, -LX4-piperidinyl, LX4-piperazinyl, -LX4-phenyl, or -LX4-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX4a.

[0239] In some embodiments, RX4is hydrogen. In some embodiments, RX4is optionally substituted C1-6alkyl. In some embodiments, RX4is C1-6alkyl optionally substituted with one or more RX4a. In some embodiments, RX4is optionally substituted C1-6heteroalkyl. In some embodiments, RX4is C1-6heteroalkyl optionally substituted with one or more RX4a. In some embodiments, RX4is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, or C1-6heteroalkyl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is C2-6alkenyl or C2-6alkynyl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is aryl or heteroaryl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is cycloalkyl or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is -LX4-heterocycloalkyl, -LX4-cycloalkyl, -LX4-aryl, or -LX4-heteroaryl, wherein each of which is optionally substituted with one or more RX4a. In some embodiments, RX4is -LX4-heterocycloalkyl, which is optionally substituted with one or more RX4a. In some embodiments, RX4is -LX4- cycloalkyl, which is optionally substituted with one or more RX4a. In some embodiments, RX4is -LX4-aryl, which is optionally substituted with one or more RX4a. In some embodiments, RX4is -LX4-heteroaryl, which is optionally substituted with one or more RX4a.

[0240] In some embodiments, RX4’is hydrogen. In some embodiments, RX4’is C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX4a. In some embodiments, RX4’is C1-6alkyl. In some embodiments, RX4’is methyl.

[0241] In some embodiments, Rn4and RX4’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX4a.

[0242] In some embodiments, LX4is C1-6alkylene, wherein the alkylene is optionally substituted with one or more RX4a. In some embodiments, LX4is C1-6alkylene. In some embodiments, LX4is C1-6heteroalkylene, wherein the heteroalkylene is optionally substituted with one or more RX4a. In some embodiments, LX4is C1-6heteroalkylene. In some embodiments, LX4is -O-. In some embodiments, LX4is -S-. In some embodiments, LX4is -NRa-. In some embodiments, LX4is -NH-.

[0243] In some embodiments, each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, cycloalkyl, heterocycloalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0244] In some embodiments, each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0245] In some embodiments, each RX4ais independently C1-6alkyl, C1-6alkoxyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, OH, -CN, -NO2, NH2, -C(=O)Ra, -C(=O)ORa, -NRaC(=O)NRcRd, or oxo. In some embodiments, each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, -ORa, -CN, -NO2, NH2, -C(=O)Ra, -C(=O)ORa, -NRaC(=O)NRcRd, or oxo.

[0246] In some embodiments, Rn4is methyl, RX4’is hydrogen, and RX4is C1-6alkyl optionally substituted with one or more RX4a. In some embodiments, Rn4is methyl, RX4’is hydrogen, and RX4is C1-3alkyl optionally substituted with one or more RX4a. In some embodiments, Rn4is methyl, RX4’is hydrogen, and RX4is C1-6alkyl optionally substituted with one or more -C(=O)NH2. In some embodiments, Rn4is methyl, RX4’is hydrogen, and RX4is C1-3alkyl substituted with -C(=O)NH2.

[0247] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X5 has an aromatic side chain, such as F, Y, or a variant thereof. In some embodiments, X5 is F, or a variant thereof comprising a phenyl, pyridinyl, or naphthalyl, wherein said phenyl, pyridinyl, or naphthalyl is optionally substituted with one or more substituents each independently selected from halogen, -C1-3alkyl, -OH, -NH2, -CN, -C(=O)OH, -C(=O)NH2, -NHC(=O)CH3, -C1-3alkylene-C(=O)OH, -C1-3alkylene- C(=O)NH2, -O-C1-3alkylene-C(=O)OH, -O-C1-3alkylene-C(=O)NH2, -C1-3alkylene-C(=O)-5- to 6- membered heterocycloalkylene-C1-3alkylene-C(=O)OH, -O-C1-3alkylene-C(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH, -C1-3alkylene-NHC(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH, -O-C1-3alkylene-NHC(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH, and -NH-C1-3alkylene-C(=O)OH. In some embodiments, X5 is Y, or a variant thereof comprising a hydroxyphenyl, wherein the hydrogen atom in hydroxyphenyl of Y or of the variant is optionally substituted with one or more substituents selected from -C1-3alkyl, , and -C1-3alkylene-C(=O)OH.

[0248] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, Yae, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa, each of which is optionally substituted. In some embodiments, X5 is optionally substituted Y. In some embodiments, X5 is optionally substituted F3G. In some embodiments, X5 is optionally substituted 3Py6COO. In some embodiments, X5 is optionally substituted 4Py2NH2. In someembodiments, X5 is optionally substituted 3Py5COO. In some embodiments, X5 is optionally substituted F3COO. In some embodiments, X5 is optionally substituted 3Py6NHAc. In some embodiments, X5 is optionally substituted F. In some embodiments, X5 is optionally substituted F4C. In some embodiments, X5 is optionally substituted F4OMe. In some embodiments, X5 is optionally substituted F4COO. In some embodiments, X5 is optionally substituted Nal2. In some embodiments, X5 is optionally substituted F3aao. In some embodiments, X5 is optionally substituted F4aa. In some embodiments, X5 is optionally substituted F4aao. In some embodiments, X5 is optionally substituted 3Py6NHaa. In some embodiments, X5 is optionally substituted 5Pdo. In some embodiments, X5 is optionally substituted F3CON. In some embodiments, X5 is optionally substituted F4F. In some embodiments, X5 is optionally substituted F4OEt. In some embodiments, X5 is optionally substituted F4Me. In some embodiments, X5 is optionally substituted F4CON. In some embodiments, X5 is optionally substituted F4CONPEG4Me. In some embodiments, X5 is optionally substituted F3OMe. In some embodiments, X5 is optionally substituted F3CON. In some embodiments, X5 is optionally substituted Yae. In some embodiments, X5 is optionally substituted YaeCOpipzaa. In some embodiments, X5 is optionally substituted F4aaopipzaa. In some embodiments, X5 is optionally substituted 4Pdo. In some embodiments, X5 is optionally substituted 3Py6CON. In some embodiments, X5 is optionally substituted Atp. In some embodiments, X5 is optionally substituted Cha4cH. In some embodiments, X5 is optionally substituted Cha4tH. In some embodiments, X5 is optionally substituted Cha4cOMe. In some embodiments, X5 is optionally substituted A1mor. In some embodiments, X5 is optionally substituted F4amCOpipzaa.

[0249] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X5 is any amino acid. In some embodiments, X5 is a D-amino acid. In some embodiments, X5 is an L-amino acid. In some embodiments, X5 is an N-alkylated amino acid. In some embodiments, X5 is an N-methylated amino acid. In some embodiments, X5 does not comprise a cyclic group. In some embodiments, X5 comprises a cyclic group. In some embodiments, X5 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X5 comprises a 5-6 membered heteroaryl group. In some embodiments, X5 comprises a phenyl group. In some embodiments, X5 is a peptoid.

[0250] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X5 has a structure of, wherein: Rn5is hydrogen or C1-3alkyl; ring A5 is an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl;each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, - NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX5-heterocycloalkyl, -LX5-cycloalkyl, -LX5-aryl, or -LX5-heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O, =S, or =N(Ra); LX5is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa- , wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a; kx5 is 0, 1, 2, or 3; mx5 is 0, 1, 2, 3, 4, or 5; *X4 represents the point of attachment to X4; *X6 represents the point of attachment to X6; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0251] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein: Rn5is hydrogen or methyl; ring A5 is a C6-10aryl, 5-10 membered heteroaryl, C6-10cycloalkyl, or 5-10 membered heterocycloalkyl; each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, - NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX5-5-6 membered heterocycloalkyl, -LX5-C3-6cycloalkyl, -LX5-C6-10aryl, or -LX5-5-10 membered heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O; and LX5is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a.

[0252] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein: ring A5 is a phenyl, naphthyl, pyridinyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, or tetrahydropyranyl; each RX5is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -LX5-piperidinyl, or LX5-piperazinyl, wherein each of the alkyl, heteroalkyl, piperidinyl, and piperazinyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O; kx5 is 1 or 2; and mx5 is 0, 1, or 2.

[0253] In some embodiments, Rn5is hydrogen. In some embodiments, Rn5is C1-3alkyl. In some embodiments, Rn5is methyl.

[0254] In some embodiments, ring A5 is a C6-10aryl, 5-10 membered heteroaryl, C3-10cycloalkyl, or 3-10 membered heterocycloalkyl. In some embodiments, ring A5 is a C6-10aryl, 5-10 membered heteroaryl, C6-10cycloalkyl, or 5-10 membered heterocycloalkyl. In some embodiments, ring A5 is phenyl, naphthyl, pyridinyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, or tetrahydropyranyl. In some embodiments, ring A5 is C6-10aryl. In some embodiments, ring A5 is phenyl. In some embodiments, ring A5 is naphthyl. In some embodiments, ring A5 is 5-10 membered heteroaryl. In some embodiments, ring A5 is 6-10 membered heteroaryl. In some embodiments, ring A5 is 5-6 membered heteroaryl. In some embodiments, ring A5 is pyridine. In some embodiments, ring A5 is pyridine. In some embodiments, ring A5 is C3-10cycloalkyl. In some embodiments, ring A5 is C5-10cycloalkyl. In some embodiments, ring A5 is C5-6cycloalkyl. In some embodiments, ring A5 is C3-6cycloalkyl. In some embodiments, ring A5 is cyclohexane. In some embodiments, ring A5 is 3-10 membered heterocycloalkyl. In some embodiments, ring A5 is 5-6 membered heterocycloalkyl. In some embodiments, ring A5 is tetrahydropyran. In some embodiments, ring A5 is morpholine.

[0255] In some embodiments, each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), - P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX5-5- 6 membered heterocycloalkyl, -LX5-C3-6cycloalkyl, -LX5-C6-10aryl, or -LX5-5-10 membered heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a. In some embodiments, each RX5is independently C1-6alkyl, C1-6haloalkyl, C1- 6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -NRcRd, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -NRaC(=O)Ra, - NRaC(=O)ORa, -C(=O)NRcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX5-5-6 membered heterocycloalkyl, -LX5-C3-6cycloalkyl, -LX5-C6-10aryl, or -LX5-5-10 membered heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a. In some embodiments, each RX5is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, - C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -LX5-piperidinyl, or LX5-piperazinyl, wherein each of the alkyl, heteroalkyl, piperidinyl, and piperazinyl are optionally substituted with one or more RX5a.

[0256] In some embodiments, each RX5ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0257] In some embodiments, two RX5are taken together to form =O.

[0258] In some embodiments, kx5 is 0. In some embodiments, kx5 is 1. In some embodiments, kx5 is 2. In some embodiments, kx5 is 3.

[0259] In some embodiments, mx5 is 0. In some embodiments, mx5 is 1. In some embodiments, mx5 is 2. In some embodiments, mx5 is 3. In some embodiments, mx5 is 4. In some embodiments, mx5 is 5.

[0260] In some embodiments, Rn5 is hydrogen, kx5 is 1 or 2, mx5 is 0, 1, or 2, ring A5 is phenyl, and each RX5is independently halogen, C1-6alkyl, C1-6haloalkyl, or -C(=O)ORa. In some embodiments, Rn5 is hydrogen, kx5 is 1, mx5 is 1, ring A5 is phenyl, and RX5is -C(=O)OH.

[0261] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X6 is an aliphatic amino acid (e.g., V, L, I, A, G, or a variant thereof), a hydrophilic amino acid (e.g., D, E, or a variant thereof), threonine (T), serine (S), O-methyl threonine (TMe), or methionine (M).

[0262] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe, each of which is optionally substituted. In some embodiments, X6 is optionally substituted I. In some embodiments, X6 is optionally substituted V. In some embodiments, X6 is optionally substituted Eva. In some embodiments, X6 is optionally substituted Chg. In some embodiments, X6 is optionally substituted Tbg. In some embodiments, X6 is optionally substituted A. In some embodiments, X6 is optionally substituted L. In some embodiments, X6 is optionally substituted Ahp. In some embodiments, X6 is optionally substituted F4COO. In some embodiments, X6 is optionally substituted Gcpr. In some embodiments, X6 is optionally substituted Gcpe. In some embodiments, X6 is optionally substituted alI. In some embodiments, X6 is optionally substituted Cle. In some embodiments, X6 is optionally substituted S3REt. In some embodiments, X6 is optionally substituted TMe. In some embodiments, X6 is optionally substituted Acpr. In some embodiments, X6 is optionally substituted Cba. In some embodiments, X6 isoptionally substituted Gthp. In some embodiments, X6 is optionally substituted NleCOO. In some embodiments, X6 is optionally substituted NleOH. In some embodiments, X6 is optionally substituted P. In some embodiments, X6 is optionally substituted Atb. In some embodiments, X6 is optionally substituted Nva. In some embodiments, X6 is optionally substituted Nle. In some embodiments, X6 is optionally substituted N. In some embodiments, X6 is optionally substituted DapAc. In some embodiments, X6 is optionally substituted Abu. In some embodiments, X6 is optionally substituted Nmm. In some embodiments, X6 is optionally substituted Ndm. In some embodiments, X6 is optionally substituted Ncit. In some embodiments, X6 is optionally substituted Cit. In some embodiments, X6 is optionally substituted SMe. In some embodiments, X6 is optionally substituted HseMe. In some embodiments, X6 is optionally substituted HseEt. In some embodiments, X6 is optionally substituted HseiPr. In some embodiments, X6 is optionally substituted dMeS. In some embodiments, X6 is optionally substituted TdMe. In some embodiments, X6 is optionally substituted Cbg. In some embodiments, X6 is optionally substituted NvaOMe. In some embodiments, X6 is optionally substituted SiPr. In some embodiments, X6 is optionally substituted Spr. In some embodiments, X6 is optionally substituted NleOMe. In some embodiments, X6 is optionally substituted Sbu. In some embodiments, X6 is optionally substituted Scbm. In some embodiments, X6 is optionally substituted Scpe. In some embodiments, X6 is optionally substituted AhpOMe. In some embodiments, X6 is optionally substituted HseBu. In some embodiments, X6 is optionally substituted Spent. In some embodiments, X6 is optionally substituted Hsecpe.

[0263] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X6 is any amino acid. In some embodiments, X6 is a D-amino acid. In some embodiments, X6 is an L-amino acid. In some embodiments, X6 is an N-alkylated amino acid. In some embodiments, X6 is an N-methylated amino acid. In some embodiments, X6 does not comprise a cyclic group. In some embodiments, X6 comprises a cyclic group. In some embodiments, X6 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X6 comprises a 5-6 membered heteroaryl group. In some embodiments, X6 comprises a phenyl group. In some embodiments, X6 is a peptoid.

[0264] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X6 has a structure of, wherein; Rn6is hydrogen or C1-3alkyl; RX6is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX6-heterocycloalkyl, -LX6- cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; orRn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a; LX6is C1-6alkylene, C1-6heteroalkylene, O, S, or NRa, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a; *X5 represents the point of attachment to X5; *X7 represents the point of attachment to X7; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0265] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein Rn6is hydrogen or methyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2- 6alkynyl, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX6- 5-6 membered heterocycloalkyl, -LX6-C3-6cycloalkyl, -LX6-C6-10aryl, or -LX6-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; and LX6is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a.

[0266] In some embodiments, Rn6is hydrogen. In some embodiments, Rn6is C1-3alkyl. In some embodiments, Rn6is methyl.

[0267] In some embodiments, RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX6-5-6 membered heterocycloalkyl, -LX6- C3-6cycloalkyl, -LX6-phenyl or -LX6-6 membered heteroaryl, wherein each of the alkyl, heteroalkyl, phenyl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a.

[0268] In some embodiments, RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX6-5-6 membered heterocycloalkyl, -LX6-C3-6cycloalkyl, -LX6-C6-10aryl, or -LX6-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a.

[0269] In some embodiments, RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX6-5-6 membered heterocycloalkyl, -LX6-C4-6cycloalkyl, -LX6-C6-10aryl, or -LX6-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a. In some embodiments, RX6is C1-6alkyl, C1-6heteroalkyl, 6 -LX6-phenyl, or -LX6-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, and pyridinyl is optionally substituted with one or more RX6a.

