Programmable mirna-dependent gene expression

Abstract

The present invention provides miRNA-based polynucleotide circuits which can be programmed to express a polypeptide payload in a target cell type or tissue, or a cell in a specific state, or a target species. The present invention further provides vectors, host cells, and pharmaceutical compositions comprising the miRNA-based polynucleotide circuits. The present invention further provides a method of selectively expressing a payload polypeptide in a target cell type or tissue, or a cell in a specific state.

Description

Programmable miRNA-Dependent Gene ExpressionCROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This patent application claims priority to U.S. Provisional Application No. 63 / 521,537, filed on June 16, 2023, the disclosure of which is herein incorporated by reference in its entirety.SEQUENCE LISTING

[0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on June 13, 2024, is named 243735_000349_SL.xml and is 11,058 bytes in size.FIELD OF THE INVENTION

[0003] The present invention relates to miRNA-based polynucleotide circuits which can be programmed to express a polypeptide payload in a target cell type or tissue, or a cell in a specific state, or a target species. The present invention further relates to vectors, host cells, and pharmaceutical compositions comprising the miRNA-based polynucleotide circuits. The present invention further relates to a method of selectively expressing a payload polypeptide in a target cell type or tissue, or a cell in a specific state.BACKGROUND

[0004] The capacity to deliver a desired biologic cargo to a specific cell type or tissue is arguably the most significant barrier in transforming basic science discoveries into clinically relevant therapeutics. Experimental platforms presently used to mediate delivery generally focus on virus-dependent and -independent carriers and attempt to achieve specificity in a variety of ways. Despite some notable successes, enabling specific delivery of a desired biologic cargo remains the central roadblock for the vast majority of clinical needs1.

[0005] Despite the excitement surrounding the use of mRNA-based therapeutics, utilization of this platform is limited to vaccine applications where short-term expression in a very small number of cells is sufficient to achieve the desired outcome2. For most therapeutic needs, a platform that can elicit a more sustained response in a greater number of specific cell types is generally required. In this clinical space, the use of viral vectors to deliver therapeuticcargoes has gained significant regulatory approval in recent years3. At present, many biologic-based therapies rely on one of three viral vectors, notably, adeno-associated-virus (AAV) vectors, adenovirus vectors, or lentivirus vectors, although many alternative platforms are also in development4. AAV and adenovirus vectors are typically used in therapies where they are directly administered to patients by infusion, with AAV being the most popular vector for areas outside of oncology and vaccines. Lentivirus vectors are typically used for ex vivo therapies, in which cells harvested from a patient are isolated and treated in the lab prior to being re-introduced4. While existing viral vector-based therapies such as these continue to make significant advances, the full extent of their clinical impact remains unclear in part because of a number of limitations including achieving cell specificity'. Following successful entry of a given viral vector, efficacy depends on the quality’ of transgene expression. Specifically, the biologic cargo of interest must be expressed at the appropriate level, in the appropriate cells, and for the appropriate duration to mediate the desired clinical effect. Efforts to achieve this have traditionally focused on the inclusion of regulatory elements but these efforts have not yet materialized into a technology that provides programable tissue or cell-specific resolution as it relates to biologic activity-.

[0006] Accordingly, there is an unmet need for new strategies to achieve tissue or cellspecific delivery of biologic cargos.SUMMARY OF THE INVENTION

[0007] In one aspect, provided herein is a polynucleotide comprising: a) a nucleotide sequence encoding a ribosomal frameshift stimulator; b) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA, and wherein each of the one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting the MSE sequence; c) a first ribosomal frameshift element; d) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5‘ to the nucleotide sequence encoding the first payload polypeptide, andwherein translation of the first pay load polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and e) optionally one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting mRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator.

[0008] In some embodiments, the one or more MSE sequences are positioned in the open reading frame (ORF) or in the 3’ untranslated region (3’ UTR) of the ribosomal frameshift stimulator transcript coding sequence.

[0009] In some embodiments, the polynucleotide further comprises a first promoter, and wherein expression of the ribosomal frameshift stimulator is under the control of the first promoter.

[0010] In some embodiments, expression of the first payload polypeptide is under the control of the first promoter.

[0011] In some embodiments, the polynucleotide is structured as an alternatively spliced construct, wherein one transcript comprises the nucleotide sequence encoding the ribosomal frameshift stimulator and one or more MSE sequences, and another transcript comprises the first ribosomal frameshift element and the nucleotide sequence encoding the first payload polypeptide. In some embodiments, the polynucleotide is structured as an alternatively spliced construct, wherein one transcript comprises the nucleotide sequence encoding the ribosomal frameshift stimulator and one or more MSE sequences, and another transcript does not comprise the nucleotide sequence encoding the ribosomal frameshift stimulator and one or more MSE sequence. In some embodiments, the polynucleotide further comprises a 5' donor splice site and a 3‘ acceptor splice site. In one embodiment, the 5’ donor splice site comprises the sequence AG*GU(A / G)AGU or AG*GU(A / G)GAU, wherein * denotes the splice junction. In one embodiment, the 3’ acceptor splice site comprises a branch point, a pyrimidine tract, and the sequence AG*G, wherein * denotes the splice junction.

[0012] In some embodiments, the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding apayload polypeptide, and wherein expression of the first payload polypeptide and the one or more additional payload polypeptides is under the control of the first promoter.

[0013] In some embodiments, the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein expression of the first payload polypeptide is under the control of the first promoter, and expression of each of the additional payload polypeptides is under the control of respective additional promoters.

[0014] In some embodiments, the polynucleotide further comprises a second promoter, wherein expression of the first payload polypeptide is under the control of the second promoter. In some embodiments, the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein expression of each of the additional payload polypeptides is under the control of respective additional promoters. In some embodiments, the polynucleotide further comprises one or more DNA insulator elements, wherein the one or more DNA insulator elements are positioned between the 3’UTR of the ribosomal frameshift stimulator transcript coding sequence and the second promoter, and wherein the DNA one or more DNA insulator elements enhance efficiency of termination of transcription of the ribosomal frameshift stimulator. In some embodiments, the polynucleotide further comprises one or more DNA insulator elements, wherein the DNA insulator elements are positioned between the 3’UTR of each subsequent transcript and each subsequent promoter, and wherein the DNA insulator elements enhance efficiency of termination of transcription. In one embodiment, the DNA insulator element comprises CCCTC-binding factor site(s).

[0015] In some embodiments, the nucleotide sequence encoding the first pay load polypeptide is positioned in frame with the first ribosomal frameshift element.

[0016] In some embodiments, the nucleotide sequence encoding the first payload polypeptide is positioned in -1 translation frame in relation to the first ribosomal frameshift element.