[0270] In some embodiments, RX6is optionally substituted C1-6alkyl. In some embodiments, RX6is C1-6alkyl optionally substituted with one or more RX6a. In some embodiments, RX6is optionally substituted C1- 6heteroalkyl. In some embodiments, RX6is C1-6heteroalkyl optionally substituted with one or more RX6a. In some embodiments, RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, or C1-6heteroalkyl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6isC2-6alkenyl or C2-6alkynyl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6is aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6is aryl or heteroaryl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6is cycloalkyl or heterocycloalkyl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6is C3-6cycloalkyl, which is optionally substituted with one or more RX6a. In some embodiments, RX6is -LX6- heterocycloalkyl, -LX6-cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of which is optionally substituted with one or more RX6a. In some embodiments, RX6is -LX6-heterocycloalkyl, which is optionally substituted with one or more RX6a. In some embodiments, RX6is -LX6- cycloalkyl, which is optionally substituted with one or more RX6a. In some embodiments, RX6is -LX6-aryl, which is optionally substituted with one or more RX6a. In some embodiments, RX6is -LX6-heteroaryl, which is optionally substituted with one or more RX6a.

[0271] In some embodiments, Rn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a.

[0272] In some embodiments, each RX6ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0273] In some embodiments, Rn6is hydrogen, and RX6is C1-6alkyl which is optionally substituted with one or more RX6a. In some embodiments, each RX6ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, or -ORa. In some embodiments, each RX6ais independently halogen, or -O-C1-6alkyl. In some embodiments, RX6ais -O-CH3. In some embodiments, RX6is -CH(CH3)OCH3.

[0274] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X7 is an amino acid comprising a branched alkyl side chain, a C3-5cycloalkyl side chain, or a 3- to 5- membered heterocycloalkyl side chain, or an N-methylated variant thereof. In some embodiments, the branched alkyl side chain comprises 3-5 carbon atoms. In some embodiments, the alkyl, cycloalkyl, or heterocycloalkyl side chain is optionally substituted with -O-C1-C6alkyl.

[0275] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg, each of which is optionally substituted. In some embodiments, X7 is optionally substituted I. In some embodiments, X7 is optionally substituted Eva. In some embodiments, X7 is optionally substituted alI. In some embodiments, X7 is optionally substituted TMe. In some embodiments, X7 is optionally substituted SMe. In some embodiments, X7 is optionally substituted Gcpr. In some embodiments, X7 is optionally substituted Gcpe. In some embodiments, X7 is optionally substituted Gthp. In some embodiments, X7 is optionally substituted dMeS. In some embodiments, X7 is optionallysubstituted TdMe. In some embodiments, X7 is optionally substituted Cbg.

[0276] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X7 is any amino acid. In some embodiments, X7 is a D-amino acid. In some embodiments, X7 is an L-amino acid. In some embodiments, X7 is an N-alkylated amino acid. In some embodiments, X7 is an N-methylated amino acid. In some embodiments, X7 does not comprise a cyclic group. In some embodiments, X7 comprises a cyclic group. In some embodiments, X7 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X7 comprises a 5-6 membered heteroaryl group. In some embodiments, X7 comprises a phenyl group. In some embodiments, X7 is a peptoid.

[0277] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X7 has a structure of, wherein: Rn7is hydrogen or C1-3alkyl ; RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2- 6alkynyl, cycloalkyl, or heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a; *X6 represents the point of attachment to X6; and *X8 represents the point of attachment to X8; other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0278] In some embodiments, wherein Rn7is hydrogen or methyl; and RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, C3-6cycloalkyl, or 5-6 membered heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a.

[0279] In some embodiments, Rn7is hydrogen. In some embodiments, Rn7is C1-3alkyl. In some embodiments, Rn7is methyl.

[0280] In some embodiments, RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, C3-6cycloalkyl, or 5-6 membered heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a. In some embodiments, RX7is C1-6alkyl, C1-6heteroalkyl, C3-6cycloalkyl, or 5-6 membered heterocycloalkyl, wherein each of the alkyl, heteroalkyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a. In some embodiments, RX7is C1-6alkyl, which is optionally substituted with one or more RX7a. In some embodiments, RX7is C1-6alkyl. In some embodiments, RX7is a branched C1-6alkyl. In some embodiments, RX7is C1-6heteroalkyl, which is optionally substituted with one or moreRX7a. In some embodiments, RX7is C1-6heteroalkyl. In some embodiments, RX7is C3-6cycloalkyl, which is optionally substituted with one or more RX7a. In some embodiments, RX7is C3-6cycloalkyl. In some embodiments, RX7is 5-6 membered heterocycloalkyl, which is optionally substituted with one or more RX7a. In some embodiments, RX7is 5-6 membered heterocycloalkyl.

[0281] In some embodiments, each RX7ais independently halogen, -CN, -ORa, -SRa, -NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, or =O.

[0282] In some embodiments, Rn7is hydrogen and RX7is C1-6alkyl, which is optionally substituted with one or more RX7a. In some embodiments, Rn7is hydrogen and RX7is C1-6alkyl. In some embodiments, Rn7is hydrogen and RX7is C3-6alkyl. In some embodiments, Rn7is hydrogen and RX7is branched C1-6alkyl.

[0283] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X8 is Y, or a variant thereof comprising a hydroxyphenyl ring, wherein the hydroxyphenyl ring of Y or of the variant is optionally substituted with one or more substituents selected from halogen, -C1-3alkyl, - OH, -C(=O)OH, -O-CH3, -C1-3alkylene-C(=O)OH, -C1-3alkylene-C(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH, and -C1-3alkylene-NHC(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X8 is F, or a variant thereof comprising a phenyl, pyridinyl, or indazolyl, wherein the phenyl of F or the phenyl, pyridinyl, or indazolyl of the variant is optionally substituted with one or more substituents each independently selected from halogen, -C1-3alkyl, -OH, - C(=O)OH, -C(=O)NH2, -NHC(=O)NH2, -C1-3alkylene-C(NH2)-COOH, -NH-CO-CH3, -NH-C1-3alkylene- NH2, -C(=O)-N(CH2)2, -S(=O)2-CH3, -C1-3alkylene-NH-C(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH, and -O-C1-3alkylene-NH-C(=O)- 5- to 6-membered heterocycloalkylene-C1-3alkylene-C(=O)OH.

[0284] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X8 is Y, F4OMe, F4COO, F4OEt, F4u, F4Me, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X8 is Y, F4OMe, F4COO, F4OEt, F4u, F4Me, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa, each of which is optionally substituted. In some embodiments, X8 is optionally substituted Y. In some embodiments, X8 is optionally substituted F4OMe. In some embodiments, X8 is optionally substituted F4COO. In some embodiments, X8 is optionally substituted F4OEt. In some embodiments, X8 is optionally substituted F4u. In some embodiments, X8 is optionally substituted F4Me. In some embodiments, X8 is optionally substituted F4CONdMe. In some embodiments, X8 is optionally substituted F4CON. In some embodiments, X8 is optionally substituted F4ms. In some embodiments, X8 is optionally substituted F4CONPEG4Me. In some embodiments, X8 is optionally substituted F34dOMe. In some embodiments, X8 is optionally substituted F3OMe. In some embodiments,X8 is optionally substituted F3C. In some embodiments, X8 is optionally substituted F3CON. In some embodiments, X8 is optionally substituted F3CONdMe. In some embodiments, X8 is optionally substituted 3Py6CON. In some embodiments, X8 is optionally substituted Yae. In some embodiments, X8 is optionally substituted YaeCOpipzaa. In some embodiments, X8 is optionally substituted 5Inda. In some embodiments, X8 is optionally substituted F3aao. In some embodiments, X8 is optionally substituted F3aa. In some embodiments, X8 is optionally substituted F4aao. In some embodiments, X8 is optionally substituted F4aa. In some embodiments, X8 is optionally substituted 3Py6Nhae. In some embodiments, X8 is optionally substituted 3Py6NHAc. In some embodiments, X8 is optionally substituted 3Py6OMe. In some embodiments, X8 is optionally substituted F4aaopipzaa. In some embodiments, X8 is optionally substituted F4amCOpipzaa.

[0285] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X8 is A, I, L, or V. In some embodiments, X8 is A. In some embodiments, X8 is A or a derivative thereof. In some embodiments, X8 is I or a derivative thereof. In some embodiments, X8 is L or a derivative thereof. In some embodiments, X8 is V or a derivative thereof.

[0286] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X8 is any amino acid. In some embodiments, X8 is a D-amino acid. In some embodiments, X8 is an L-amino acid. In some embodiments, X8 is an aliphatic-amino acid. In some embodiments, X8 is an N-alkylated amino acid. In some embodiments, X8 is an N-methylated amino acid. In some embodiments, X8 does not comprise a cyclic group. In some embodiments, X8 comprises a cyclic group. In some embodiments, X8 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X8 comprises a 5-6 membered heteroaryl group. In some embodiments, X8 comprises a phenyl group. In some embodiments, X8 is a peptoid.

[0287] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X8 has a structure of, wherein, Rn8is hydrogen or C1-3alkyl; ring A8 is an aryl or heteroaryl; each RX8is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, - NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX8-heterocycloalkyl, -LX8-cycloalkyl, -LX8-aryl, or -LX8-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O, =S, or =N(Ra); LX8is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a; kx8 is 0, 1, 2, or 3; mx8 is 0, 1, 2, 3, 4, or 5; *X7 represents the point of attachment to X7; *X9 represents the point of attachment to X9; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0288] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein ring A8 is a C6-10aryl or 5-10 membered heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, - NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, - NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX8-5-6 membered heterocycloalkyl, -LX8- C3-6cycloalkyl, -LX8- C6-10aryl, or -LX8-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O; and LX8is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a.

[0289] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein ring A8 is a phenyl, pyridinyl, indolyl, azaindolyl, indazolyl, or benzimidazolyl; each RX8is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, - NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -LX5-piperidinyl, or LX5-piperazinyl, wherein each of the alkyl, heteroalkyl, piperidinyl, and piperazinyl are optionally substituted with one or more RX8a; or two RX5are taken together to form =O; kx8 is 1 or 2; andmx8 is 0, 1, or 2.

[0290] In some embodiments, Rn8is hydrogen. In some embodiments, Rn8is C1-3alkyl. In some embodiments, Rn8is methyl.

[0291] In some embodiments, ring A8 is C6-10aryl. In some embodiments, ring A8 is a phenyl. In some embodiments, ring A8 is naphthyl.

[0292] In some embodiments, ring A8 is 5-10 membered heteroaryl. In some embodiments, ring A8 is 5-6 membered heteroaryl. In some embodiments, ring A8 is monocyclic heteroaryl. In some embodiments, ring A8 is bicyclic heteroaryl. In some embodiments, ring A8 is bicyclic fused heteroaryl. In some embodiments, ring A8 is bicyclic 5-6 or 6-5 fused heteroaryl. In some embodiments, ring A8 is a phenyl, pyridinyl, indolyl, azaindolyl, indazolyl, or benzimidazolyl.

[0293] In some embodiments, each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, - S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX8-5-6 membered heterocycloalkyl, -LX8-C3-6cycloalkyl, -LX8- C6-10aryl, or -LX8-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a.

[0294] In some embodiments, each RX8is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, - OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or -LX8-5-6 membered heterocycloalkyl (e.g., -LX8-piperidinyl or LX8-piperazinyl), wherein each of the alkyl, heteroalkyl, heterocycloalkyl (e.g., piperidinyl, and piperazinyl) are optionally substituted with one or more RX8a.

[0295] In some embodiments, RX8are taken together to form an oxo.

[0296] In some embodiments, LX8is C1-6alkylene, which is optionally substituted with one or more RX8a. In some embodiments, LX8is C1-6heteroalkylene, which is optionally substituted with one or more RX8a. In some embodiments, LX8is -O-. In some embodiments, LX8is -S-. In some embodiments, LX8is -NRa-.

[0297] In some embodiments, kx8 is 0. In some embodiments, kx8 is 1. In some embodiments, kx8 is 2. In some embodiments, kx8 is or 3.

[0298] In some embodiments, mx8 is 0. In some embodiments, mx8 is 1. In some embodiments, mx8 is 2. In some embodiments, mx8 is 3. In some embodiments, mx8 is 4. In some embodiments, mx8 is 5.

[0299] In some embodiments, Rn8is hydrogen, kx8 is 0, 1, or 2, mx8 is 0, 1, or 2, ring A8 is phenyl, and each RX8is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, or -ORa, wherein each of the alkyl or heteroalkyl is optionally substituted with one or more RX8a. In some embodiments, Rn8is hydrogen, kx8 is 1, mx8 is 1, ring A8 is phenyl, and each RX8isindependently halogen, C1-6alkyl, or -ORa, wherein each of the alkyl or heteroalkyl is optionally substituted with one or more RX8a. In some embodiments, Rn8is hydrogen, kx8 is 1, mx8 is 1, ring A8 is phenyl, and each RX8is independently halogen, C1-6alkyl, or -OCH2C(=O)OH. In some embodiments, Rn8is hydrogen, kx8 is 1, mx8 is 1, ring A8 is phenyl, and RX8is -OCH2C(=O)OH.

[0300] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X9 is an N-methyl aromatic amino acid, optionally a bicyclic aromatic amino acid. In some embodiments, X9 is N-methyl amino acid comprising a phenyl or monocyclic heteroaryl, each of which is optionally substituted. In some embodiments, X9 is N-methyl amino acid comprising a naphthalyl or bicyclic heteroaryl, each of which is optionally substituted. In some embodiments, the bicyclic heteroaryl is a 5-6, 6-6, or 6-5 fused heteroaryl. In some embodiments, the heteroaryl comprise 1-3 ring nitrogen atoms. In some embodiments, the heteroaryl comprise 1-2 ring nitrogen atoms. In some embodiments, the heteroaryl comprise 1 ring nitrogen atom. In some embodiments, the N-methyl aromatic amino acid is N- methyl monocyclic aromatic amino acid comprising a phenyl or pyridinyl optionally substituted with one or more substituents each independently selected from halogen, -C1-3alkyl, and trifluoromethyl. In some embodiments, the N-methyl aromatic amino acid is N-methyl bicyclic aromatic amino acid comprising a naphthalyl, quinolyl, or indazolyl optionally substituted with one or more substituents each independently selected from H or C1-3alkyl.

[0301] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeW7N, MeF3C4Me, or MeF3Me4C. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeW7N, MeF3C4Me, or MeF3Me4C, each of which is optionally substituted. In some embodiments, X9 is optionally substituted MeNal2. In some embodiments, X9 is optionally substituted MeNal27N. In some embodiments, X9 is optionally substituted MeF34diox. In some embodiments, X9 is optionally substituted MeF34dOMe. In some embodiments, X9 is optionally substituted MeF4T. In some embodiments, X9 is optionally substituted MeY. In some embodiments, X9 is optionally substituted MeW1Me. In some embodiments, X9 is optionally substituted MeW7N. In some embodiments, X9 is optionally substituted MeF3C4Me. In some embodiments, X9 is optionally substituted MeF3Me4C.

[0302] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X9 is a D-amino acid. In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I- 3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X9 is an L-amino acid. In some embodiments, X9 is an N- alkylated amino acid. In some embodiments, X9 is an N-methylated amino acid. In some embodiments, X9 comprises a cyclic group. In some embodiments, X9 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X9 comprises a 5-6 membered heteroaryl group. In some embodiments, X9 comprises a bicyclic heteroaryl group. In some embodiments, X9 comprises a phenyl group. In some embodiments, X9 is a peptoid.

[0303] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X9 has a structure of, wherein: Rn9is hydrogen or C1-3alkyl; ring A9 is an aryl or heteroaryl; each RX9is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O, =S, or =N(Ra); kx9 is 0, 1, 2, or 3; mx9 is 0, 1, 2, 3, 4, or 5; *X8 represents the point of attachment to X8; *X10 represents the point of attachment to X10; and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0304] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein Rn9is hydrogen or methyl; ring A9 is a C6-10aryl or 5-10 membered heteroaryl; and each RX9is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O.

[0305] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein ring A9 is a phenyl, naphthyl, pyridinyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, or isoquinolinyl; each RX9is independently halogen, C1-6alkyl, C1-6haloalkyl, -CN, -ORa, -SRa, or -NRcRd, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more RX9a; kx9 is 1 or 2; and mx9 is 0, 1, or 2.

[0306] In some embodiments, Rn9is hydrogen. In some embodiments, Rn9is C1-3alkyl. In some embodiments, Rn9is methyl.