[0017] In some embodiments, the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein the nucleotide sequence encoding each additional payload polypeptide is independently positioned in frame or in -1 translation frame in relation to its closest 5' ribosomal frameshift element in the resulting mRNA.

[0018] In one embodiment, provided herein is a polynucleotide comprising from 5’ to 3’: a) a first promoter;b) a 5’ donor splice site: c) a nucleotide sequence encoding a ribosomal frameshift stimulator; d) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA, and wherein each of the one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting the MSE sequence: e) a 3’ splice acceptor site, f) a first ribosomal frameshift element, and g) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the first payload polypeptide is positioned in frame or in -1 translation frame in relation to the first ribosomal frameshift element.

[0019] In one embodiment, the polynucleotide described above further comprises 3’ to the nucleotide sequence encoding the first pay load polypeptide from 5’ to 3’: h) a second promoter; i) a second ribosomal frameshift element, and j) a nucleotide sequence encoding a second payload polypeptide, wherein the second ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the second payload polypeptide, wherein translation of the second payload polypeptide is controlled by the second ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the second payload polypeptide is positioned in frame or in -1 translation frame in relation to the second ribosomal frameshift element.

[0020] In one embodiment, the polynucleotide further comprises a DNA insulator element, wherein the DNA insulator element is positioned between the nucleotide sequence encodingthe first payload polypeptide and the second promoter, and wherein the DNA insulator element enhances efficiency of termination of transcription.

[0021] In one embodiment, the 5’ donor splice site comprises the sequence AG*GU(A / G)AGU or AG*GU(A / G)GAU, wherein * denotes the splice junction.

[0022] In one embodiment, the 3 ’ acceptor splice site comprises a branch point, a pyrimidine tract, and the sequence AG*G, wherein * denotes the splice junction.

[0023] In one embodiment, provided herein is a polynucleotide comprising from 5?to 3’: a) a first promoter; b) a nucleotide sequence encoding a ribosomal frameshift stimulator; c) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA, and wherein each of the one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting the MSE sequence, d) a second promoter; e) a first ribosomal frameshift element, andI) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the first payload polypeptide is positioned in frame or in -1 translation frame in relation to the first ribosomal frameshift element.

[0024] In one embodiment, the polynucleotide further comprises a DNA insulator element, wherein the DNA insulator element is positioned between the 3’UTR of the ribosomal frameshift stimulator transcript coding sequence and the second promoter, and wherein the DNA insulator element enhances efficiency of termination of transcription.

[0025] In one embodiment, the polynucleotide further comprises 3’ to the nucleotide sequence encoding the first pay load polypeptide from 5’ to 3‘: g) a third promoter; h) a second ribosomal frameshift element, andi) a nucleotide sequence encoding a second payload polypeptide, wherein the second ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the second payload polypeptide, wherein translation of the second payload polypeptide is controlled by the second ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the second payload polypeptide is positioned in frame or in -1 translation frame in relation to the second ribosomal frameshift element.

[0026] In one embodiment, the polynucleotide further comprises a DNA insulator element, wherein the DNA insulator element is positioned between the nucleotide sequence encoding the first payload polypeptide and the third promoter, and wherein the DNA insulator element enhances efficiency of termination of transcription.

[0027] In various embodiments, the first promotor is an RNA polymerase II promoter. The first promoter may be a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

[0028] In various embodiments, the second promoter is an RNA polymerase II promoter. The second promoter may be a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

[0029] In various embodiments, the third promoter is an RNA polymerase II promoter. The third promoter is a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

[0030] In various embodiments, the first promoter is a bi-directional promoter which drives expression of the ribosomal frameshift stimulator in one direction and the first pay load polypeptide in the opposite direction.

[0031] In another aspect, provided herein is a polynucleotide comprising from 5’ to 3’: a) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of said one or more MSE sequences is targeted by a miRNA, b) a nucleotide sequence encoding a ribosomal frameshift stimulator, wherein each of said one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of theribosomal frameshift stimulator in the absence of the respective miRNA targeting said MSE sequence; c) a bi-directional promoter; d) a first ribosomal frameshift element; e) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the bidirectional promoter drives expression of the ribosomal frameshift stimulator in one direction and the first payload polypeptide in the opposite direction; and f) optionally one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting rnRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator.

[0032] In various embodiments, the bi-directional promoter is selected from human promoter for 3-phosphogly cerate kinase (hPGK) promoter, a minimal Cytomegalovirus (CMV) promoter, TRE3G promoter, Ponasterone A, and combinations thereof.

[0033] In various embodiments, the ribosomal frameshift stimulator is a cardiovirus 2A protein. In one embodiment, the cardiovirus 2A protein comprises the amino acid sequence SEQ ID NO: 1, or a variant thereof. In one embodiment, the cardiovirus 2A protein consists of the amino acid sequence SEQ ID NO: 1, or a variant thereof. In one embodiment, the nucleotide sequence encoding the cardiovirus 2A protein comprises the sequence SEQ ID NO: 2, or a variant thereof. In one embodiment, the nucleotide sequence encoding the cardiovirus 2A protein consists of the sequence SEQ ID NO: 2, or a variant thereof.

[0034] In various embodiments, the first ribosomal frameshift element comprises from 5?to 3’:1) a 5 ’ shift site,2) a spacer sequence, and3) a stem-loop structure.

[0035] In various embodiments, the second ribosomal frameshift element comprises from 5’ to 3’:1) a 5’ shift site,2) a spacer sequence, and3) a stem-loop structure.

[0036] In one embodiment, the 5’ shift site comprises the sequence 5’-GGUUUUU-3’. In one embodiment, the 5?shift site consists of the sequence 5 -GGUUUUU-3’.

[0037] In some embodiments, the spacer is 13 orl 4 nucleotides long. In one embodiment, the spacer comprises the sequence SEQ ID NO: 4. In one embodiment, the spacer consists of the sequence SEQ ID NO: 4.

[0038] In some embodiments, the stem-loop structure comprises a stem of 7 nucleotides. In one embodiment, the stem-loop structure comprises the sequence 5’-CGGCAGU-3’ followed by a 21 nucleotide loop and the complementary sequence 5’ ACUGCCG-3’.

[0039] In some embodiments, the loop of the stem-loop structure comprises an adenosine triplet followed by a cytosine triplet. In one embodiment, the loop structure comprises the sequence GUCAUCAAUGGCUCAAACCCU (SEQ ID NO: 7). In one embodiment, the loop structure consists of the sequence GUCAUCAAUGGCUCAAACCCU (SEQ ID NO: 7).