[0307] In some embodiments, ring A9 is C6-10aryl. In some embodiments, ring A9 is 5-10 membered heteroaryl. In some embodiments, ring A9 is monocyclic heteroaryl. In some embodiments, ring A9 is bicyclic heteroaryl. In some embodiments, ring A9 is bicyclic 6-6 fused heteroaryl. In some embodiments,ring A9 is bicyclic 6-5 or 5-6 fused heteroaryl. In some embodiments, ring A9 is phenyl, naphthyl, pyridinyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, or isoquinolinyl.

[0308] In some embodiments, each RX9ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1- C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re. In some embodiments, each RX9is independently halogen, C1-6alkyl, C1-6haloalkyl, -CN, -ORa, -SRa, or -NRcRd, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more RX9a.

[0309] In some embodiments, kx9 is 0. In some embodiments, kx9 is 1. In some embodiments, kx9 is 2. In some embodiments, kx9 is 3.

[0310] In some embodiments, mx9 is 0. In some embodiments, mx9 is 1. In some embodiments, mx9 is 2. In some embodiments, mx9 is 3. In some embodiments, mx9 is 4. In some embodiments, mx9 is 5.

[0311] In some embodiments, Rn9is methyl, kx9 is 1, ring A9 is a bicyclic 6-6 fused heteroaryl. In some embodiments, ring A9 is isoquinolinyl.

[0312] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X10 is G. In some embodiments, X10 is a D-amino acid (e.g., da, ds, de, or dp). In some embodiments, X10 is a D amino acid selected from da, ds, de, and dp. In some embodiments, X10 is da.

[0313] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X11 is F or a variant thereof, or an amino acid comprising -C1-6alkylene-phenyl. In some embodiments, the F or the variant thereof is F, or a variant thereof comprising a phenyl or heteroaryl (e.g., monocyclic or bicyclic), each of which is optionally substituted. In some embodiments, the F or the variant thereof is F, or a variant thereof comprising a phenyl, or pyridinyl, optionally substituted with one or more substituents each independently selected from phenyl, -O-phenyl, -O-C1-3alkylene-phenyl, pyridinyl, imidazolyl, pyrazolyl, N-C1-3alkylene pyrazolyl, N-C1-3alkylene(-O-C1-3alkyl) pyrazolyl, pyranyl, tetrahydropyranyl, piperidinyl, N-C1-3alkylene-C(=O)-piperidinyl.

[0314] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, or F4CONdMe. In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, or F4CONdMe, each of which is optionally substituted. In some embodiments, X11 is optionally substituted Bph. In some embodiments, X11 is optionally substituted 3Py6Ph. In some embodiments, X11 is optionally substituted F41Me4Pyz. In some embodiments, X11 is optionally substituted F43Pyz. In some embodiments, X11 is optionally substituted F44Pyz. In some embodiments, X11 is optionally substituted F41Pyz. In some embodiments, X11 isoptionally substituted F41Me3Pyz. In some embodiments, X11 is optionally substituted F41Et4Pyz. In some embodiments, X11 is optionally substituted F41MeOe4Pyz. In some embodiments, X11 is optionally substituted F41MeOp4Pyz. In some embodiments, X11 is optionally substituted F44thp. In some embodiments, X11 is optionally substituted F4Ac4pip. In some embodiments, X11 is optionally substituted PhNva. In some embodiments, X11 is optionally substituted PhNle. In some embodiments, X11 is optionally substituted Yph. In some embodiments, X11 is optionally substituted Ybn. In some embodiments, X11 is optionally substituted F4tb. In some embodiments, X11 is optionally substituted F4oPr. In some embodiments, X11 is optionally substituted F4CONdMe.

[0315] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X11 is any amino acid. In some embodiments, X11 is a D-amino acid. In some embodiments, X11 is an L-amino acid. In some embodiments, X11 is an N-alkylated amino acid. In some embodiments, X11 is an N-methylated amino acid. In some embodiments, X11 comprises a cyclic group. In some embodiments, X11 comprises a 5-6 membered heterocycloalkyl group. In some embodiments, X11 comprises a 5-6 membered heteroaryl group. In some embodiments, X11 comprises a bicyclic heteroaryl group. In some embodiments, X11 comprises a phenyl group. In some embodiments, X11 is a peptoid.

[0316] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), X11 has a structure of, wherein: Rn11is hydrogen or C1-3alkyl; ring A11 is an aryl or heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, - C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX11-heterocycloalkyl, -LX11-cycloalkyl, -LX11-aryl, or -LX11-heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O, =S, or =N(Ra); LX11is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a;kx11 is 0, 1, 2, 3, 4, or 5; mx11 is 0, 1, 2, 3, 4, or 5; *X10 represents the point of attachment to X10; *X12 represents the point of attachment to X12 or *X12 represents the point of attachment to N(R2) (e.g., in Formula (I-1) and (I-2)); and other groups (such as Ra, Rc, Rd, and Re) have the meanings defined in Formula (I).

[0317] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein ring A11 is C6-10aryl or 5-10 membered heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, - C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, - LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O; and LX11is C1-6alkylene, C1-6heteroalkylene, or -O-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a.

[0318] In some embodiments of a peptide of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV-2), wherein ring A11 is a phenyl or pyridinyl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -NRaS(=O)2Ra, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, - OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O; kx11 is 1, 2, 3, or 4; and mx11 is 0, 1, or 2.

[0319] In some embodiments, Rn11is hydrogen. In some embodiments, Rn11is C1-3alkyl. In some embodiments, Rn11is methyl.

[0320] In some embodiments, A11 is C6-10aryl. In some embodiments, A11 is phenyl. In someembodiments, A11 is 5-10 membered heteroaryl. In some embodiments, A11 is 5-6 membered heteroaryl. In some embodiments, A11 is monocyclic heteroaryl. In some embodiments, A11 is bicyclic heteroaryl.

[0321] In some embodiments, each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, - NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, - NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11-C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a.

[0322] In some embodiments, each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a.

[0323] In some embodiments, each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -NRaC(=O)Ra, -C(=O)NRcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5- 10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a.

[0324] In some embodiments, each RX11is independently phenyl, pyridinyl, pyrrolyl, pyrazolyl, imidazolyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, -LX11-5-6 membered heterocycloalkyl, -LX11-phenyl, or -LX11-pyridinyl, wherein each of the phenyl, pyridinyl, pyrrolyl, pyrazolyl, imidazolyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, and heterocycloalkyl is optionally substituted with one or more RX11a.

[0325] In some embodiments, two RX11are taken together to form oxo.

[0326] In some embodiments, LX11is C1-6alkylene, which is optionally substituted with one or more RX11a. In some embodiments, LX11is C1-6heteroalkylene, which is optionally substituted with one or more RX11a. In some embodiments, LX11is -O-. In some embodiments, LX11is -S-. In some embodiments, LX11is -NRa-.

[0327] In some embodiments, each RX11ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O,wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

[0328] In some embodiments, kx11 is 0. In some embodiments, kx11 is 1. In some embodiments, kx11 is 2. In some embodiments, kx11 is 3. In some embodiments, kx11 is 4. In some embodiments, kx11 is 5.

[0329] In some embodiments, mx11 is 0. In some embodiments, mx11 is 1. In some embodiments, mx11 is 2. In some embodiments, mx11 is 3. In some embodiments, mx11 is 4. In some embodiments, mx11 is 5.

[0330] In some embodiments, Rn11is hydrogen, kx11 is 0, 1, or 2, mx11 is 1, ring A11 is monocyclic heteroaryl, and RX11is phenyl. In some embodiments, Rn11is hydrogen, kx11 is 1, mx11 is 1, ring A11 is pyridinyl, and RX11is phenyl.

[0331] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X12 is N-methylated cysteine or a derivative thereof. In some embodiments, X12 is N-methylated cysteine. In some embodiments, X12 is N-methylated cysteine, which is optionally substituted.

[0332] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa; MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb); X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa; X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, KAc, Hgn, MeY, or DapCOpipzaa; X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa; X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, Yae, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa; X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe; X7 is I, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg;X8 is A, I, L, V, Y, F4OMe, F4COO, F4OEt, F4u, F4Me, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa; X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeW7N, MeF3C4Me, or MeF3Me4C; X10 is G or a D-amino acid (e.g., da, ds, de, or dp); X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, or F4CONdMe; and X12 is MeC.

[0333] In some embodiments of Formula (I), (I-5), (III-2), or (IV-2), X1 is MeA, MeK, MeK(datb), MeK(de), MeK(df), MeK(H), MeKAc, MeKCOpipzaa, MeDapCOpipzaa, or MeQ; X2 is MeA, HseMe, MeHseMe, MeI, MeL, MeQ, MeY, S, TMe, MeKCOpipzaa, or Me3Py; X3 is D, Hgn, KAc, MeY, or Q; X4 is MeA4paa, MeD, MeK, Q, MeQ, MeY, W5N, MeDapCOpipzaa, or MeKCOpipzaa; X5 is 3Py6NHaa, F4aao, F4COO, Y, or Yae; X6 is alI, Cle, I, S3REt, or TMe; X7 is I; X8 is F4aa, F4aao, F4aaopipzaa, F4amCOpipzaa, F4COO, F4u, Y, Yae, or YaeCOpipzaa; X9 is MeNal2, MeNal27N, or MeY; X10 is G; X11 is 3Py6Ph or F41Me4Pyz; and X12 is MeC.

[0334] In some embodiments of Formula (I), (I-1), (I-2), (I-3), (I-4), (I-5), (III-1), (III-2), (IV-1), or (IV- 2), X1 is MeA, MeK, MeK(datb), MeK(de), MeK(df), MeK(H), MeKAc, MeKCOpipzaa, MeDapCOpipzaa, or MeQ; X2 is MeA, HseMe, MeHseMe, MeI, MeL, MeQ, MeY, S, TMe, MeKCOpipzaa, or Me3Py; X3 is D, Hgn, KAc, MeY, or Q; X4 is MeA4paa, MeD, MeK, Q, MeQ, MeY, W5N, MeDapCOpipzaa, or MeKCOpipzaa; X5 is 3Py6NHaa, F4aao, F4COO, Y, or Yae;X6 is alI, Cle, I, S3REt, or TMe; X7 is I; X8 is F4aa, F4aao, F4aaopipzaa, F4amCOpipzaa, F4COO, F4u, Y, Yae, or YaeCOpipzaa; X9 is MeNal2, MeNal27N, or MeY; X10 is G; and X11 is 3Py6Ph or F41Me4Pyz.

[0335] In some embodiments, a radiopharmaceutical conjugate of the present disclosure comprising a cyclic peptide of Formula (I) has a structure of Formula (III-1),wherein, –Linker– represents the linker; R1is selected from the group consisting of -NH2and -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis selected from the group consisting of -S-, -CH2-, or -O-; and wherein X1 to X11 have the definitions described in Formula (I).

[0336] In some embodiments, the linker is attached to the 1stamino acid residue (or X1), the 2ndamino acid residue (or X2), the 3rdamino acid residue (or X3), the 4thamino acid residue (or X4), the 8thamino acid residue (or X8), or the 12thamino acid residue at R1. In some embodiments, the linker is attached to the 1stamino acid residue (or X1). In some embodiments, the linker is attached to the 2ndamino acid residue (or X2). In some embodiments, the linker is attached to the 3rdamino acid residue (or X3). In some embodiments, the linker is attached to the 3rdamino acid residue (or X3). In some embodiments, the linker is attached to the 4thamino acid residue (or X4). In some embodiments, the linker is attached to the 8thamino acid residue (or X8). In some embodiments, the linker is attached to the 12thamino acid residue at R1. In some embodiments, the linker is a bond. In some embodiments, the metal chelator isIn some embodiments, the radiopharmaceutical conjugate further comprises a radionuclide bound to the metal chelator.

[0337] In some embodiments, a radiopharmaceutical conjugate of the present disclosure comprising a cyclic peptide of Formula (I) has a structure of Formula (III-2),wherein X1-X12 have the definition described in Formula (I) and Lcyc is a ring closing group that covalently connecting X1 with X12; and –Linker– represents the linker.

[0338] In some embodiments, the linker is attached to the 1stamino acid residue (or X1), the 2ndamino acid residue (or X2), the 3rdamino acid residue (or X3), the 4thamino acid residue (or X4), the 8thamino acid residue (or X8), or the 12thamino acid residue (or X12). In some embodiments, the linker is attached to the 1stamino acid residue (or X1). In some embodiments, the linker is attached to the 2ndamino acid residue (or X2). In some embodiments, the linker is attached to the 3rdamino acid residue (or X3). In some embodiments, the linker is attached to the 3rdamino acid residue (or X3). In some embodiments, the linker is attached to the 4thamino acid residue (or X4). In some embodiments, the linker is attached to the 8thamino acid residue (or X8). In some embodiments, the linker is attached to the 12thamino acid residue (or X12). In some embodiments, the linker is a bond. In some embodiments, the metal chelator isIn some embodiments, the radiopharmaceutical conjugate further comprises a radionuclide bound to the metal chelator.

[0339] In some embodiments, a radiopharmaceutical conjugate of the present disclosure comprising a cyclic peptide of Formula (I) has a structure of Formula (IV-1),wherein, –Linker– represents the linker; R* is a covalently bound radionuclide; R1is selected from the group consisting of -NH2and -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis selected from the group consisting of -S-, -CH2-, or -O-; and wherein X1 to X11 have the definitions described in Formula (I).

[0340] In some embodiments, the linker is attached to the 5thamino acid residue (or X5), the 8thamino acid residue (or X8), the 9thamino acid residue (or X9), or the 11thamino acid residue (or X11). In some embodiments, the linker is attached to the 5thamino acid residue (or X5). In some embodiments, the linker is attached to the 8thamino acid residue (or X8). In some embodiments, the linker is attached to the 9thamino acid residue (or X9). In some embodiments, the linker is attached to the 11thamino acid residue (or X11). In some embodiments, the linker is a bond.

[0341] In some embodiments, a radiopharmaceutical conjugate of the present disclosure comprising a cyclic peptide of Formula (I) has a structure of Formula (IV-2),wherein X1-X12 have the definition described in Formula (I) and Lcyc is a ring closing group that covalently connecting X1 with X12; and –Linker– represents the linker.

[0342] In some embodiments, the linker is attached to the 5thamino acid residue (or X5), the 8thamino acid residue (or X8), the 9thamino acid residue (or X9), or the 11thamino acid residue (or X11). In some embodiments, the linker is attached to the 5thamino acid residue (or X5). In some embodiments, the linker is attached to the 8thamino acid residue (or X8). In some embodiments, the linker is attached to the 9thamino acid residue (or X9). In some embodiments, the linker is attached to the 11thamino acid residue (or X11). In some embodiments, the linker is a bond.

[0343] In some embodiments, the Lcyc is a group selected from Table 4B. In some embodiments, the Lcyc is formed by reacting the first and the second functional groups in Table 4C. In some embodiments, the Lcyc is -C(=O)-CH2-. In some embodiments, the Lcyc is -C(=O)-CH2-, which is formed by reacting with a chloroacetylated (or bromoacetylated) amino acid with a cysteine. In some embodiments, the Lcyc is -C(=O)-CH2-S-, which is formed by reacting with a chloroacetylated (or bromoacetylated) amino acid with an amino acid comprising an SH group.

[0344] In some embodiments, a radiopharmaceutical conjugate disclosed herein or a pharmaceutically accepted salt thereof has a cyclic structure having an amino acid (e.g., a chloroacetylated amino acid) in the first residue X1 and a cysteine residue or a variant thereof, and wherein the amino acid (e.g., the chloroacetylated amino acid) in X1 and the cysteine residue or a variant thereof are bound. In some embodiments, a radiopharmaceutical conjugate disclosed herein or a pharmaceutically accepted salt thereof has a cyclic structure having an amino acid (e.g., a chloroacetylated amino acid) in the first residue X1 and a cysteine residue or a variant thereof, and wherein the amino acid (e.g., the chloroacetylated amino acid) in X1 and the cysteine residue or a variant thereof form a covalent bond. In some embodiments, a radiopharmaceutical conjugate disclosed herein or a pharmaceutically accepted salt thereof has a cyclic structure having a bromoacetylated amino acid in the first residue X1 and a cysteine residue or a variant thereof, and wherein the bromoacetylated amino acid in X1 and the cysteine residue or a variant thereof form a covalent bond.

[0345] In some embodiments, the radiopharmaceutical conjugate consists of an amino acid sequence selected from SEQ ID NOs: 1-72, and the peptide has a cyclic structure having a cysteine residue or a variant thereof at the 12thresidue (X12). In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72, and the peptide has a cyclic structure having a cysteine residue or a variant thereof at the 12thresidue (X12), and wherein the chloroacetylated amino acid and the cysteine residue or a variant thereof at 12thresidue form a covalent bond. In some embodiments, the chloroacetyl group can be replaced with a bromoacetyl group.