[0040] In various embodiments, the first ribosomal frameshift element comprises the sequenceGGUUUUUCAGACUCAAGGAGCGGCAGUGUCAUCAAUGGCUCAAACCCUACUGC CG (SEQ ID NO: 8), or a sequence having at least 60% identity thereto.

[0041] In various embodiments, the second ribosomal frameshift element comprises the sequence GGUUUUUCAGACUCAAGGAGCGGCAGUGUCAUCAAUGGCUCAAACCCUACUGC CG (SEQ ID NO: 8), or a sequence having at least 60% identity thereto.

[0042] In various embodiments, the first ribosomal frameshift element causes -1 frameshift in the presence of the ribosomal frameshift stimulator.

[0043] In various embodiments, the second ribosomal frameshift element causes a -1 frameshift in the presence of the ribosomal frameshift stimulator.

[0044] In various embodiments, the polynucleotide further comprises one or more additional combinations of an additional ribosomal frameshift element and a nucleotide sequence encoding an additional payload polypeptide, wherein the additional ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the additional payload polypeptide, wherein translation of the additional pay load polypeptide is controlledby the additional ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the additional payload polypeptide is positioned in frame or in -1 translation frame in relation to the additional ribosomal frameshift element.

[0045] In various embodiments, the polynucleotide comprises two MSE sequences. In some embodiments, when two or more MSE sequences are present, at least two of these MSE sequences are targeted by the same miRNA. In some embodiments, when two or more MSE sequences are present, at least two of these MSE sequences are targeted by different miRNAs.

[0046] In various embodiments, the one or more MSE sequences are targeted by miRNA(s) which is characterized by tissue-specific, cell type-specific, cell-state-specific or speciesspecific expression. In some embodiments, the one or more MSE sequences is targeted by miR-1, miR-155, miR-124, miR-182, miR-96, miR-183, miR-21, miR-16, miR-17, miR-19, miR-25, miR-34, miR-92, miR-93, miR-142, miR-222, miR-149, miR-375, miR-503, or miR-181b-2.

[0047] In various embodiments, the first payload polypeptide is a gene editing nuclease, a chimeric antigen receptor (CAR), an antibody, a cytotoxic protein, a cell surface receptor, a transcription factor, an enzyme, a reporter protein, a cytokine, or a polypeptide that confers drug resistance.

[0048] In various embodiments, the second payload polypeptide is a gene editing nuclease, a chimeric antigen receptor (CAR), an antibody, a cytotoxic protein, a cell surface receptor, a transcription factor, an enzyme, a reporter protein, a cytokine, or a polypeptide that confers drug resistance.

[0049] In some embodiments, the gene editing nuclease is a Cas protein, ZFN nuclease, or TALEN. In one embodiment, the Cas protein is Cas9.

[0050] In another aspect, provided herein is a vector comprising the polynucleotide described herein. In some embodiments, the vector is a viral vector. In some embodiments, the viral vector is a retroviral vector, an adenovirus vector, a parvovirus vector, an influenza virus vector, a herpes virus vector, a poxvirus vector, a rhabdovirus vector, a paramyxovirus vector, a morbillivirus vector, or a reovirus vector. In some embodiments, the retroviral vector is a lentiviral vector. In some embodiments, the parvoviral vector is an adeno- associated virus (AAV) vector. In some embodiments, the paramyxovirus vector is a Sendai virus (SeV) vector.

[0051] In another aspect, provided herein is a composition comprising the polynucleotide or the vector described herein and a carrier or excipient. In some embodiments, the composition is a pharmaceutical composition comprising the polynucleotide or the vector and a pharmaceutically acceptable carrier or excipient.

[0052] In another aspect, provided herein is a host cell comprising the polynucleotide, or the vector described herein.

[0053] In another aspect, provided herein is a method of selectively expressing a payload polypeptide in a target cell type or tissue or a cell in a specific state within a multicellular organism, comprising introducing to the multicellular organism an effective amount of the polynucleotide, or the vector, or the composition described herein. In some embodiments, the multicellular organism is an animal, a plant, or a fungus. In some embodiments, the animal is a human, veterinary animal, or experimental animal.BRIEF DESCRIPTION OF THE DRAWINGS

[0054] Fig. 1 shows a schematic of the cardiovirus programmed ribosomal frameshifting (PRF) element. Figure discloses SEQ ID NO: 12.

[0055] Fig. 2 shows a schematic of the programmable ribosomal shift element of cardioviruses which, in the presence of the 2A protein, results in a ribosomal -1 shift.

[0056] Figs. 3A-3B show the schematic of a bicistronic RNA encoding epitope tagged GFP and mCherry, the latter being in a -1 frame. Between the constructs is either a canonical stem loop (SL), or a mutated form lacking the cytosine triplet (SLmut), from EMCV which serves as the 2A-dependent ribosomal shift site (Fig. 3A). Western blot of protein derived from cells transfected with a wild type and mutated version of the constructs depicted in Fig. 3A with either 2A or a mutant form (m2A) (Fig. 3B).

[0057] Figs. 4A-4B show the schematic of lentivirus constructs expressing a miR-21- targeted 2A transcript and an alternative splice site to generate mCherry (dashed lines). Downstream of the 3’ splice site contains the 2A-dependent ribosomal frame shift motif (Fig. 4A). In the presence of miR-21, 2A should be silenced and mCherry can be translated in original frame (frame 0). In the absence of miR-21, 2A creates a functional ribosomal frameshift element, resulting in change to the -1 frame for the cargo (mCherry) (Fig. 4A). If the cargo (mCherry) is constructed in frame 0, the presence of miR-21 and the absence of 2A will enable expression. If the cargo (mCherry) in constructed in the -1 frame, expression will be limited to conditions in which miR-21 is absent and 2A is present (Fig. 4A). Fluorescentmicroscopy of wild-type MDCK cells (MDCKWT) and MDCK cells lacking miR-21 (MDCKmiR-21 / ) 2 days post transduction (2dpt) with a lentivirus depicted in Fig. 4A where the mCherry cargo was constructed to be in frame 0 relative to the ribosomal frame shift motif (Fig. 4B). Abbreviation used in the Figure: pA = Poly adenylation sequence.

[0058] Figs. 5A-5B show various exemplary7gene expression schemes utilizing programmable miRNA-dependent gene expression. The expression scheme can be utilized to express a single gene of interest (GOI) or multiplexed GOI through the use of alternative splicing events and / or multiple promoters. Abbreviations used in the Figure: Pl= Promoter 1 ; pA = Poly adenylation sequence; I = Insulator; P2= Promoter 2; P3= Promoter 3.

[0059] Fig. 6 illustrates lentivirus- and AAV2-based miRNA-on switches with a single cytomegalovirus (CMV) promoter controlling cargo (mCherry) in frame 0 relative to the ribosomal frame shift motif in 293T cells. miR-21, but not miR-124, is present in 293T cells. Abbreviations used in the Figure: Pl = Promoter 1; pA = Poly adenylation sequence.

[0060] Fig. 7 illustrates lentivirus-based miRNA-on switch with a single CMV promoter controlling cargo (mCherry7) in frame 0 relative to the ribosomal frame shift motif in U-87 cells. miR-124. but not miR-21, is present in U-87 cells. Abbreviations used in the Figure: Pl= Promoter 1; pA = Poly adenylation sequence; SL=stem loop.

[0061] Fig. 8 illustrates further exemplary7gene expression schemes utilizing programmable miRNA-dependent gene expression. Abbreviations used in the Figure: Pl= Promoter 1; pA = Poly adenylation sequence; P2= Promoter 2.

[0062] Figs. 9A-9C illustrate a miRNA-dependent expression construct developed using a lentivirus delivery platform. Schematic of a plasmid encoding eGFP as two independent exons wherein the intron contains the pre-cursors for either Homo sapien miR-21 (hsa-miR- 21) or miR-375 (hsa-miR-375) (Fig. 9A). Schematic of a lentiviral genome comprising a bidirectional promoter designed to express an EMCV 2A frameshift protein harboring two miR-21 target sites in the 3’ UTR and an in-frame mCherr7transcript harboring a 5’ stem loop (SL) comprising the EMCV programable ribosomal shift (PRS) element (Fig. 9B). Fluorescent microscopy images of 293 cells co-transfected with the pLenti-2A-miR-21-PRS- mCherry plasmid and a pcDNA-eGFP construct expressing either miR-21 or miR-375 (Fig. 9C). Images were taken at 3 days post treatment. Top panels show mCherry expression and bottom panels show7eGFP expression.

[0063] Figs. 10A-10B illustrate a miRNA-dependent expression construct developed using a Sendai virus delivery platform. Schematic of an engineered Sendai virus genome encoding microRNA-21 (miR-21 )-targeted (miR-21T) transcript encoding the EMCV 2A protein (2A)and an in-frame mCherry transcript harboring a 5 ' stem loop (SL) comprising either a functional or mutated (SLmut) version of the EMCV programable ribosomal shift (PRS) element (Fig. 10A). Fluorescent microscopy images denoting mCherry expression in wild type Madin-Darby Canine Kidney (MDCK) cells, or a clonal MDCK line in which miR-21 expression was disrupted (MDCK™11’217’) (Fig. 10B). Panels denote cells infected with the recombinant viruses depicted in Fig. 10A at a multiplicity of infection of 5 at 48 hours post infection.

[0064] Figs. 11 A-l 1 C show results of an in vivo study using an engineered Sendai virus delivery platform. Schematics of a Sendai virus engineered to express the 2 A protein with three miR-503 targets in its 3’ UTR (Fig. 11A). Red fluorescent protein (RFP) expression analyzed by immunohistochemistry (IHC) (Fig. 11B). A volcano plot of differentiated genes from RFP+ cells, showing that two genes, namely AQP5 and SFTPC, were significantly enriched (Fig. 11C).DETAILED DESCRIPTION

[0065] One strategy to restrict expression of RNA- or DNA-based therapies to minimize off-target effects is the exploitation of miRNAs5’9In most eukaryotic organisms, small noncoding RNAs called microRNAs (miRNAs) fine-tune protein expression by engaging rnRNAs to induce de-adenylation and / or stall the ribosome during the translation process10. This biology orchestrates various developmental processes and is essential for maintaining most cell lineages in the body. In contrast to antiviral RNA interference (RNAi) utilized by plants and arthropods where the small RNA is captured from incoming virus. miRNAs derive from host-encoded RNA hairpins and do not participate in the host defenses11. A miRNA is loaded into an RNA-induced silencing complex (RISC) and engages its target rnRNAs in a sequence-specific manner. The impact a miRNA has on its cognate host target(s) is determined by the extent of complementarity. Typically, binding of a miRNA to the target mRNA is not contiguous like it is for antiviral RNAi, leading to only moderate changes in target RNA regulation and protein output with levels ranging from 1.1- to 1.5-fold reductions11. The modest repression induced by miRNAs do not elicit drastic changes in the cell when measured over days. However, miRNA biology can dramatically influence cellular processes over the course of weeks to months and are ideal modulators of cell development and differentiation. For this reason, most cell lineages harbor a distinct profile of miRNAs although examples of ubiquitous species are also common. As this modest level of repressionis a product of target complementarity, should a miRNA engage an mRNA containing a target with perfect complementarity, the mRNA would be enzymatically cleaved, leading to complete ablation of the message akin to siRNA biology12. While this biology does not naturally occur in vertebrates, it can be engineered and applied to both mRNA and vectorbased designs to control tropism. Indeed, there are now many reports of successful designs where such strategies have successfully limited the capacity of a given genetic circuit to be silenced in a specific cell lineage or tissue based on the unique expression of a miRNA. Despite the value in excluding expression of a biologic target in unwanted tissues, application of this concept does not enable one to achieve cell-specific expression unless every' unwanted cell ty pe both expressed a unique miRNA and a target for each tissue could be incorporated into the asset of interest. This is not possible because the miRNA expression profiles of all cell types are not known and, if this knowledge was obtained, the space constraints to include each target would be prohibitive as cargo capacity7in most clinical vectors is finite. As a result, a new strategy for achieving cell-specificity7is needed.

[0066] Incorporation of the miRNA-based circuit described herein can ensure that a given mRNA- or vector- based therapeutics delivers its biological pay load exclusively to a given cell type of interest. The capacity to achieve this minimizes toxicity7and immunogenicity while improving therapeutic outcomes.Definitions

[0067] The term “microRNA (miRNA) Silencing Element” or "MSE" is used herein to refer to a nucleotide sequence within an mRNA that can bind to a specific miRNA and result in a measurable amount of post-transcriptional silencing of such mRNA (determined, e.g., by a decrease in mRNA and / or protein content). For post-transcriptional silencing to occur, MSE-miRNA sequence complementarity in most cases will include the seed sequence of the miRNA, which is typically comprised of nucleotides 1-7 or 2-8 of the miRNA, and additional complementarity7folloyving the seed sequence.