[0346] In some embodiments, the peptide consists of an amino acid sequence selected from any one of SEQ ID NOs: 66-71 that lacks the X3 amnio acid residue, and the peptide has a cyclic structure having a cysteine residue or a variant thereof at the “12thresidue” (X12). In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72, and the peptide has a cyclic structure having a cysteine residue or a variant thereof at the 12thresidue (X12), and wherein the amino acid at X1 (e.g., a chloroacetylated amino acid) and the cysteine residue or a variant thereof at the 12thresidue form a covalent bond. In some embodiments, the chloroacetyl group can be replaced with a bromoacetyl group.

[0347] In some embodiments, a radiopharmaceutical conjugate disclosed herein or a pharmaceutically salt thereof has a cyclic structure having the first amino acid covalently linked to the last amino acid.

[0348] In some embodiments, the radiopharmaceutical conjugate or the pharmaceutically accepted salt thereof has a cyclic structure having a chloroacetylated amino acid in X1 and a cysteine or a cysteinevariant thereof residue, and wherein the chloroacetylated amino acid in X1 and the cysteine or substituted cysteine are bound. In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72. In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72, and the peptide has a cyclic structure. In some embodiments, the peptide consists of an amino acid sequence selected from SEQ ID NOs: 1-72, and the peptide has a cyclic structure having a chloroacetylated amino acid and a cysteine or a cysteine variant thereof residue at C-terminus, and wherein the chloroacetylated amino acid and the cysteine or a cysteine variant thereof at C-terminus are bound. In some embodiments, the peptide has a cyclic structure having a chloroacetylated amino acid and; (i) 12 or more total amino acids, a cysteine or a cysteine variant thereof residue at the 12thresidue, and wherein the chloroacetylated amino acid and the cysteine or a cysteine variant thereof at the 12thresidue are bound; or (ii) 11 or fewer total amino acids, especially lacking X3 residue, a cysteine or a cysteine variant thereof residue at the 12thresidue, and wherein the chloroacetylated amino acid and the cysteine or substituted cysteine at the 12thresidue are bound. In some embodiments, the chloroacetyl group can be replaced with a bromoacetyl group.

[0349] In some embodiments, the radiopharmaceutical conjugate or the pharmaceutically acceptable salt thereof comprises a peptide comprising an amino acid sequence that is at least 95% identical to a sequence selected from SEQ ID NOs:X1-X12 of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that is at least 80%, 85%, 90%, 95%, or 98% identical to a sequence selected from SEQ ID NOs: X1-X12 of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof consists of an amino acid sequence selected from SEQ ID NOs: X1-X12 of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that has at most 1, 2, 3, 4, or 5 amino acid residues that are different compared to a sequence selected from SEQ ID NOs: X1-X12 of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that has at most 1, 2, 3, 4, or 5 additions, deletions and / or substitutions (including conservative substitutions) to a sequence selected from SEQ ID NOs: X1-X12 of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that has at most 1 addition, deletion, or substitution (including conservative substitutions) to a sequence selected from SEQ ID NOs: X1-X12 of SEQ ID NOs: 1-72.

[0350] In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that lacks the X3 amino acid residue of any one of SEQ ID NOs: 1-72, and is at least 70%, 80%, or 90% identical to the remaining residues of any one of SEQ ID NOs: 1-72. In some embodiments, the peptide or the salt thereof comprises an amino acid sequence that is at least 70%, 80%, or 90% identical to a sequence selected from SEQ ID NOs: 66-71.

[0351] Exemplary peptides of the present disclosure include the peptides described in Table 1. In some embodiments, the peptides of Table 1 have a -C(=O)-halogen group attached to the N-terminus. In some embodiments, the peptides of Table 1 have a -C(=O)-CH2-halogen group attached to the N-terminus. In some embodiments, the peptides of Table 1 have a -C(=O)-halogen group attached at residue position 1. In some embodiments, the peptides of Table 1 have a -C(=O)-CH2-halogen group attached at residueposition 1. In some embodiments, the peptides of Table 1 have a -C(=O)-Cl group attached to the N- terminus. In some embodiments, the peptides of Table 1 have a -C(=O)-CH2-Cl group attached to the N- terminus. In some embodiments, the peptides of Table 1 have a -C(=O)-Cl group attached at residue position 1. In some embodiments, the peptides of Table 1 have a -C(=O)-CH2-Cl group attached at residue position 1. In some embodiments, the peptides of Table 1 have a -C(=O)-Br group attached at residue position 1. In some embodiments, the peptides of Table 1 have a -C(=O)-CH2-Br group attached at residue position 1.

[0352] In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)- halogen group attached to the N-terminus. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-CH2-halogen group attached to the N-terminus. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-halogen group attached at residue position 1. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-CH2-halogen group attached at residue position 1. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-Cl group attached to the N-terminus. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-CH2-Cl group attached to the N-terminus. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-Cl group attached at residue position 1. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-CH2-Cl group attached at residue position 1. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-Br group attached at residue position 1. In some embodiments, the radiopharmaceutical conjugates of the disclosure have a -C(=O)-CH2-Br group attached at residue position 1. In some embodiments, the peptides in the radiopharmaceutical conjugates of the disclosure are monocyclic.

[0353] In some embodiments, the peptides of the radiopharmaceutical conjugates described herein are monocyclic peptides, wherein the -C(=O)-Cl at residue position 1 forms a bond with the cysteine at residue position 12. In some embodiments, the peptides of the radiopharmaceutical conjugates described herein are monocyclic peptides, wherein the -C(=O)-CH2-Cl at residue position 1 forms a bond with the cysteine at residue position 12. In some embodiments, the peptides in the radiopharmaceutical conjugates described herein are monocyclic peptides with 12 amino acid residues forming the ring.

[0354] In some embodiments, a herein described conjugate is selected from conjugates described in Table 2, Table 3A or Table 3B.

[0355] In some embodiments, described herein is a conjugate having the following structure, or a pharmaceutically acceptable salt thereof:In some embodiments, described herein is a conjugate having the following structure, or a pharmaceutically acceptable salt thereof:In some embodiments, described herein is a conjugate having the following structure, or a pharmaceutically acceptable salt thereof:In some embodiments, Cu-C-30NOTA is64Cu-C-30NOTA. In some embodiments, described herein is a conjugate having the following structure, or a pharmaceutically acceptable salt thereof (SEQ ID NO: 376):In some embodiments, described herein is a radiopharmaceutical having the following structure, or a pharmaceutically acceptable saltthereof (SEQ ID NO: 376): , wherein XMis a radionuclide. In some embodiments, described herein is a radiopharmaceutical having the following structure, or a pharmaceutically acceptable salt thereof (SEQ ID NO: 376):wherein XMis a radionuclide. In some embodiments, described herein is a radiopharmaceutical having the following structure, or a pharmaceutically acceptable salt thereof (SEQ ID NO: 376):, wherein XMis a radionuclide. In some embodiments, XMis a radionuclide selected from Table 7. In some embodiments, XMis Ac-225. In some embodiments, XMis Lu-177. In some embodiments, XMis Ga-68.

[0356] In some embodiments, provided herein are conjugates having the same peptide sequence and linker as the conjugates described in Table 2, Table 3A or Table 3B, except that the ring closing linkage between the amino acid residue of position 1 and the cysteine (e.g., at position 12) are covalently bound by a different group. For example, the amino acid residue of position 1 can comprise a group selected from maleimides, halides, disulfides, electron-deficient alkynes, thioesters, and alkenes, which forms a covalent bond with the cysteine.

[0357] In some embodiments, the peptides of conjugates of Table 1 are monocyclic peptides, wherein the -C(=O)-Cl at residue position 1 forms a bond with the cysteine at residue position 12. In some embodiments, the peptides of conjugates of Table 1 are monocyclic peptides, wherein the -C(=O)-CH2-Cl at residue position 1 forms a bond with the cysteine at residue position 12. In some embodiments, the peptides in the conjugates of Table 1 are monocyclic peptides with 12 amino acid residues forming the ring.

[0358] In one aspect, described herein is a peptide that has avidity for GPC3, wherein the peptide competes for binding to human GPC3 with a peptide that has an amino acid sequence including deletion, substitution, and / or addition of one or several amino acids in the amino acid of SEQ ID NO: 1: MeK-MeI-D-MeQ-F4COO-I-I-Y-MeNal27N-G-3Py6Ph-MeC (SEQ ID NO: 1) or a pharmaceutically acceptable salt thereof.

[0359] In one aspect, described herein is a peptide that has avidity for GPC3, wherein the peptide competes for binding to human GPC3 with a peptide that has a structure of Formula (I) as described herein (e.g., Formula (I-1), (I-2), (I-3), (I-4), and (I-5)), or a pharmaceutically acceptable salt thereof.

[0360] In some embodiments, the radiopharmaceutical conjugate has a binding affinity to a human GPC3 of at most 100 nM as determined by Kdin surface plasmon resonance (SPR) analysis. In some embodiments, the radiopharmaceutical conjugate has a binding affinity to a human GPC3 of at most 1 nM as determined by Kdin surface plasmon resonance (SPR) analysis.

[0361] The structures of exemplary unnatural amino acids that are present in Table 1 can be found in Table 5G.

[0362] As described in Table 1 or other tables, abbreviations have the following meanings:

[0363] Lower case d means D-amino acids, e.g., dF refers to d-phenylalanine;

[0364] Me refers to a methyl group, e.g., MeG represents N-Methyl-Glycine;

[0365] Ala or A refer to alanine;

[0366] Arg or R refer to arginine;

[0367] Asn or N refer to asparagine;

[0368] Asp or D refer to aspartic acid;

[0369] Cys or C refer to cysteine;

[0370] Gln or Q refer to glutamine;

[0371] Gly or G refer to glycine;

[0372] His or H refer to histidine;

[0373] Ile or I refer to isoleucine;

[0374] Leu or L refer to leucine;

[0375] Lys or K refer to lysine;

[0376] Met or M refer to methionine;

[0377] Phe or F refer to phenylalanine;

[0378] Pro or P refer to proline;

[0379] Ser or S refer to serine;

[0380] Thr or T refer to threonine;

[0381] Trp or W refer to tryptophan;

[0382] Tyr or Y refer to tyrosine;

[0383] Val or V refer to valine;