[0068] The term “complementarity ” means that a nucleic acid can form hydrogen bond(s) with another nucleic acid sequence by either traditional Watson-Crick or other non-traditional types of interactions such as Wobble-base pairing which permits binding of guanine and uracil. A percent complementarity7indicates the percentage of residues in a nucleic acid molecule that can form hydrogen bonds with a second nucleic acid sequence.

[0069] In reference to the nucleic acid molecules of the present disclosure, the binding free energy for a nucleic acid molecule with its complementary sequence is sufficient to allow therelevant function of the nucleic acid to proceed, e.g., miRNA activity. Determination of binding free energies for nucleic acid molecules is well known in the art (see, e.g., Turner et al., 1987, CSH Symp. Quant. Biol. LII pp. 123-133; Frier et al., 1986, Proc. Nat. Acad. Sci. USA 83:9373-9377; Turner et al., 1987, J Am. Chem. Soc. 109:3783-3785). “Perfectly complementary” means that all the contiguous residues of a nucleic acid sequence will form hydrogen bond(s) with the same number of contiguous residues in a second nucleic acid sequence. In one embodiment, the human miRNA has partial complementarity (i.e., less than 100% complementarity) with the corresponding target nucleic acid molecule.

[0070] The term “ribosomal frameshift stimulator”, as used herein, refers to a trans-acting proteinous molecule that can promote a ribosomal frameshift in an mRNA transcript.

[0071] The term “ribosomal frameshift element”, as used herein, refers to a cis-acting polynucleotide sequence that can cause a ribosomal frameshift in an mRNA transcript in the presence of a ribosomal frameshift stimulator.

[0072] As used herein, the term “multicellular organism” refers to an individual organism consisting of a plurality of cells (typically, a plurality of cells of different types).Multicellular organisms include animals, plants, fungi, and the like. In some embodiments, animals refer to mammals including humans, veterinary animals (e.g., cats, dogs, cows, horses, sheep, pigs, etc.) and experimental animal models (e.g., mice, rats, monkeys, etc.). In one embodiment, the animal is a human.

[0073] The term “therapeutically effective amount” refers to that quantity of a compound (e.g., polynucleotide, vector) or a pharmaceutical composition comprising such compound that is sufficient to result in a desired activity upon administration to a subject in need thereof. Within the context of the present invention, the term “therapeutically effective” refers to that quantity of a compound or pharmaceutical composition that is sufficient to achieve selective expression of a payload polypeptide in a target cell type or tissue or a cell in a specific state.

[0074] The phrase “pharmaceutically acceptable” refers to molecular entities and compositions that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, when administered to a mammal (e.g.. human). Preferably, as used herein, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.

[0075] The term “carrier” applied to pharmaceutical compositions of the invention refers to a diluent, excipient, or vehicle with which a compound (e.g., a polynucleotide or vector) isadministered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Water or aqueous solution, saline solutions, and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Suitable pharmaceutical carriers are described in “Remington's Pharmaceutical Sciences” by E. W. Martin, 18th Edition.

[0076] The term “about” or “approximately” means within a statistically meaningful range of a value. Such a range can be within an order of magnitude, preferably within 50%, more preferably within 20%, still more preferably within 10%, and even more preferably within 5% of a given value or range. The allowable variation encompassed by the term “about” or “approximately” depends on the particular system under study, and can be readily appreciated by one of ordinary skill in the art.

[0077] In accordance with the present invention there may be employed conventional molecular biology7, microbiology7, and recombinant DNA techniques within the skill of the art. Such techniques are explained fully in the literature. See, e.g., Sambrook. Fritsch & Maniatis. Molecular Cloning: A Laboratory Manual, Second Edition. Cold Spring Harbor. N.Y.: Cold Spring Harbor Laboratory Press, 1989 (herein “Sambrook et al., 1989”); DNA Cloning: A Practical Approach, Volumes I and II (D. N. Glover ed. 1985); Oligonucleotide Synthesis (M. J. Gait ed. 1984); Nucleic Acid Hybridization [B. D. Hames & S. J. Higgins eds. (1985)]; Transcription And Translation [B. D. Hames & S. J. Higgins, eds. (1984)]; Animal Cell Culture [R. I. Freshney, ed. (1986)]; Immobilized Cells And Enzymes [IRL Press, (1986)]; B. Perbal, A Practical Guide To Molecular Cloning (1984); Ausubel, F. M. et al. (eds ). Current Protocols in Molecular Biology. John Wiley & Sons, Inc., 1994. These techniques include site directed mutagenesis as described in Kunkel, Proc. Natl. Acad. Sci. USA 82: 488-492 (1985), U.S. Pat. No. 5,071,743, Fukuoka et al., Biochem. Biophys. Res. Commun. 263: 357-360 (1999); Kim and Maas, BioTech. 28: 196-198 (2000); Parikh and Guengerich, BioTech. 24: 4 28-431 (1998); Ray and Nickoloff, BioTech. 13: 342-346 (1992); Wang et al., BioTech. 19: 556-559 (1995); Wang and Malcolm. BioTech. 26: 680-682 (1999); Xu and Gong, BioTech. 26: 639-641 (1999), U.S. Pat. Nos. 5,789,166 and 5.932,419, Hogrefe, Strategies 14. 3: 74-75 (2001), U.S. Pat. Nos. 5,702,931, 5,780,270, and 6,242,222, Angag and Schutz, Biotech. 30: 486-488 (2001), Wang and Wilkinson, Biotech. 29: 976-978 (2000), Kang et al., Biotech. 20: 44-46 (1996), Ogel and McPherson, Protein Engineer. 5: 467-468 (1992), Kirsch and Joly, Nuc. Acids. Res. 26: 1848-1850 (1998), Rhem and Hancock, J. Bacteriol. 178: 3346-3349 (1996), Boles and Miogsa, Curr. Genet. 28: 197-198(1995), Barrentino et al., Nuc. Acids. Res. 22: 541-542 (1993), Tessier and Thomas, Meths.Molec. Biol. 57: 229-237, and Pons et al., Meth. Molec. Biol. 67: 209-218. microRNA (miRNA)-based circuits

[0078] In one aspect, described herein are miRNA-based polynucleotide circuits which can be programmed to express a polypeptide payload in a target cell type or tissue, a cell in a specific state, or a target species.

[0079] In some embodiments, the present disclosure provides a polynucleotide comprising: a) a nucleotide sequence encoding a ribosomal frameshift stimulator; b) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA, and wherein each of the one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting the MSE sequence; and c) a first ribosomal frameshift element; and d) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first pay load polypeptide, and wherein translation of the first pay load polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator. Optionally, the polynucleotide may further comprise one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting mRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator.

[0080] In one embodiment, the present disclosure provides a system comprising: (i) a first polynucleotide comprising a) a nucleotide sequence encoding a ribosomal frameshift stimulator; b) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA, and wherein each of the one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting the MSE sequence; and (ii) a second polynucleotide comprising c) a first ribosomal frameshift element; and d) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift elementis positioned 5‘ to the nucleotide sequence encoding the first payload polypeptide, and wherein translation of the first pay load polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator. Optionally, the system further comprises (as part of the second polynucleotide or as one or more additional polynucleotides) one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5?to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting mRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator.

[0081] miRNAs are small (19-25 bp), non-coding RNA molecules encoded in the genomes of plants and animals. These highly conserved, short RNAs regulate the expression of genes by binding to specific mRNAs in a sequence-specific manner. Canonically, miRNA targeting is reliant on base pairing of the "seed" region which typically is comprised of nucleotides 1-7 or 2-8 of the miRNA to sites in the mRNA 3’ untranslated region (3' UTR). Bartel. Cell 116(2):281 (2004). miRNA regulation moderately affects global protein production resulting in a “fine tuning” of the cellular transcriptome. Baek et al., Nature 455(7209):64 (2008) and Selbach et al., Nature 455(7209):58 (2008).

[0082] Like mRNAs, miRNA expression profiles appear to vary from tissue to tissue but are similar for identical tissues in different individuals (Baskerville and Bartel, 2005). Determining a miRNA with the desired expression profile may be achieved using techniques known to those skilled in the art. For example, the mirVana™ miRNA Probe Set and mirVana™ miRNA Detection Kit available from Thermo Fisher Scientific, may be used to compare the miRNA expression profiles in human tissues according to the manufacturer's instructions. Another common way of identifying tissue-specific miRNAs is using Northern Blot. An example of such a technique is described in Lagos-Quintana M et al, Current Biol (2002) 12:735-739, which is incorporated herein by reference in its entirety. Methods of identifying new miRNAs and their target sequences using a computation approach are disclosed in W02004 / 066183 and Brennecke J et al, PLoS Biology (2005) 3(3): 0404-0418 (Brennecke et al., 2005), each of which is incorporated herein by reference in its entirety. Once the miRNA has been identified, one can generate an MSE sequence by generating a reverse and complement sequence of the miRNA . In most cases, a MSE sequence shouldhave at least complementarity to the seed region of the miRNA and additional complementarity following the seed sequence.

[0083] Several hundred miRNAs have been cloned and sequenced from mouse, human, Drosphila. C, elegans and Arabidopsis . Examples of such sequences may be found on microRNA databases, e.g., miRBase (mirbase.org).

[0084] In various embodiments, a polynucleotide molecule of the present disclosure comprises one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of the one or more MSE sequences is targeted by a miRNA. In some embodiments, the polynucleotide comprises two MSE sequences. In some embodiments, the polynucleotide comprises three MSE sequences. In some embodiments, the polynucleotide comprises four MSE sequences. In some embodiments, the polynucleotide comprises five MSE sequences. In some embodiments, the polynucleotide comprises six MSE sequences. In some embodiments, the polynucleotide comprises seven MSE sequences. In some embodiments, the polynucleotide comprises eight MSE sequences. In some embodiments, the polynucleotide comprises nine MSE sequences. In some embodiments, the polynucleotide comprises ten or more MSE sequences.

[0085] In some embodiments, when two or more MSE sequences are present, at least two of these MSE sequences are targeted by the same miRNA. In some embodiments, when two or more MSE sequences are present, at least two of these MSE sequences are targeted by different miRNAs.

[0086] In various embodiments, the one or more MSE sequences are targeted by miRNA(s) which are characterized by tissue-specific, cell type-specific, cell state-specific or speciesspecific expression.

[0087] As described herein, a tissue-specific, cell type-specific, cell state-specific or species-specific MSE useful in the RNA-based circuits of the present disclosure can be derived from those MSEs that bind, and are post-transcriptionally inhibited by, miRNAs which are expressed at high levels in a particular tissue or cell type, or at a particular cell state, or in a select species, but are not expressed or expressed at very low levels in other tissue or cell types, or other cell states, or in other species. However, in some cases, MSEs that bind, and are post-transcriptionally inhibited by, miRNAs which are expressed at low levels in a particular tissue or cell type, or at a particular cell state, or in a select species may also be useful, for example, for achieving a desired level of expression of a particular payload polypeptide.

[0088] miRNAs that are “highly expressed’' or “expressed at high levels” can be detected by standard Northern blot analysis (Pall et al., Nature Protocols 3(6) 1077 (2008)). Preferably, such highly expressed miRNAs represent greater than or equal to 0. 1% of the total cellular miRNA found in the tissue or cell of interest as measured by RNA deep sequencing (Hafner et al., Methods 44(1)3 (2008)).

[0089] miRNAs that are “expressed at very low levels” may be undetectable by standard Northern blot analysis. Preferably, such miRNAs expressed at very low levels represent equal to or less than 0.01 % of the total cellular miRNA found in the tissue or cell of interest as measured by RNA deep sequencing.

[0090] In some embodiments, the one or more MSE sequences is targeted by miR-1, miR- 155, miR-124, miR-182. miR-96, miR-183, miR-21, miR-16. miR-17, miR-19. miR-25, miR- 34, miR-92, miR-93, miR-142, miR-222, miR-149, miR-181b-2, or a combination thereof.