[0384] Unless otherwise stated in the present specification, the following abbreviations for non-natural amino acids are used according to the following meanings: F4G 2-amino-3-(4-guanidinophenyl)propanoic acid, such as (S)-2-amino-3-(4- guanidinophenyl)propanoic acid (CAS 59574-11-7); 4Py 2-amino-3-(pyridin-4-yl)propanoic acid, such as (S)-2-amino-3-(pyridin-4-yl)propanoic acid (CAS 37535-49-2); 3Py 2-amino-3-(pyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(pyridin-3-yl)propanoic acid (CAS 64090-98-8); Cit 2-amino-5-ureidopentanoic acid, such as (S)-2-amino-5-ureidopentanoic acid (CAS 372-75-8); KCOpipzaa 2-amino-6-{[4-(carboxymethyl)piperazine-1-carbonyl]amino}hexanoic acid, such as (2S)-2-amino-6-{[4-(carboxymethyl)piperazine-1-carbonyl]amino}hexanoic acidEva 2-amino-3-ethylpentanoic acid, such as (S)-2-amino-3-ethylpentanoic acid (CAS 14328-49-5); Ahp 2-aminoheptanoic acid, such as (S)-2-aminoheptanoic acid (CAS No. 44902-02-5); F4COO 4-(2-amino-2-carboxyethyl)benzoic acid, such as (S)-4-(2-amino-2-carboxyethyl)benzoic acid (CAS 126109-42-0); KCOpip4COO 1-((5-amino-5-carboxypentyl)carbamoyl)piperidine-4-carboxylic acid, such as (S)-1- ((5-amino-5-carboxypentyl)carbamoyl)piperidine-4-carboxylic acidAib 2-amino-2-methylpropanoic acid (CAS 62-57-7); Hpr piperidine-2-carboxylic acid, such as (S)-piperidine-2-carboxylic acid (CAS 3105-95-1); Sbu 2-amino-3-butoxypropanoic acid, such as (2S)-2-amino-3-butoxypropanoic acid (CAS 138320- 46-4); MeDapCOpipzaa 3-(4-(carboxymethyl)piperazine-1-carboxamido)-2-(methylamino)propanoic acid, such as (S)-3-(4-(carboxymethyl)piperazine-1-carboxamido)-2-Scbm 2-amino-3-(cyclobutylmethoxy)propanoic acid, such as (2S)-2-amino-3-Sbu 2-amino-3-butoxypropanoic acid, such as (2S)-2-amino-3-butoxypropanoic acid (CAS 138320- 46-4); Scpe 2-amino-3-(cyclopentyloxy)propanoic acid, such as (2S)-2-amino-3-(cyclopentyloxy)propanoic acid (CAS 1509921-28-1); HseBu 2-amino-4-butoxybutanoic acid, such as (2S)-2-amino-4-butoxybutanoic acid (CAS 17673-71- 1); A4paa 2-amino-3-(1-(carboxymethyl)piperidin-4-yl)propanoic acid, such as (S)-2-amino-3-(1- (carboxymethyl)piperidin-4-yl)propanoic acidSpent 2-amino-3-(pentyloxy)propanoic acid, such as (2S)-2-amino-3-(pentyloxy)propanoic acid (CAS 1502644-74-7); Hgl 2-aminohexanedioic acid, such as (S)-2-aminohexanedioic acid (CAS 1118-90-7) Hsecpe 2-amino-4-(cyclopentyloxy)butanoic acid, such as (2S)-2-amino-4-(cyclopentyloxy)butanoic acid (CAS 1501949-22-9); Hgn 2,6-diamino-6-oxohexanoic acid, such as (S)-2,6-diamino-6-oxohexanoic acid (CAS 7433-32- 1); DapCOpipzaa 2-amino-3-(4-(carboxymethyl)piperazine-1-carboxamido)propanoic acid, such as (S)- 2-amino-3-(4-(carboxymethyl)piperazine-1-carboxamido)propanoic acidMeD 2-(methylamino)butanedioic acid, such as (2S)-2-(methylamino)butanedioic acid (CAS 4226- 18-0); CmG 2-[(2-carbamoylethyl)amino]acetic acid (CAS 34299-32-6); Medd 2-(methylamino)butanedioic acid, such as (2R)-2-(methylamino)butanedioic acid (CAS 6384- 92-5); HseEt 2-amino-4-ethoxybutanoic acid, such as (2S)-2-amino-4-ethoxybutanoic acid (CAS 17268-93- 8); HseiPr 2-amino-4-(propan-2-yloxy)butanoic acid, such as (2S)-2-amino-4-(propan-2-yloxy)butanoic acid (CAS 685842-10-8); CrmG 2,2'-azanediyldiacetic acid (CAS 142-73-4); CeG 3-((carboxymethyl)amino)propanoic acid (CAS 505-72-6); CrpG 4-((carboxymethyl)amino)butanoic acid (CAS 4386-04-3); MeHgl 2-(methylamino)hexanedioic acid, such as (S)-2-(methylamino)hexanedioic acid (CAS 261943- 13-9); MeCit 2-(methylamino)-5-ureidopentanoic acid, such as (S)-2-(methylamino)-5-ureidopentanoic acid (CAS 2226129-88-8); F3G 2-amino-3-(3-guanidinophenyl)propanoic acid, such as (S)-2-amino-3-(3- guanidinophenyl)propanoic acid (CAS 1019057-42-1); 3Py6COO 5-(2-amino-2-carboxyethyl)picolinic acid, such as (S)-5-(2-amino-2- carboxyethyl)picolinic acid (CAS 1269945-31-4); 4Py2NH2 2-amino-3-(2-aminopyridin-4-yl)propanoic acid, such as (S)-2-amino-3-(2- aminopyridin-4-yl)propanoic acid (CAS 1269969-46-1);3Py5COO 5-(2-amino-2-carboxyethyl)nicotinic acid, such as (S)-5-(2-amino-2- carboxyethyl)nicotinic acid (CAS 1270138-35-6); F3COO 3-(2-amino-2-carboxyethyl)benzoic acid, such as (S)-3-(2-amino-2-carboxyethyl)benzoic acid (CAS 13861-02-4) 3Py6NHAc 3-(6-acetamidopyridin-3-yl)-2-aminopropanoic acid, such as (S)-3-(6- acetamidopyridin-3-yl)-2-aminopropanoic acid (CAS 1270189-35-9); F4C 2-amino-3-(4-chlorophenyl)propanoic acid, such as (S)-2-amino-3-(4-chlorophenyl)propanoic acid (CAS 14173-39-8) F4OMe 2-amino-3-(4-methoxyphenyl)propanoic acid, such as (S)-2-amino-3-(4- methoxyphenyl)propanoic acid (CAS 6230-11-1); Nal2 2-amino-3-(naphthalen-2-yl)propanoic acid, such as (S)-2-amino-3-(naphthalen-2-yl)propanoic acid (CAS 58438-03-2); F3aao 2-amino-3-(3-(carboxymethoxy)phenyl)propanoic acid, such as (S)-2-amino-3-(3- (carboxymethoxy)phenyl)propanoic acidF4aa 2-amino-3-(4-(carboxymethyl)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (carboxymethyl)phenyl)propanoic acid (CAS 140233-60-9); F4aao 2-amino-3-(4-(carboxymethoxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (carboxymethoxy)phenyl)propanoic acid (CAS 24558-63-2); 3Py6NHaa 2-amino-3-(6-((carboxymethyl)amino)pyridin-3-yl)propanoic acid, such as (S)-2- amino-3-(6-((carboxymethyl)amino)pyridin-3-yl)propanoic acid5Pdo 2-amino-3-(6-oxo-1,6-dihydropyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(6-oxo-1,6- dihydropyridin-3-yl)propanoic acid (CAS 140681-92-1); F3CON 2-amino-3-(3-carbamoylphenyl)propanoic acid, such as (S)-2-amino-3-(3- carbamoylphenyl)propanoic acid (CAS 1217651-22-3); F4F 2-amino-3-(4-fluorophenyl)propanoic acid, such as (S)-2-amino-3-(4-fluorophenyl)propanoic acid (CAS 1132-68-9); F4OEt 2-amino-3-(4-ethoxyphenyl)propanoic acid, such as (S)-2-amino-3-(4-ethoxyphenyl)propanoic acid (CAS 32795-52-1); F4Me 2-amino-3-(p-tolyl)propanoic acid, such as (S)-2-amino-3-(p-tolyl)propanoic acid (CAS 1991- 87-3);F4CON 2-amino-3-(4-carbamoylphenyl)propanoic acid, such as (S)-2-amino-3-(4- carbamoylphenyl)propanoic acid (CAS 223593-04-2); F4CONPEG4Me 3-(4-((2,5,8,11-tetraoxatridecan-13-yl)carbamoyl)phenyl)-2-aminopropanoic acid, such as (S)-3-(4-((2,5,8,11-tetraoxatridecan-13-yl)carbamoyl)phenyl)-2-aminopropanoic acid; F3OMe 2-amino-3-(3-methoxyphenyl)propanoic acid, such as (S)-2-amino-3-(3- methoxyphenyl)propanoic acid (CAS 33879-32-2); YaeCOpipzaa 2-amino-3-(4-(2-(4-(carboxymethyl)piperazine-1- carboxamido)ethoxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(2-(4- (carboxymethyl)piperazine-1-carboxamido)ethoxy)phenyl)propanoic acidF4aaopipzaa 2-amino-3-(4-(2-(4-(carboxymethyl)piperazin-1-yl)-2-oxoethoxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(2-(4-(carboxymethyl)piperazin-1-yl)-2- oxoethoxy)phenyl)propanoic acid4Pdo 2-amino-3-(2-oxo-1,2-dihydropyridin-4-yl)propanoic acid, such as (S)-2-amino-3-(2-oxo-1,2- dihydropyridin-4-yl)propanoic acid (CAS 1270061-10-3); 3Py6CON 2-amino-3-(6-carbamoylpyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(6- carbamoylpyridin-3-yl)propanoic acid; Atp 2-amino-3-(tetrahydro-2H-pyran-4-yl)propanoic acid, such as (S)-2-amino-3-(tetrahydro-2H- pyran-4-yl)propanoic acid (CAS 1344910-91-3); Cha4cH 2-amino-3-((1s,4R)-4-hydroxycyclohexyl)propanoic acid, such as (S)-2-amino-3-((1s,4R)-4- hydroxycyclohexyl)propanoic acidCha4tH 2-amino-3-((1r,4S)-4-hydroxycyclohexyl)propanoic acid, such as (S)-2-amino-3-((1r,4S)-4- hydroxycyclohexyl)propanoic acid (CAS 221243-22-7); Cha4cOMe 2-amino-3-((1s,4R)-4-methoxycyclohexyl)propanoic acid, such as (S)-2-amino-3- ((1s,4R)-4-methoxycyclohexyl)propanoic acidA1mor 2-amino-3-morpholinopropanoic acid, such as (S)-2-amino-3-morpholinopropanoic acid (CAS 1931924-34-3); F4amCOpipzaa 2-amino-3-(4-((4-(carboxymethyl)piperazine-1- carboxamido)methyl)phenyl)propanoic acid, such as (S)-2-amino-3-(4-((4- (carboxymethyl)piperazine-1-carboxamido)methyl)phenyl)propanoic acidChg 2-amino-2-cyclohexylacetic acid, such as (S)-2-amino-2-cyclohexylacetic acid (CAS 14328-51- 9); Cle 1-aminocyclopentane-1-carboxylic acid (CAS 52-52-8); Tbg 2-amino-3,3-dimethylbutanoic acid, such as (S)-2-amino-3,3-dimethylbutanoic acid (CAS 20859-02-3); Gcpr 2-amino-2-cyclopropylacetic acid, such as (S)-2-amino-2-cyclopropylacetic acid (CAS 49606- 99-7); Gcpe 2-amino-2-cyclopentylacetic acid, such as (S)-2-amino-2-cyclopentylacetic acid (CAS 2521-84- 8); Acpr 2-amino-3-cyclopropylpropanoic acid, such as (S)-2-amino-3-cyclopropylpropanoic acid (CAS 102735-53-5); Cba 2-amino-3-cyclobutylpropanoic acid, such as (S)-2-amino-3-cyclobutylpropanoic acid (CAS 1201593-65-8); Gthp 2-amino-2-(tetrahydro-2H-pyran-4-yl)acetic acid, such as (S)-2-amino-2-(tetrahydro-2H-pyran- 4-yl)acetic acid (CAS 811842-25-8); NleCOO 2-aminoheptanedioic acid, such as (S)-2-aminoheptanedioic acid (CAS 26630-55-7); NleOH 2-amino-6-hydroxyhexanoic acid, such as (S)-2-amino-6-hydroxyhexanoic acid (CAS 6033-32- 5);Atb 2-amino-4,4-dimethylpentanoic acid, such as (S)-2-amino-4,4-dimethylpentanoic acid (CAS 57224-50-7); Nva 2-aminopentanoic acid, such as (S)-2-aminopentanoic acid (CAS 6600-40-4); Nle 2-aminohexanoic acid, such as (S)-2-aminohexanoic acid (CAS 327-57-1); DapAc 3-acetamido-2-aminopropanoic acid, such as (S)-3-acetamido-2-aminopropanoic acid (CAS 20584-70-7); Abu 2-aminobutanoic acid, such as (S)-2-aminobutanoic acid (CAS 1492-24-6); Ncit 2-amino-4-ureidobutanoic acid, such as (S)-2-amino-4-ureidobutanoic acid (CAS 1190-47-2); dMeS 2-amino-3-hydroxy-3-methylbutanoic acid, such as (S)-2-amino-3-hydroxy-3-methylbutanoic acid (CAS 2280-27-5); TdMe 2-amino-3-methoxy-3-methylbutanoic acid, such as (S)-2-amino-3-methoxy-3-methylbutanoic acid (CAS 2280-29-7); Cbg 2-amino-2-cyclobutylacetic acid, such as (S)-2-amino-2-cyclobutylacetic acid (CAS 49607-08- 1); NvaOMe 2-amino-5-methoxypentanoic acid, such as (S)-2-amino-5-methoxypentanoic acid (CAS 1315051-48-9); NleOMe 2-amino-6-methoxyhexanoic acid, such as (S)-2-amino-6-methoxyhexanoic acid (CAS 1690134-89-4); AhpOMe2-amino-7-methoxyheptanoic acid, such as (S)-2-amino-7-methoxyheptanoic acid; F4u 2-amino-3-(4-ureidophenyl)propanoic acid, such as (S)-2-amino-3-(4-ureidophenyl)propanoic acid (CAS 32401-733-4); F4CONdMe 2-amino-3-(4-(dimethylcarbamoyl)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (dimethylcarbamoyl)phenyl)propanoic acid (CAS 2349530-31-8); F4ms 2-amino-3-(4-(methylsulfonyl)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (methylsulfonyl)phenyl)propanoic acid (CAS 1195655-47-0); F34dOMe 2-amino-3-(3,4-dimethoxyphenyl)propanoic acid, such as (S)-2-amino-3-(3,4- dimethoxyphenyl)propanoic acid (CAS 32161-30-1); F3C 2-amino-3-(3-chlorophenyl)propanoic acid, such as (S)-2-amino-3-(3-chlorophenyl)propanoic acid (CAS 80126-51-8); F3CONdMe 2-amino-3-(3-(dimethylcarbamoyl)phenyl)propanoic acid, such as (S)-2-amino-3-(3- (dimethylcarbamoyl)phenyl)propanoic acid5Inda 2-amino-3-(1H-indazol-5-yl)propanoic acid, such as (S)-2-amino-3-(1H-indazol-5-yl)propanoic acid (CAS 1335577-14-4);F3aa 2-amino-3-(3-(carboxymethyl)phenyl)propanoic acid, such as (S)-2-amino-3-(3- (carboxymethyl)phenyl)propanoic acid (CAS 1270107-31-7); 3Py6Nhae 2-amino-3-(6-((2-aminoethyl)amino)pyridin-3-yl)propanoic acid, such as (S)-2- amino-3-(6-((2-aminoethyl)amino)pyridin-3-yl)propanoic acid3Py6OMe 2-amino-3-(6-methoxypyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(6- methoxypyridin-3-yl)propanoic acid (CAS 1270178-24-9); MeNal2 2-(methylamino)-3-(naphthalen-2-yl)propanoic acid, such as (S)-2-(methylamino)-3- (naphthalen-2-yl)propanoic acidMeNal27N 3-(isoquinolin-7-yl)-2-(methylamino)propanoic acid, such as (S)-3-(isoquinolin-7-yl)- 2-(methylamino)propanoic acidMeF34diox 3-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-2-(methylamino)propanoic acid, such as (S)- 3-(2,3-dihydrobenzo[b][1,4]dioxin-6-yl)-2-(methylamino)propanoic acidMeF34dOMe 3-(3,4-dimethoxyphenyl)-2-(methylamino)propanoic acid, such as (S)-3-(3,4- dimethoxyphenyl)-2-(methylamino)propanoic acid (CAS 52939-34-1); MeF4T 2-(methylamino)-3-(4-(trifluoromethyl)phenyl)propanoic acid, such as (S)-2-(methylamino)-3- (4-(trifluoromethyl)phenyl)propanoic acidMeW7N 2-(methylamino)-3-(1H-pyrrolo[2,3-b]pyridin-3-yl)propanoic acid, such as (S)-2- (methylamino)-3-(1H-pyrrolo[2,3-b]pyridin-3-yl)propanoic acid (CAS 356067-71-5); MeF3C4Me 3-(3-chloro-4-methylphenyl)-2-(methylamino)propanoic acid, such as (S)-3-(3-chloro- 4-methylphenyl)-2-(methylamino)propanoic acidMeF3Me4C 3-(4-chloro-3-methylphenyl)-2-(methylamino)propanoic acid, such as (S)-3-(4-chloro- 3-methylphenyl)-2-(methylamino)propanoic acidBph 3-([1,1'-biphenyl]-4-yl)-2-aminopropanoic acid, such as (S)-3-([1,1'-biphenyl]-4-yl)-2- aminopropanoic acid (CAS 155760-02-4); 3Py6Ph 2-amino-3-(6-phenylpyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(6-phenylpyridin-3- yl)propanoic acidF41Me4Pyz 2-amino-3-(4-(1-methyl-1H-pyrazol-4-yl)phenyl)propanoic acid, such as (S)-2-amino- 3-(4-(1-methyl-1H-pyrazol-4-yl)phenyl)propanoic acidF43Pyz 3-(4-(1H-pyrazol-3-yl)phenyl)-2-aminopropanoic acid, such as (S)-3-(4-(1H-pyrazol-3- yl)phenyl)-2-aminopropanoic acidF44Pyz 3-(4-(1H-pyrazol-4-yl)phenyl)-2-aminopropanoic acid, such as (S)-3-(4-(1H-pyrazol-4- yl)phenyl)-2-aminopropanoic acidF41Pyz 3-(4-(1H-pyrazol-1-yl)phenyl)-2-aminopropanoic acid, such as (S)-3-(4-(1H-pyrazol-1- yl)phenyl)-2-aminopropanoic acid (CAS 1269982-08-2); F41Me3Pyz 2-amino-3-(4-(1-methyl-1H- ol-3-yl)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(1-methyl-1H-pyrazol-3-yl)phenyl)propanoic acidF41Et4Pyz 2-amino-3-(4-(1-ethyl-1H-pyrazol-4-yl)phenyl)propanoic acid, such as (S)-2-amino-3- (4-(1-ethyl-1H-pyrazol-4-yl)phenyl)propanoic acidF41MeOe4Pyz 2-amino-3-(4-(1-(2-methoxyethyl)-1H-pyrazol-4-yl)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(1-(2-methoxyethyl)-1H-pyrazol-4-yl)phenyl)propanoic acidF41MeOp4Pyz 2-amino-3-(4-(1-(3-methoxypropyl)-1H-pyrazol-4-yl)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(1-(3-methoxypropyl)-1H-pyrazol-4-yl)phenyl)propanoic acidF44thp 2-amino-3-(4-(tetrahydro-2H-pyran-4-yl)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (tetrahydro-2H-pyran-4-yl)phenyl)propanoic acidF4Ac4Pip 3-(4-(1-acetylpiperidin-4-yl)phenyl)-2-aminopropanoic acid, such as (S)-3-(4-(1- acetylpiperidin-4-yl)phenyl)-2-aminopropanoic acidPhNva 2-amino-5-phenylpentanoic acid, such as (S)-2-amino-5-phenylpentanoic acid (CAS 62777-25- 7); PhNle 2-amino-6-phenylhexanoic acid, such as (S)-2-amino-6-phenylhexanoic acid (CAS 80887-26- 9); Yph 2-amino-3-(4-phenoxyphenyl)propanoic acid, such as (S)-2-amino-3-(4-phenoxyphenyl)propanoic acid (CAS 150351-64-7); Ybn 2-amino-3-(4-(benzyloxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4- (benzyloxy)phenyl)propanoic acid (CAS 16652-64-5); F4tb 2-amino-3-(4-(tert-butyl)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(tert- butyl)phenyl)propanoic acidF4Opr 2-amino-3-(4-propoxyphenyl)propanoic acid, such as (S)-2-amino-3-(4- propoxyphenyl)propanoic acid (CAS 32795-53-2); S3Ret (3R)-2-amino-3-hydroxypentanoic acid, such as (2S,3R)-2-amino-3-hydroxypentanoic acid (CAS 10148-67-1); Yae 2-amino-3-(4-(2-aminoethoxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4-(2- aminoethoxy)phenyl)propanoic acid (CAS 1909283-20-0); datb 2-amino-4,4-dimethylpentanoic acid, such as (R)-2-amino-4,4-dimethylpentanoic acid (CAS 88319-43-1); Me3Py 2-(methylamino)-3-(pyridin-3-yl)propanoic acid, such as (S)-2-(methylamino)-3-(pyridin-3- yl)propanoic acid (CAS 2651172-69-7) ; W5N 2-amino-3-(1H-pyrrolo[3,2-c]pyridin-3-yl)propanoic acid, such as (S)-2-amino-3-(1H- pyrrolo[3,2-c]pyridin-3-yl)propanoic acid (CAS 149704-62-1) MeA4paa 3-(1-(carboxymethyl)piperidin-4-yl)-2-(methylamino)propanoic acid, such as (S)-3- (1-(carboxymethyl)piperidin-4-yl)-2-(methylamino)propanoic acidMeI (3S)-3-methyl-2-(methylamino)pentanoic acid, such as (2S,3S)-3-methyl-2- (methylamino)pentanoic acid (CAS 4125-98-8); MeA 2-(methylamino)propanoic acid, such as (2S)-2-(methylamino)propanoic acid (CAS 3913-67- 5); MeG 2-(methylamino)acetic acid, such as 2-(methylamino)acetic acid (CAS 107-97-1); MeV 3-methyl-2-(methylamino)butanoic acid, such as (2S)-3-methyl-2-(methylamino)butanoic acid (CAS 2480-23-1) MeT (3R)-3-hydroxy-2-(methylamino)butanoic acid, such as (2S,3R)-3-hydroxy-2- (methylamino)butanoic acid (CAS 2812-28-4) MeC N-methylcysteine, such as (R)-N-methylcysteine alI (3R)-2-amino-3-methylpentanoic acid, such as (2S,3R)-2-amino-3-methylpentanoic acid (CAS 1509-34-8)TMe (3R)-2-amino-3-methoxybutanoic acid, such as (2S,3R)-2-amino-3-methoxybutanoic acid (CAS 4144-02-9) MeQ 4-carbamoyl-2-(methylamino)butanoic acid, such as (2S)-4-carbamoyl-2- (methylamino)butanoic acid (CAS 300560-56-9) MeTMe (3R)-3-methoxy-2-(methylamino)butanoic acid, such as (2S,3R)-3-methoxy-2- (methylamino)butanoic acid (CAS 594865-59-5) MeK 6-amino-2-(methylamino)hexanoic acid, such as (2S)-6-amino-2-(methylamino)hexanoic acid (CAS 7431-89-2) MeKAc 6-acetamido-2-(methylamino)hexanoic acid, such as (2S)-6-acetamido-2- (methylamino)hexanoic acidMeK(datb) N6-(2-amino-4,4-dimethylpentanoyl)-N2-methyl-lysine, such as N6-((R)-2-amino- 4,4-dimethylpentanoyl)-N2-methyl-L-lysineMeK(de) N6-(glutamyl)-N2-methyl-lysine, such as N6-(D-glutamyl)-N2-methyl-L-lysineMeK(df) N6-(phenylalanyl)-N2-methyl-lysine, such as N6-(D-phenylalanyl)-N2-methyl-L- lysineMeK(H) N6-( histidyl)-N2-methyl-lysine, such as N6-(L-histidyl)-N2-methyl-L-lysineHar 2-amino-6-carbamimidamidohexanoic acid, such as (2S)-2-amino-6-carbamimidamidohexanoic acid (CAS 156-86-5) KAc 2-amino-6-acetamidohexanoic acid, such as (2S)-2-amino-6-acetamidohexanoic acid (CAS 692-04-6)dd 2-aminobutanedioic acid, such as (2R)-2-aminobutanedioic acid EtG 2-(ethylamino)acetic acid (CAS 627-01-0) K(biotin)6-{5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4-d]imidazol-4-yl]pentanamido}-2- aminohexanoic acid, such as (2S)-6-{5-[(3aS,4S,6aR)-2-oxo-hexahydro-1H-thieno[3,4- d]imidazol-4-yl]pentanamido}-2-aminohexanoic acid (CAS 576-19-2); MeeG 2-[(2-methoxyethyl)amino]acetic acid (CAS 205124-55-6); CmpG 2-[(3-carbamoylpropyl)amino]acetic acid (CAS 1182825-67-7) Nmm 2-amino-3-(methylcarbamoyl)propanoic acid, such as (2S)-2-amino-3- (methylcarbamoyl)propanoic acid (CAS 149204-93-3) Ndm 2-amino-3-(dimethylcarbamoyl)propanoic acid, such as (2S)-2-amino-3- (dimethylcarbamoyl)propanoic acid (CAS 138585-02-1); SMe 2-amino-3-methoxypropanoic acid, such as (2S)-2-amino-3-methoxypropanoic acid(CAS 32620-11-4); HseMe 2-amino-4-methoxybutanoic acid, such as (2S)-2-amino-4-methoxybutanoic acid (CAS 3311- 01-1); SiPr 2-amino-3-(propan-2-yloxy)propanoic acid, such as (2S)-2-amino-3-(propan-2-yloxy)propanoic acid (CAS 83824-92-4) SPr 2-amino-3-propoxypropanoic acid, such as (2S)-2-amino-3-propoxypropanoic acid (CAS 113576-31-1) MeW1Me 3-(1-methyl-1H-indol-3-yl)-2-(methylamino)propanoic acid, such as (2S)-3-(1- methyl-1H-indol-3-yl)-2-(methylamino)propanoic acid (CAS 1152412-98-0) MeQdMe 4-(dimethylcarbamoyl)-2-(methylamino)butanoic, (2S)-4-(dimethylcarbamoyl)-2- (methylamino)butanoic (CAS 2255323-71-6) MeSMe 3-methoxy-2-(methylamino)propanoic acid, such as (2S)-3-methoxy-2-(methylamino)propanoic acidMeHseMe 4-methoxy-2-(methylamino)butanoic acid, such as (2S)-4-methoxy-2- (methylamino)butanoic acid (CAS 1500648-79-2) MeKCOpipzaa (2S)-6-{[4-(carboxymethyl)piperazine-1-carbonyl]amino}-2-(methylamino)hexanoic acidKCOpipzetOH 2-amino-6-{[4-(2-hydroxyethyl)piperazine-1-carbonyl]amino}hexanoic acid, such as (2S)-2-amino-6-{[4-(2-hydroxyethyl)piperazine-1-carbonyl]amino}hexanoic acidKCOmeglumine 2-amino-6-({methyl[(2S,3R,4R,5R)-2,3,4,5,6- pentahydroxyhexyl]carbamoyl}amino)hexanoic acid, such as (2S)-2-amino-6- ({methyl[(2S,3R,4R,5R)-2,3,4,5,6-pentahydroxyhexyl]carbamoyl}amino)hexanoic acid; MeK(SulfoCy5) 2-[(1E,3E)-5-[(2E)-1-(5-{[(5S)-5-carboxy-5-(methylamino)pentyl]carbamoyl}pentyl)- 3,3-dimethyl-5-sulfo-2,3-dihydro-1H-indol-2-ylidene]penta-1,3-dien-1-yl]-1-ethyl-3,3-dimethyl-3H- indol-1-ium-5-sulfonateYae(SulfoCy5) 2-[(1E,3E)-5-[(2E)-1-{5-[(2-{4- [(2S) -2-amino-2- carboxyethyl]phenoxy}ethyl)carbamoyl]pentyl}-3,3-dimethyl-5-sulfo-2,3-dihydro-1H-indol-2- ylidene]penta-1,3-dien-1-yl] -1-ethyl-3,3-dimethyl-3H-indol-1-ium-5-sulfonateNegative control (FACS assay): 2-[(1E,3E)-5-[(2E)-1-(5-{[(5S)-5-carbamoyl-5-[1-(2- acetamidoacetamido)-3,6,9,12,15,18,21,24,27,30-decaoxatritriacontan-33- amido]pentyl]carbamoyl}pentyl)-3,3-dimethyl-5-sulfo-2,3-dihydro-1H-indol-2-ylidene]penta-1,3-dien-1-yl]-1-ethyl-3,3-dimethyl-3H-indol-1-ium-5-sulfonateMeK(Biotin-PEG12c) 51-(methylamino)-5,45-dioxo-1-((3aS,4S,6aR)-2-oxohexahydro-1H- thieno[3,4-d]imidazol-4-yl)-9,12,15,18,21,24,27,30,33,36,39,42-dodecaoxa-6,46- diazadopentacontan-52-oic acid, such as (S)-51-(methylamino)-5,45-dioxo-1-((3aS,4S,6aR)-2- oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)-9,12,15,18,21,24,27,30,33,36,39,42-dodecaoxa- 6,46-diazadopentacontan-52-oic acidYae(Biotin-PEG12c) 2-amino-3-(4-((4,44-dioxo-48-((3aS,4S,6aR)-2-oxohexahydro-1H- thieno[3,4-d]imidazol-4-yl)-7,10,13,16,19,22,25,28,31,34,37,40-dodecaoxa-3,43- diazaoctatetracontyl)oxy)phenyl)propanoic acid, such as (S)-2-amino-3-(4-((4,44-dioxo-48- ((3aS,4S,6aR)-2-oxohexahydro-1H-thieno[3,4-d]imidazol-4-yl)- 7,10,13,16,19,22,25,28,31,34,37,40-dodecaoxa-3,43-diazaoctatetracontyl)oxy)phenyl)propanoic acid.Table 2. Exemplary conjugates of the present disclosure containing a chelated cold Lutetium (Lu-175) (12mer cyclic peptides). “Term” refers to the functional group at the C-terminus.

[0385] Table 3A illustrates exemplary conjugates of the present disclosure containing a chelated Lutetium-177. As an example,177Lu-C-1 of Table 3A has the same structure as Lu-C-1 of Table 2, except that Lu-177 is present in177Lu-C-1 while Lu-175 is present in Lu-C-1.

[0386] Table 3B illustrates exemplary conjugates of the present disclosure containing a chelated Actinium-225. As an example,225Ac-C-1 of Table 3B has the same structure as Lu-C-1 of Table 2, except that Ac-225 is present in225Ac-C-1 while Lu-175 is present in Lu-C-1. Table 3A Table 3B

[0387] The molecular weight of the described peptide can vary. In some embodiments, the peptide has a molecular weight of about 0.1 to about 25 kDa. In some embodiments, the peptide has a molecular weight of about 0.2 to about 20 kDa, about 0.5 to about 15 kDa, about 0.75 to about 10 kDa, about 0.5 to about 10 kDa, about 0.5 to about 5 kDa, about 0.5 to about 2.5 kDa, about 0.5 to about 2 kDa, about 0.5 to about 1.5 kDa, about 0.5 to about 1 kDa, about 1 to about 10 kDa, about 1 to about 5 kDa, about 1 to about 2.5 kDa, about 1 to about 2 kDa, about 1 to about 1.5 kDa, about 1 to about 1.25 kDa, or about 0.5 to about 1.25 kDa. In some embodiments, the peptide has a molecular weight of about 0.5 to 5 kDa. In some embodiments, the peptide has a molecular weight of about 0.5 to 2 kDa. In some embodiments, the peptide has a molecular weight of about 0.75 to 1.75 kDa. In some embodiments, the peptide has a molecular weight of about 1 to 1.5 kDa. In some embodiments, the peptide is monocyclic.

[0388] A peptide described herein can be cyclized (i.e., macrocyclized). Cyclization can be achieved less ideally via a single disulfide bond, or more ideally via a peptide bond, alkyl bond, alkenyl bond, ester bond, thioester bond, ether bond, thioether bond, phosphate ether bond, azo bond, C—S—C bond, C—N—C bond, C═N—C bond, C═N—O bond, amide bond, lactam bridge, carbamoyl bond, urea bond, thiourea bond, amine bond, thioamide bond, or the like, but not limited to them. In some embodiments, the peptide is a cyclic peptide that is cyclized by a peptide bond, alkyl bond, alkenyl bond, ester bond, thioester bond, ether bond, thioether bond, phosphate ether bond, azo bond, C—N— C bond, C═N—C bond, C═N—O bond, amide bond, lactam bridge, carbamoyl bond, urea bond, thiourea bond, amine bond, or thioamide bond. In some embodiments, the cyclic peptide is cyclized by a thioether bond. In some embodiments, the cyclic peptide is cyclized via an oxime cyclization reaction. A cyclization of a peptide sometimes stabilizes the peptide structure and thereby enhance affinity for a target. The cyclization can occur between the N- and C-terminus, or it can occur between a terminal amino acid and a non-terminal amino acid. In some embodiments, the cyclization occurs between two non-terminal amino acids. In some embodiments, the peptide is cyclized via oxime cyclization. In some embodiments, the peptide is cyclized between cysteine and haloacyl. In some embodiments, the peptide comprises a haloacetyl group (e.g., chloroacetyl or bromoacetyl) at the N-terminus. In some embodiments, the peptide comprises a haloacetyl group (e.g., chloroacetyl or bromoacetyl) at the C- terminus. In some embodiments, the peptide comprises a Cys at the C-terminus. In some embodiments, the peptide comprises a Cys at the N-terminus. In some embodiments, the cyclization occurs via a thioether bond between Cys and a haloacetyl group. In some embodiments, the cyclization occurs between the N-terminus and the C-terminus of the peptide.

[0389] As amino acids for macrocyclization, for example, an amino acid having the following functional group A and an amino acid having a corresponding functional group B can be used (see Table 4A). Either the functional group A or the functional group B may be placed on the N-terminal side. The amino acid having the functional group A and the amino acid having the functional group B can each be an N-terminal amino acid or C-terminal amino acid or a non-terminal amino acid. In some embodiments, an amino acid having the functional group A is placed at the N-terminus. In some embodiments, an amino acid having the functional group A is placed at the C-terminus. In some embodiments, an amino acid having the functional group A is placed at a non-terminal amino acid. In some embodiments, an amino acid having the functional group B is placed at the N-terminus. In some embodiments, an amino acid having the functional group B is placed at the C-terminus. In some embodiments, an amino acid having the functional group B is placed at a non-terminal amino acid. Table 4A. Functional groups for cyclization

[0390] In some embodiments, the amino acid (I-A) in Table 4A can be, for example, a chloroacetylated amino acid. Exemplary chloroacetylated amino acids include N-chloroacetyl-L- alanine, N-chloroacetyl-L-phenylalanine, N-chloroacetyl-L-tyrosine, N-chloroacetyl-L-tryptophan, N- 3-(2-chloroacetamido)benzoyl-L-phenylalanine, N-3-(2-chloroacetamido)benzoyl-L-tyrosine, N-3-(2- chloroacetamido)benzoyl-L-tryptophan, β-N-chloroacetyl-L-diaminopropanoic acid, γ-N-chloroacetyl- L-diaminobutyric acid, σ-N-chloroacetyl-L-ornithine, ε-N-chloroacetyl-L-lysine, N-3- chloromethylbenzoyl-L-tyrosine, and N-3-chloromethylbenzoyl-L-tryptophane and D-amino acid derivatives corresponding thereto (for example, N-Chloroacetyl-D-alanine, N-Chloroacetyl-D- phenylalanine, N-Chloroacetyl-D-tyrosine, and N-Chloroacetyl-D-tryptophan).

[0391] Examples of the amino acid (I-B) include, but are not limited to, cysteine, homocysteine, mercaptonorvaline, mercaptonorleucine, 2-amino-7-mercaptoheptanoic acid, 2-amino-8- mercaptooctanoic acid, and amino acids obtained by protecting the SH group of these amino acids and then eliminating the protecting group, and D-amino acid derivatives corresponding thereto.

[0392] The cyclization method can be carried out, for example, according to the method described in Kawakami, T. et al., Nature Chemical Biology 5, 888-890 (2009); Yamagishi, Y. et al., ChemBioChem 10, 1469-1472 (2009); Sako, Y. et al., Journal of American Chemical Society 130, 7932-7934 (2008); or WO2008 / 117833.

[0393] In some embodiments, for example, the amino acid (II-A) is selected from propargylglycine, homopropargylglycine, 2-amino-6-heptynoic acid, 2-amino-7-octynoic acid, and 2-amino-8-nonynoic acid can be used. In addition, 4-pentynoylated or 5-hexynoylated amino acids can also be used. Examples of the 4-pentynoylated amino acids include N-(4-pentenoyl)-L-alanine, N-(4-pentenoyl)-L- phenylalanine, N-(4-pentenoyl)-L-tyrosine, N-(4-pentenoyl)-L-tryptophan, N-3-(4-pentynoylamido)benzoyl-L-phenylalanine, N-3-(4-pentynoylamido)benzoyl-L-tyrosine, N-3-(4- pentynoylamido)benzoyl-L-tryptophan, β-N-(4-pentenoyl)-L-diaminopropanoic acid, γ-N-(4- pentenoyl)-L-diaminobutyric acid, σ-N-(4-pentenoyl)-L-ornithine, and ε-N-(4-pentenoyl)-L-lysine, and D-amino acid derivatives corresponding thereto.