[0091] In some embodiments, the one or more MSE sequences is targeted by aae-bantam- 5p, aae-let-7, aae-miR-1, aae-miR-10, aae-miR-100, aae-miR-1000, aae-miR-10365, aae- miR-l l-3p, aae-miR-1 l-5p, aae-miR-1174, aae-miR-1175-3p, aae-miR-1175-5p, aae-miR- 11893, aae-miR-11894a. aae-miR- 11894b, aae-miR-1 1895. aae-miR- 11896, aae-miR- 1 1897a, aae-miR-11897b, aae-miR-11898, aae-miR-11899, aae-miR-11900, aae-miR- 11901, aae-miR-11902, aae-miR-11903a, aae-miR-11903b, aae-miR-11904, aae-miR-11905, aae- miR-11906, aae-miR-11907. aae-miR-11908, aae-miR-11909, aae-miR-11910. aae-miR- 1191 1, aae-miR-1 1912, aae-miR-11913. aae-miR-11914, aae-miR-11915, aae-miR-1 1916. aae-miR-11917, aae-miR-11918, aae-miR-1 1919, aae-miR-11920, aae-miR-11921, aae-miR- 11922, aae-miR-11923, aae-miR- 11924, aae-miR-1 1925, aae-miR- 11926, aae-miR-11927, aae-miR-11928, aae-miR- 12-3p, aae-miR- 12-5p, aae-miR-124, aae-miR-125 -5p, aae-miR- 13-3p, aae-miR-13-5p. aae-miR-133, aae-miR-137, aae-miR-14, aae-miR-184, aae-miR- 1889-3p, aae-miR-1889-5p, aae-miR-1890, aae-miR-1891, aae-miR-190, aae-miR- 193, aae- miR-210, aae-miR-219, aae-miR-252-3p, aae-miR-252-5p, aae-miR-263a-3p, aae-miR-263a- 5p, aae-miR-263b-3p, aae-miR-263b-5p, aae-miR-275-3p, aae-miR-275-5p, aae-miR-276-3p, aae-miR-276-5p, aae-miR-2765, aae-miR-277-3p. aae-miR-277-5p, aae-miR-278-3p, aae- miR-278-5p. aae-miR-279, aae-miR-281-3p, aae-miR-281-5p, aae-miR-282-3p, aae-miR- 282-5p, aae-miR-283, aae-miR-285, aae-miR-286a, aae-miR-286b, aae-miR-2940-3p, aae- miR-2940-5p, aae-miR-2941, aae-miR-2942, aae-miR-2943, aae-miR-2944a-3p, aae-miR- 2944a-5p, aae-miR-2944b-3p, aae-miR-2944b-5p, aae-miR-2945-3p, aae-miR-2945-5p, aae- miR-2946, aae-miR-2a-3p, aae-miR-2a-5p, aae-miR-2b, aae-miR-2c, aae-miR-305-3p. aae- miR-305-5p, aae-miR-306-3p, aae-miR-306-5p, aae-miR-307, aae-miR-308-3p, aae-miR-308-5p, aae-miR-309a. aae-miR-309b-3p, aae-miR-309b-5p, aae-miR-31, aae-miR-315-3p, aae-miR-315-5p. aae-miR-316, aae-miR-317, aae-miR-33, aae-miR-34-3p, aae-miR-34-5p, aae-miR-375, aae-miR-7, aae-miR-71-3p, aae-miR-71-5p, aae-miR-79-3p, aae-miR-79-5p, aae-miR-8-3p, aae-miR-8-5p, aae-miR-87, aae-miR-927, aae-miR-929, aae-miR-92a-3p, aae- miR-92a-5p, aae-miR-92b-3p, aae-miR-92b-5p, aae-miR-932-3p, aae-miR-932-5p, aae-miR- 957, aae-miR-965, aae-miR-970, aae-miR-980-3p, aae-miR-980-5p, aae-miR-981, aae-miR- 988-3p, aae-miR-988-5p, aae-miR-989, aae-miR-993. aae-miR-996, aae-miR-998, aae-miR- 999, aae-miR-9a, aae-miR-9b, aae-miR-9c-3p, aae-miR-9c-5p, aae-miR-iab-4-3p, aae-miR- iab-4-5p, aau-miR160, aau-miR162, aau-miR168, aau-miR172, aau-miR2086, aau-miR319, aau-miR396, abu-let-7a, abu-let-7b, abu-let-7c, abu-let-7d, abu4et-7e, abu-let-7f, abu-let-7g. abu-let-7h, abu-let-7i, abu-miR-1, abu-miR-100, abu-miR-lOla, abu-miR-lOlb, abu-miR- 103, abu-miR-10543, abu-miR-10544, abu-miR-10545-3p, abu-miR-10545-5p, abu-miR- 10546, abu-miR-10547, abu-miR-10548-3p, abu-miR-10548-5p, abu-miR-10549, abu-miR- 10550-3p, abu-miR-10550-5p, abu-miR-10551, abu-miR-10552, abu-miR-10553, abu-miR- 10554, abu-miR-10555, abu-miR-10556a, abu-miR-10556b, abu-miR-10557, abu-miR- 10558, abu-miR-10559, abu-miR-10560, abu-miR-10561, abu-miR-10562. abu-miR-10563. abu-miR-10564, abu-miR-10565, abu-miR-106, abu-miR-107, abu-miR-lOa, abu-miR-lOb, abu-miR-lOc, abu-miR-lOd, abu-miR-122, abu-miR-124, abu-miR-125a, abu-miR-125b, abu-miR-126-3p, abu-miR-126-5p, abu-miR-128, abu-miR-129, abu-miR-130, abu-miR-132- 3p, abu-miR-132-5p. abu-miR-133a, abu-miR-133b, abu-miR-135a-3p. abu-miR-135a-5p. abu-miR-135b, abu-miR-135c-3p, abu-miR-135c-5p, abu-miR-135d, abu-miR-137, abu-miR- 138, abu-miR-1388, abu-miR-139, abu-miR-140, abu-miR-142-3p, abu-miR-142-5p, abu- miR-143, abu-miR-144, abu-miR-145, abu-miR-146, abu-miR-147, abu-miR-148a-3p, abu- miR-148a-5p, abu-miR-148b, abu-miR-150. abu-miR-152, abu-miR-153a, abu-miR-153b, abu-miR-153c, abu-miR-155, abu-miR-15a, abu-miR-15b, abu-miR-15c-3p, abu-miR-15c- 5p, abu-miR-16a, abu-miR-16b, abu-miR-16c, abu-miR-17, abu-miR-1788, abu-miR-181a, abu-miR-181b, abu-miR-181c, abu-miR-182, abu-miR-183, abu-miR-184a, abu-miR-184b, abu-miR-187, abu-miR-18a, abu-miR-18b, abu-miR-190a-3p, abu-miR-190a-5p, abu-miR- 190b, abu-miR-192, abu-miR-193-3p. abu-miR-193-5 