[0394] In some embodiments, for example, the amino acid (II-B) is selected from azidoalanine, 2- amino-4-azidobutanoic acid, azidoptonorvaline, azidonorleucine, 2-amino-7-azidoheptanoic acid, and 2-amino-8-azidooctanoic acid can be used. In addition, azidoacetylated or 3-azidopentanoylated amino acids can also be used. Examples of the azidoacetylated amino acids include N-azidoacetyl-L-alanine, N-azidoacetyl-L-phenylalanine, N-azidoacetyl-L-tyrosine, N-azidoacetyl-L-tryptophan, N-3-(4- pentynoylamido)benzoyl-L-phenylalanine, N-3-(4-pentynoylamido)benzoyl-L-tyrosine, N-3-(4- pentynoylamido)benzoyl-L-tryptophan, β-N-azidoacetyl-L-diaminopropanoic acid, γ-N-azidoacetyl-L- diaminobutyric acid, α-N-azidoacetyl-L-ornithine, and ε-N-azidoacetyl-L-lysine, and D-amino acid derivatives corresponding thereto.

[0395] The cyclization method can be performed, for example, according to the method described in Sako, Y. et al., Journal of American Chemical Society 130, 7932-7934 (2008) or WO2008 / 117833.

[0396] Examples of amino acid (III-A) include, but are not limited to, N-(4-aminomethyl-benzoyl)- phenylalanine (AMBF) and 4-3-aminomethyltyrosine.

[0397] Examples of the amino acid (III-B) include, but are not limited to, 5-hydroxytryptophan (WoH). The cyclization method can be performed, for example, according to the method described in Yamagishi, Y. et al., ChemBioChem 10, 1469-1472 (2009) or WO2008 / 117833.

[0398] Examples of the amino acid (IV-A) include, but are not limited to, 2-amino-6-chloro-hexynoic acid, 2-amino-7-chloro-heptynoic acid, and 2-amino-8-chloro-octynoic acid.

[0399] Examples of the amino acid (IV-B) include, but are not limited to, cysteine, homocysteine, mercaptonorvaline, mercaptonorleucine, 2-amino-7-mercaptoheptanoic acid, and 2-amino-8- mercaptooctanoic acid, amino acids obtained by protecting the SH group of these amino acids and then eliminating the protecting group, and D-amino acid derivatives corresponding thereto. The cyclization method can be performed, for example, according to the method described in WO2012 / 074129.

[0400] Examples of the amino acid (V-A) include, but are not limited to, N-3-chloromethylbenzoyl- L-phenylalanine, N-3-chloromethylbenzoyl-L-tyrosine, and N-3-chloromethylbenzoyl-L-tryptophane.

[0401] Examples of the amino acid (V-B) include, but are not limited to, cysteine, homocysteine, mercaptonorvaline, mercaptonorleucine, 2-amino-7-mercaptoheptanoic acid, and 2-amino-8- mercaptooctanoic acid, and amino acids obtained by protecting the SH group of these amino acids and then eliminating the protecting group, and D-amino acid derivatives corresponding thereto.

[0402] The amino acids I-A to V-A and I-B to V-B can be introduced into the peptide in a known manner by chemical synthesis or translation and synthesis described herein. In some embodiments, the cyclization reaction comprises forming a thioether bond using an amino acid comprising a sulfanylgroup, e.g., cysteine, homocysteine, mercaptonorvaline, mercaptovaline, mercaptonorleucine, 2-amino- 7-mercaptoheptanoic acid, and 2-amino-8-mercaptooctanoic acid.

[0403] A peptide described herein can comprise one or more negatively charged amino acids and / or one or more positively charged amino acids. Positively charged amino acids include, for example, lysine, arginine, histidine, and amino acids that contain additional amine groups. Positively charged amino acids can comprise a heteroaryl substitution such as pyridine, imidazole, pyrazole, or triazole that has one or more ring nitrogen atoms. Negatively charged amino acids include, for ex...

Claims

CLAIMS We claim:

1. A radiopharmaceutical or a pharmaceutically acceptable salt thereof, the radiopharmaceutical comprising: (a) a peptide of Formula (I-1),wherein: R1is -NH2or -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis -S-, -CH2-, or -O-; X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring, or cycloalkyl or heterocycloalkyl group, or X5 is a peptoid; X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted; X8 is A, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G or A, or an N-alkylated variant thereof, or a D-amino acid; andX11 is an amino acid comprising an aromatic ring; and (b) a metal chelator bound to a radionuclide, wherein the metal chelator is covalently attached to the peptide.

2. The radiopharmaceutical or pharmaceutically acceptable salt thereof of claim 1, wherein the radiopharmaceutical conjugate is selected from Table 3A or Table 3B.

3. A radiopharmaceutical of the following structure:,or a pharmaceutically acceptable salt thereof, wherein XMis a radionuclide.

4. A conjugate or a pharmaceutically acceptable salt thereof, the conjugate comprising: (a) a peptide of Formula (I-1),wherein: R1is -NH2or -OH; R2is C1-3alkyl; R3is C1-3alkylene, optionally substituted with one or more R4; each R4is independently C1-3alkyl or C3-6cycloalkyl; kxR is 1, 2, 3, 4, 5, or 6; XRis -S-, -CH2-, or -O-; X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 is an amino acid comprising an aromatic ring, or cycloalkyl or heterocycloalkyl group, or X5 is a peptoid; X6 is a hydrophobic amino acid, a hydrophilic amino acid, or a polar amino acid wherein the polar amino acid has a substituted side chain; X7 is a hydrophobic amino acid comprising a C1-C8alkyl, cycloalkyl, or heterocycloalkyl, wherein the alkyl, cycloalkyl, and heterocycloalkyl are each independently, optionally substituted; X8 is A, I, L, V, Y, or F, or a variant thereof; X9 is an N-alkylated amino acid comprising an aromatic ring; X10 is G or A, or an N-alkylated variant thereof, or a D-amino acid; and X11 is an amino acid comprising an aromatic ring; and (b) a metal chelator configured to bind with a radionuclide, wherein the metal chelator is covalently attached to the peptide.

5. The radiopharmaceutical or pharmaceutically acceptable salt thereof of claim 1, or conjugate or pharmaceutically acceptable salt thereof of claim 4, wherein the metal chelator comprises DOTA, DOTA-GA, pBn-DOTA, pBn-SCN-DOTA, NH2-DOTA, NH2-DOTA-GA, p-NCS- Bn-DOTA-GA, p-NH2-Bn-oxo-DO3A, p-SCN-Bn-oxo-DO3A, NOTA, NODA-GA, NH2- NODA-GA, p-NCS-Bn-NODA-GA, p-NH2-Bn-NOTA, p-SCN-Bn-NOTA, NCS-MP- NODA, NH2-MPAA-NODA, PCTA, p-NH2-Bn-PCTA, p-SCN-Bn-PCTA, p-SCN-Bn- HEHA, H2-MACROPA-NCS, H1-MACROPA, H2-MACROPA-NH2, H4-OCTAPA, tetra- (S, S, S, S)-Me-DOTA, tetra-(S, S, S, S)-Et-DOTA, tetra-(S, S, S, S)-iBu-DOTA, or maleimide-nBu-DOTA.

6. The radiopharmaceutical or pharmaceutically acceptable salt thereof of claim 1, or conjugate or pharmaceutically acceptable salt thereof of claim 4, wherein the metal chelator has thestructure:

7. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 6, wherein the metal chelator has the structure:

8. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-7, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-7, wherein the radionuclide is an alpha particle-emitting radionuclide.

9. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 8, wherein the alpha particle-emitting radionuclide is Ac-225, Bi-213, Bi-209, Tb-149, Ra-223, Th-227, Fr-223, Gd-148, Th-229, Pb-212, or Po-213.

10. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 9, wherein the alpha particle-emitting radionuclide is Ac-225.

11. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-7, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-7, wherein the radionuclide is a beta particle-emitting radionuclide.

12. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 11, wherein the beta particle-emitting radionuclide is Cu-67, Lu-177, Y-90, Rh-105, Yb-175, Tm-167, Pm-153, Sm-153, or In-111.

13. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 12, wherein the beta particle-emitting radionuclide is Lu-177.

14. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-7, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-7, wherein the radionuclide is a positron-emitting radionuclide.

15. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 14, wherein the positron-emitting radionuclide is Ga-68, Cu-62, Cu-64, Zr-89, Tb-152.

16. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 15, wherein the positron-emitting radionuclide is Ga-68.

17. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-7, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-7, wherein the radionuclide is Ac-225, Lu-177, or Ga-68.

18. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-17, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-17, further comprising a linker that covalently connects the peptide with the metal chelator.

19. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-18 , or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-18, wherein the linker is attached to a lysine of the peptide.

20. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-19 , or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-19, wherein the linker is attached to X1, X2, X3, X4, X8, or X12.

21. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-20 , or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-20, wherein the linker is attached to X1.

22. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-21 , or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-21, wherein the linker is a bond.

23. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-21 , or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-21, wherein the linker comprises 3 to 30 intervening non-hydrogen, organic atoms between the metal chelator and the peptide.

24. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-23, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-23, wherein the peptide has the structure of Formula (I-2):

25. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-24, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-24, wherein:X1 is I, R, Cit, F4G, 4Py, 3Py, KCOpipzaa, V, Eva, Q, E, MeI, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeV, MeHseMe, Aib, MeT, alI, TMe, MeKCOpipzaa, MeQ, Hpr, MeTMe, MeDapCOpipzaa, MeE, MeK, MeKAc, MeK(de), MeK(H), MeK(df), or MeK(datb); X2 is I, K, Cit, F4G, 4Py, 3Py, KCOpipzetOH, V, KCOpipzaa, Eva, Q, E, S, Ahp, F4COO, KCOpip4COO, MeQdMe, MeA, MeSMe, MeG, MeI, MeV, MeL, HseMe, MeY, Me3Py, MeHseMe, MeKAc, alI, TMe, MeTMe, MeK, MeKCOpipzaa, MeQ, Hpr, MeTMe, or MeDapCOpipzaaa; X3 is D, Har, KCOpipzetOH, Cit, KCOmeglumine, KCOpipzaa, A4paa, Q, A, da, MeA, Abu, Dap, diMeDap, G, MeG, V, E, MeD, S, T, N, Hgl, F4COO, KCOpip4COO, K, KAc, Hgn, MeY, or DapCOpipzaa; X4 is D, Har, KCOpipzetOH, KCOmeglumine, KCOpipzaa, A4paa, Q, A, E, MeD, S, N, Hgl, F4COO, KCOpip4COO, dd, MeQ, MeQdMe, MeA, MeSMe, MeG, EtG, MeeG, CmG, CmpG, CrmG, CeG, CrpG, MeK, MeKAc, MeHgl, Hgn, MeDapCOpipzaa, MeKCOpipzaa, Medd, Cit, MeCit, MeN, MeS, MeE, MeY, W5N, or MeA4paa; X5 is Y, F3G, 3Py6COO,4Py2NH2, 3Py5COO, F3COO, 3Py6NHAc, F, F4C, F4OMe, F4COO, MeF4COO, Nal2, F3aao, F4aa, F4aao, 3Py6NHaa, 5Pdo, F3CON, F4F, F4OEt, F4Me, F4CON, F4CONPEG4Me, F3OMe, F3CON, Yae, YaeCOpipzaa, F4aaopipzaa, 4Pdo, 3Py6CON, Atp, Cha4cH, Cha4tH, Cha4cOMe, A1mor, or F4amCOpipzaa; X6 is I, V, Eva, Chg, Tbg, A, L, Ahp, F4COO, Gcpr, Gcpe, alI, Cle, S3REt, TMe, alTMe, Acpr, Cba, Gthp, NleCOO, NleOH, P, Atb, Nva, Nle, N, DapAc, Abu, Nmm, Ndm, Ncit, Cit, SMe, HseMe, HseEt, HseiPr, dMeS, TdMe, Cbg, NvaOMe, SiPr, Spr, NleOMe, Sbu, Scbm, Scpe, AhpOMe, HseBu, Spent or Hsecpe; X7 is I, A, L, V, Eva, alI, TMe, SMe, Gcpr, Gcpe, Gthp, dMeS, TdMe, or Cbg; X8 is A, I, L, V, Y, Cha, Aph, F4OMe, F4COO, F4OEt, F4u, F4Me, F4F, F4CONdMe, F4CON, F4ms, F4CONPEG4Me, F34dOMe, F3OMe, F3C, F3CON, F3CONdMe, 3Py6CON, Yae, YaeCOpipzaa, 5Inda, F3OH, F3aao, F3aa, F4aao, F4aa, 3Py6Nhae, 3Py6NHAc, 3Py6OMe, F4aaopipzaa, or F4amCOpipzaa; X9 is MeNal2, MeNal27N, MeF34diox, MeF34dOMe, MeF4T, MeY, MeW1Me, MeiW, Me(7Me)6inda, Me(7Me)6indol, Me6inda, MeW7N, MeF3C4Me, or MeF3Me4C; X10 is G, MeG, A, or a D-amino acid; and X11 is Bph, 3Py6Ph, F41Me4Pyz, F43Pyz, F44Pyz, F41Pyz, F41Me3Pyz, F41Et4Pyz, F41MeOe4Pyz, F41MeOp4Pyz, F44thp, F4Ac4pip, PhNva, PhNle, Yph, Ybn, F4tb, F4oPr, F4CONdMe, 3Py(6-(2-Py)), 3Py(6-(3-Py)), 3Py(6-(4-Py)), 3Py6(Pip1),3Py6Imidaz1, 3Py6Me, 3Py6Oxaz5, 3Py6Pipza, 3Py6Pyrazol1, 3Py6Pyrazol3, 3Py6Pyrrol1, Phe(4-(2-Py)), Phe(4-(3-Py)), Phe(4-(4-Py)), or Phe35N4Ph.

26. The radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1 or 5-24, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 4-24, wherein: X1 is any amino acid; X2 is any amino acid; X3 is any amino acid; X4 is any amino acid; X5 iswherein: Rn5is hydrogen or C1-3alkyl; ring A5 is an aryl, heteroaryl, cycloalkyl, or heterocycloalkyl; each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX5-heterocycloalkyl, -LX5-cycloalkyl, -LX5-aryl, or -LX5-heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O, =S, or =N(Ra); LX5is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa- , wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a; kx5 is 0, 1, 2, or 3; mx5 is 0, 1, 2, 3, 4, or 5; *X4 represents the point of attachment to X4; and *X6 represents the point of attachment to X6;X6 iswherein; Rn6is hydrogen or C1-3alkyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX6-heterocycloalkyl, -LX6-cycloalkyl, -LX6-aryl, or -LX6-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; or Rn6and Rx6are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX6a; LX6is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a; *X5 represents the point of attachment to X5; and *X7 represents the point of attachment to X7; X7 iswherein:Rn7is hydrogen or C1-3alkyl ; RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, cycloalkyl, or heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a; RX7’is hydrogen or C1-3alkyl; *X6 represents the point of attachment to X6; and *X8 represents the point of attachment to X8; X8 iswherein;Rn8is hydrogen or C1-3alkyl; ring A8 is an aryl or heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX8-heterocycloalkyl, -LX8-cycloalkyl, -LX8-aryl, or -LX8-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O, =S, or =N(Ra); LX8is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a; kx8 is 0, 1, 2, or 3; mx8 is 0, 1, 2, 3, 4, or 5; *X7 represents the point of attachment to X7; and *X9 represents the point of attachment to X9; X9 iswherein: Rn9is hydrogen or C1-3alkyl; ring A9 is an aryl or heteroaryl; each RX9is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, or -NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O, =S, or =N(Ra); kx9 is 0, 1, 2, or 3; mx9 is 0, 1, 2, 3, 4, or 5; *X8 represents the point of attachment to X8; and *X10 represents the point of attachment to X10; X10 is glycine, methylglycine, or a D-amino acid;X11 iswherein: Rn11is hydrogen or C1-3alkyl; ring A11 is an aryl or heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, - NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX11-heterocycloalkyl, -LX11-cycloalkyl, -LX11-aryl, or -LX11-heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O, =S, or =N(Ra); LX11is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a; kx11 is 0, 1, 2, 3, 4, or 5; mx11 is 0, 1, 2, 3, 4, or 5; *X10 represents the point of attachment to X10; and *X12 represents the point of attachment to N(R2); each of RX5a, RX6a, RX7a, RX8a, RX9a, and RX11ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; each Rais independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl,aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; each Reis independently halogen, -CN, -OH, -O-C1-C6alkyl, -SF5, -S(=O)C1-C6alkyl, -S(=O)2C1-C6alkyl, -S(=O)2NH2, -S(=O)2-halogen, -S(=O)2NHC1-C6alkyl, -S(=O)2N(C1-C6alkyl)2, -NH2, -NHC1-C6alkyl, -N(C1-C6alkyl)2, -NHC(=NH)NH2, -NHC(=O)OC1-C6alkyl, -C(=O)C1-C6alkyl, -C(=O)OH, C1-C6alkyl-C(=O)OH, -C(=O)OC1-C6alkyl, -C(=O)NH2, -C(=O)N(C1-C6alkyl)2, -C(=O)NHC1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, or C1-C6heteroalkyl; or two Reare taken together to form =O; and each Rcand Rdare independently hydrogen, C1-C6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, cycloalkyl, heterocycloalkyl, aryl, heteroaryl, C1-C6alkyl(cycloalkyl), C1-C6alkyl(heterocycloalkyl), C1-C6alkyl(aryl), or C1-C6alkyl(heteroaryl), wherein each of the alkyl, alkenyl, alkynyl, cycloalkyl, heterocycloalkyl, aryl, and heteroaryl is independently optionally substituted with one or more Re; or Rcand Rdare taken together with the atom to which they are attached to form a heterocycloalkyl optionally substituted with one or more Re.

27. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 26, wherein X1 is an N-alkylated amino acid.

28. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 26, wherein: X1 iswherein:Rn1is hydrogen or C1-3alkyl; RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX1- heterocycloalkyl, -LX1-cycloalkyl, -LX1-aryl, or -LX1-heteroaryl, wherein each of the alkyl, alkenyl, alkynyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a; RX1’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX1a; orRn1and RX1’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX1a; LX1is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX1a; each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X12 represents the point of attachment to C(O)(CH2)kxR; and *X2 represents the point of attachment to X2.

29. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 28, wherein: X1 iswherein:Rn1is hydrogen or methyl; RX1is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, - LX1-5-6 membered heterocycloalkyl, -LX1-C4-6cycloalkyl, -LX1-C6-10aryl, or -LX1-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX1a; RX1’is hydrogen or methyl; or Rn1and RX1’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX1a; LX1is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX1a; each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, - NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa,-OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X12 represents the point of attachment to C(O)(CH2)kxR; and *X2 represents the point of attachment to X2.

30. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 28 or 29, wherein: RX1is hydrogen, C1-6alkyl, C1-6heteroalkyl, -LX1-piperidinyl, -LX1-piperazinyl, -LX1-phenyl, or -LX1-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX1a.

31. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 28-30, wherein: each RX1ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

32. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-31, wherein X2 is an N- alkylated amino acid.

33. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-31, wherein: X2 iswherein: Rn2is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX2a; RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, - LX2-heterocycloalkyl, -LX2-cycloalkyl, -LX2-aryl, or -LX2-heteroaryl, wherein each ofthe alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a; RX2’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX2a; or Rn2and RX2’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX2a; LX2is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX2a; each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, - N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, - C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, - NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, =N(Ra), aryl, heteroaryl, cycloalkyl, or heterocycloalkyl, wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X1 represents the point of attachment to X1; and *X3 represents the point of attachment to X3.

34. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 33, wherein: X2 iswherein: Rn2is hydrogen or methyl; RX2is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1- 6heteroalkyl, -LX2-5-6 membered heterocycloalkyl, -LX2-C4-6cycloalkyl, -LX2-C6-10aryl, or -LX2-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX2a; RX2’is hydrogen or methyl; orRn2and RX2’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX2a; LX2is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX2a; each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, - N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, - C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, - NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X1 represents the point of attachment to X1; and *X3 represents the point of attachment to X3.

35. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 33 or 34, wherein: RX2is hydrogen, C1-6alkyl, C1-6heteroalkyl, -LX2-piperidinyl, LX2-piperazinyl, -LX2-phenyl, or -LX2-pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX2a.

36. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 33-35, wherein: each RX2ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

37. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-36, wherein: X3 iswherein: Rn3is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX3a;RX3is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX3- heterocycloalkyl, -LX3-cycloalkyl, -LX3-aryl, or -LX3-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a; RX3’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX3a; or Rn3and RX3’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX3a; LX3is C1-6alkylene, C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX3a; each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, - NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X2 represents the point of attachment to X2; and *X4 represents the point of attachment to X4.

38. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 37, wherein: X3 is, wherein: Rn3is hydrogen or methyl; RX3is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, -LX3-5-6 membered heterocycloalkyl, -LX3-C3-6cycloalkyl, -LX3-C6-10aryl, or -LX3-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX3a;LX3is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX3a; each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, - NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X2 represents the point of attachment to X2; and *X4 represents the point of attachment to X4.

39. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 37 or 38, wherein: RX3is C1-6alkyl, C1-6heteroalkyl, -LX3-piperidinyl, LX3-piperazinyl, -LX3-phenyl, or -LX3- pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX2a.

40. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 37-39, wherein: each RX3ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

41. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-40, wherein: X4 iswherein: Rn4is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX4a;RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, -LX4- heterocycloalkyl, -LX4-cycloalkyl, -LX4-aryl, or -LX4-heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a; RX4’is hydrogen or C1-6alkyl, wherein the alkyl is optionally substituted with one or more RX4a; or Rn4and RX4’are taken together with the intervening atoms to form a 5- to 6- membered heterocycloalkyl, which is optionally substituted with one or more RX4a; LX4is C1-6alkylene or C1-6heteroalkylene, -O-, -S-, or -NRa-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX4a; each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, - NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X3 represents the point of attachment to X3; and *X5 represents the point of attachment to X5.

42. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 41, wherein: X4 iswherein: Rn4is hydrogen or C1-3alkyl, wherein the alkyl is optionally substituted with one or more RX4a; RX4is hydrogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, - LX4-5-6 membered heterocycloalkyl, -LX4-C3-6cycloalkyl, -LX4-C6-10aryl, or -LX4-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX4a;LX4is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX4a; each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, C2-C6alkenyl, C2-C6alkynyl, -CN, -NO2, -ORa, -SRa, - NRcRd, -S(=O)Ra, -S(=O)2Ra, -SF5, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, - NRaS(=O)2Ra, amidinyl, -NRaC(=NH)(NRa)2, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, aryl, heteroaryl, cycloalkyl, heterocycloalkyl, =O, =S, or =N(Ra), wherein each of the aryl, heteroaryl, cycloalkyl, heterocycloalkyl, alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more Re; *X3 represents the point of attachment to X3; and *X5 represents the point of attachment to X5.

43. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of claim 41 or 42, wherein: RX4is C1-6alkyl, C1-6heteroalkyl, -LX4-piperidinyl, LX4-piperazinyl, -LX4-phenyl, or -LX4- pyridinyl, wherein each of the alkyl, heteroalkyl, phenyl, pyridinyl, piperidinyl, and piperazinyl is optionally substituted with one or more RX4a.

44. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 41-43, wherein: each RX4ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, - OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, - C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

45. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-44, wherein X4 is an N- alkylated amino acid.

46. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-44, wherein X4 is a peptoid.

47. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-46, wherein: Rn5is hydrogen or methyl; ring A5 is a C6-10aryl, 5-10 membered heteroaryl, C6-10cycloalkyl, or 5-10 membered heterocycloalkyl;each RX5is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -S(=O)(=NRa)Ra, -N=S(=O)NRcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX5-5-6 membered heterocycloalkyl, -LX5-C3-6cycloalkyl, -LX5-C6-10aryl, or -LX5-5-10 membered heteroaryl, wherein the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O; and LX5is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX5a.

48. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-47, wherein: ring A5 is a phenyl, naphthyl, pyridinyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, or tetrahydropyranyl; each RX5is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1- 6aminoalkyl, C1-6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, - OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -LX5-piperidinyl, or LX5-piperazinyl, wherein each of the alkyl, heteroalkyl, piperidinyl, and piperazinyl are optionally substituted with one or more RX5a; or two RX5are taken together to form =O; kx5 is 1 or 2; and mx5 is 0, 1, or 2.

49. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-48, wherein: each RX5ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

50. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-49, wherein: Rn6is hydrogen or methyl; RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX6-5-6 membered heterocycloalkyl, -LX6-C3-6cycloalkyl, -LX6-C6-10aryl, or -LX6-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a; and LX6is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX6a.

51. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-50, wherein: RX6is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX6-5-6 membered heterocycloalkyl, -LX6- C3-6cycloalkyl, -LX6-phenyl or -LX6-6 membered heteroaryl, wherein each of the alkyl, heteroalkyl, phenyl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX6a.

52. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-51, wherein: each RX6ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1- C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

53. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-52, wherein: Rn7is hydrogen or methyl; and RX7is C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2- 6alkenyl, C2-6alkynyl, C3-6cycloalkyl, or 5-6 membered heterocycloalkyl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a.

54. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-53, wherein:RX7is C1-6alkyl, C1-6heteroalkyl, C3-6cycloalkyl, or 5-6 membered heterocycloalkyl, wherein each of the alkyl, heteroalkyl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX7a.

55. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-54, wherein: each RX7ais independently halogen, -CN, -ORa, -SRa, -NRcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O.

56. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-55, wherein: ring A8 is a C6-10aryl or 5-10 membered heteroaryl; each RX8is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O) RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX8-5-6 membered heterocycloalkyl, -LX8- C3-6cycloalkyl, -LX8- C6-10aryl, or -LX8-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, alkenyl, alkynyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX8a; or two RX8are taken together to form =O; and LX8is C1-6alkylene or C1-6heteroalkylene, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX8a.

57. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-56, wherein: ring A8 is a phenyl, pyridinyl, indolyl, azaindolyl, indazolyl, or benzimidazolyl; each RX8is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1- 6aminoalkyl, C1-6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, - S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2NRcRd, -C(=O)Ra, -C(=O)ORa, - OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, - NRaC(=O)NRcRd, -C(=O)NRcRd, -LX8-piperidinyl, or LX8-piperazinyl, wherein each of the alkyl, heteroalkyl, piperidinyl, and piperazinyl are optionally substituted with one or more RX8a; ortwo RX5are taken together to form =O; kx8 is 1 or 2; and mx8 is 0, 1, or 2.

58. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-57, wherein: each RX8ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

59. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-58, wherein: Rn9is hydrogen or methyl; ring A9 is a C6-10aryl or 5-10 membered heteroaryl; and each RX9is independently halogen, C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1- 6aminoalkyl, C1-6heteroalkyl, C2-6alkenyl, C2-6alkynyl, -CN, -NO2, -ORa, -SRa, -SF5, or - NRcRd, wherein each of the alkyl, heteroalkyl, alkenyl, and alkynyl is optionally substituted with one or more RX9a; or two RX9are taken together to form =O.

60. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-59, wherein: ring A9 is a phenyl, naphthyl, pyridinyl, indolyl, azaindolyl, indazolyl, benzimidazolyl, or isoquinolinyl; each RX9is independently halogen, C1-6alkyl, C1-6haloalkyl, -CN, -ORa, -SRa, or -NRcRd, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more RX9a; kx9 is 1 or 2; and mx9 is 0, 1, or 2.

61. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-60, wherein: each RX9ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd,-C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

62. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-61, wherein: ring A11 is a C6-10aryl or 5-10 membered heteroaryl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -SF5, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -S(=O)(=NRa)Ra, -N=S(=O)RcRd, -NRaS(=O)2Ra, amidinyl, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, -P(=O)(ORc)(ORd), -P(=O)RcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5-6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O; and LX11is C1-6alkylene, C1-6heteroalkylene, or -O-, wherein the alkylene and heteroalkylene is optionally substituted with one or more RX11a.

63. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-62, wherein: ring A11 is a phenyl or pyridinyl; each RX11is independently C1-6alkyl, C1-6haloalkyl, C1-6hydroxyalkyl, C1-6aminoalkyl, C1-6heteroalkyl, halogen, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, -S(=O)2Ra, -S(=O)2RcRd, -NRaS(=O)2Ra, -NRaC(=NH)NRcRd, -NRaS(=O)2RcRd, -C(=O)Ra, - C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, C6-10aryl, 5-10 membered heteroaryl, C3-6cycloalkyl, 5- 6 membered heterocycloalkyl, -LX11-5-6 membered heterocycloalkyl, -LX11- C3-6cycloalkyl, -LX11- C6-10aryl, or -LX11-5-10 membered heteroaryl, wherein each of the alkyl, heteroalkyl, aryl, heteroaryl, cycloalkyl, and heterocycloalkyl is optionally substituted with one or more RX11a; or two RX11are taken together to form =O; kx11 is 1, 2, 3, or 4; and mx11 is 0, 1, or 2.

64. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-63, wherein: each RX11is independently phenyl, pyridinyl, pyrrolyl, pyrazolyl, imidazolyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, -LX11-5-6 membered heterocycloalkyl, - -LX11-phenyl, or -LX11-pyridinyl, wherein each of the phenyl, pyridinyl, pyrrolyl, pyrazolyl, imidazolyl, cyclohexyl, piperidinyl, piperazinyl, morpholinyl, tetrahydropyranyl, and heterocycloalkyl is optionally substituted with one or more RX11a.

65. The radiopharmaceutical or pharmaceutically acceptable salt thereof, or conjugate or pharmaceutically acceptable salt thereof of any one of claims 26-64, wherein: each RX11ais independently halogen, C1-6alkyl, C1-C6haloalkyl, C1-C6hydroxyalkyl, C1-C6aminoalkyl, C1-C6heteroalkyl, -CN, -NO2, -ORa, -SRa, -NRcRd, -S(=O)Ra, - S(=O)2Ra, -S(=O)2NRcRd, -NRaS(=O)2Ra, -NRaC(=NH)(NRa)2, -C(=O)Ra, -C(=O)ORa, -OC(=O)Ra, -OC(=O)ORa, -OC(=O)NRcRd, -NRaC(=O)Ra, -NRaC(=O)ORa, -NRaC(=O)NRcRd, -C(=O)NRcRd, or =O, wherein each of the alkyl and heteroalkyl is optionally substituted with one or more Re.

66. A conjugate or pharmaceutically acceptable salt thereof of claim 5, wherein the conjugate is selected from Table 9.

67. A conjugate having the structure:, or a pharmaceutically acceptable salt thereof.

68. A pharmaceutical composition comprising a radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-65, and a pharmaceutically acceptable excipient or carrier.

69. A method of treating a disease or disorder characterized by overexpression of glypican 3 (GPC3) in a subject in need of treatment, the method comprising administering to the subject a therapeutically effective amount of a radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-65, or pharmaceutical composition of claim 68.

70. A method of treating a disease or disorder characterized by overexpression of GPC3 in a subject in need of treatment, the method comprising: administering to the subject a first radiopharmaceutical or pharmaceutically acceptable salt thereof; and administering to the subject a therapeutically effective amount of a second radiopharmaceutical or pharmaceutically acceptable salt thereof, wherein: the first radiopharmaceutical or pharmaceutically acceptable salt thereof is of any one of claims 1-3 or 5-65, wherein the radionuclide is a diagnostic radionuclide; and the second radiopharmaceutical or pharmaceutically acceptable salt thereof is of any one of claims 1-3 or 5-65, wherein the radionuclide is a therapeutic radionuclide.

71. A method of diagnosing a disease or disorder characterized by overexpression of GPC3 in a subject in need thereof, comprising administering to the subject a radiopharmaceutical or pharmaceutically acceptable salt thereof of any one of claims 1-3 or 5-65, or pharmaceutical composition of claim 68; and imaging the subject, thereby determining expression level of GPC3 in the subject, wherein the radionuclide is suitable for use as an imaging isotope.

72. The method of any one of claims 69-71, wherein the disease or disorder is cancer.

73. The method of claim 72, wherein the cancer is hepatocellular carcinoma, squamous cell carcinoma of the lung, lung adenocarcinoma, germ cell tumors, hepatoblastoma, wilms tumor, malignant rhabdoid tumors, rhabdomyosarcoma, liposarcoma, thyroid cancers, pancreatic cancer, small bowel cancer, small cell neuroendocrine carcinoma (SCNC), hormonally treated, castration resistant prostatic adenocarcinoma, ovarian cancer, gastric cancer, esophageal carcinoma, or, malignant melanoma.

74. A kit, tester, or composition for determining expression level of GPC3 in a sample, wherein the kit, tester, or composition comprises a radiopharmaceutical, a conjugate, or pharmaceutically acceptable salt thereof of any one of claims 1-67, or pharmaceutical composition of claim 68.

75. The kit, tester, or composition of claim 74, adapted for use in a method of diagnosing a disease or disorder characterized by an overexpression or a decreased expression of GPC3.

76. The kit, tester, or composition of claim 74 or 75, wherein the sample is from a subject suspected of having a disease or disorder characterized by an overexpression or a decreased expression of GPC3.