p. abu-miR-194a, abu-miR-194b, abu- miR-196a, abu-miR-196b, abu-miR-199-3p, abu-miR-199-5p, abu-miR-19a, abu-miR-19b, abu-miR-19c, abu-miR-19d, abu-miR-200a, abu-miR-200b, abu-miR-202, abu-miR-203, abu-miR-204, abu-miR-205, abu-miR-206, abu-miR-20a, abu-miR-20b, abu-miR-21, abu- miR-210, abu-miR-212-3p, abu-miR-214, abu-miR-216a. abu-miR-216b, abu-miR-2187a, abu-miR-2187b-3p, abu-miR-2187b-5p, abu-miR-2188, abu-miR-218a, abu-miR-218b, abu-miR-219-5p, abu-miR-221, abu-miR-222, abu-miR-22a, abu-miR-22b, abu-miR-22c, abu- miR-23a. abu-miR-23b, abu-miR-23c. abu-miR-24a, abu-miR-24b-3p, abu-miR-24b-5p. abu- miR-24c, abu-miR-25, abu-miR-26a, abu-miR-26b, abu-miR-27a, abu-miR-27b, abu-miR- 27c, abu-miR-27d-3p, abu-miR-27d-5p, abu-miR-27e, abu-miR-29a, abu-miR-29b, abu-miR- 29c-3p, abu-miR-29c-5p, abu-miR-29d, abu-miR-301a, abu-miR-301b, abu-miR-30a-3p, abu-miR-30a-5p. abu-miR-30b, abu-miR-30c. abu-miR-30d, abu-miR-31, abu-miR-3120, abu-miR-33-5p, abu-miR-338. abu-miR-34. abu-miR-365, abu-miR-375. abu-miR-429b. abu- miR-430, abu-miR-449a, abu-miR-449b-3p, abu-miR-449b-5p, abu-miR-451, abu-miR-454b, abu-miR-455, abu-miR-456, abu-miR-457, abu-miR-458, abu-miR-460, abu-miR-462, abu- miR-489, abu-miR-499, abu-miR-551, abu-miR-7, abu-miR-7132a-3p, abu-miR-7132a-5p, abu-miR-7132b-3p, abu-miR-7132b-5p. abu-miR-7133-3p, abu-miR-7133-5p, abu-miR- 7147, abu-miR-722, abu-miR-723a, abu-miR-723b, abu-miR-724, abu-miR-725, abu-miR- 726, abu-miR-727a-5p, abu-miR-727b-3p, abu-miR-728a, abu-miR-728b, abu-miR-729, abu- miR-730, abu-miR-731-3p, abu-miR-731-5p, abu-miR-734, abu-miR-736, abu-miR-737, abu-miR-7552. abu-miR-8160a, abu-miR-8160b, abu-miR-9-3p, abu-miR-9-5p, abu-miR- 92a, abu-miR-92b. abu-miR-93. abu-miR-96, abu-miR-99a. abu-miR-99b, aca-let-7a-2-3p. aca-let-7a-3-3p, aca-let-7a-3p, aca-let-7a-5p, aca-let-7b-3p, aca-let-7b-5p, aca-let-7c-l-3p, aca-let-7c-2-3p, aca-let-7c-3-3p, aca-let-7c-5p, aca-let-7d-3p, aca-let-7d-5p, aca-let-7e-3p, aca-let-7e-5p, aca-let-7f-l-3p, aca-let-7f-2-3p. aca-let-7f-5p, aca-let-7g, aca-let-7i-3p, aca-let- 7i-5p, aca-miR-100, aca-miR-101-l-5p, aca-miR-101-2-5p. aca-miR-101-3p. aca-miR-103- 3p, aca-miR-103-5p, aca-miR-106-3p, aca-miR-106-5p, aca-miR-107-3p, aca-miR-107-5p, aca-miR-10a-3p, aca-miR-10a-5p, aca-miR-10b-3p, aca-miR-10b-5p, aca-miR-10c-3p, aca- miR-10c-5p, aca-miR-122-3p, aca-miR-122-5p, aca-miR-124a, aca-miR-124b, aca-miR- 125a-3p, aca-miR-125a-5p, aca-miR-125b, aca-miR-126-3p, aca-miR-126-5p, aca-miR-128- 3p, aca-miR-128-5p, aca-miR-129a-3p, aca-miR-129a-5p, aca-miR-129b-3p, aca-miR-129b- 5p, aca-miR-1306, aca-miR-130a-l-5p, aca-miR-130a-2-5p, aca-miR-130a-3p, aca-miR- 130b-3p, aca-miR-130b-5p, aca-miR-130c, aca-miR-132-3p, aca-miR-132-5p, aca-miR- 1329-3p, aca-miR-1329-5p, aca-miR-133a, aca-miR-133a-3p, aca-miR-133b-3p, aca-miR- 133b-5p, aca-miR-135-l-3p. aca-miR-135-2-3p, aca-miR-135-3-3p, aca-miR-135-5p, aca- miR-137a, aca-miR-137b-3p, aca-miR-137b-5p, aca-miR-138-l-3p, aca-miR-138-2-3p, aca- miR-138-5p, aca-miR-1388-3p, aca-miR-1388-5p, aca-miR-139-3p, aca-miR-139-5p, aca- miR-1397, aca-miR-140-3p, aca-miR-140-5p, aca-miR-142-3p, aca-miR-142-5p, aca-miR- 143-3p, aca-miR-143-5p, aca-miR-144-3p, aca-miR-144-5p, aca-miR-145-3p, aca-miR-145- 5p, aca-miR-146a-3p, aca-miR-146a-5p, aca-miR-146b-3p, aca-miR-146b-5p, aca-miR-147,aca-miR-148a-3p, aca-miR-148a-5p, aca-miR-148b-3p, aca-miR-148b-5p, aca-miR-150-3p, aca-miR-150-5p. aca-miR-153-3p. aca-miR-153-5p, aca-miR-155-3p, aca-miR-155-5p, aca- miR-15a-3p, aca-miR-15 a-5p, aca-miR-15 b-3p, aca-miR- 15b-5p, aca-miR-164 l-5p, aca- miR-1662-3p, aca-miR-1662-5p, aca-miR-1677a, aca-miR-1677b-3p, aca-miR-1677b-5p, aca-miR-16a-3p, aca-miR- 16a-5p, aca-miR- 16b-3p, aca-miR- 16b-5p, aca-miR- 17-3p, aca- miR-17-5p, aca-miR- 1788-3p, aca-miR-1788-5p, aca-miR- 1805-3p, aca-miR-1805-5p, aca- miR-181a, aca-miR-181b, aca-miR-181c-5p, aca-miR- 182-3p, aca-miR- 182-5p, aca-miR- 184-3p, aca-miR-184-5p, aca-miR-187-3p, aca-miR-187-5p, aca-miR- 18a-3p, aca-miR-18a- 5p, aca-miR-18b-3p, aca-miR-18b-5p, aca-miR- 190a-3p, aca-miR-190a-5p, aca-miR- 190b, aca-miR-191 -3p, aca-miR-19 l-5p, aca-miR-193 -3p, aca-miR- 193-5p, aca-miR-194- l-3p, aca-miR-194-2-3p. aca-miR-194-5 p, aca-miR-196a. aca-miR- 196c-3p, aca-miR- 196c-5p, aca-miR- 199a-5p, aca-miR-199b-5p, aca-miR- 19a-3p, aca-miR- 19a-5p, aca-miR-19b, aca- miR-19c-3p, aca-miR- 1 a- 1 -5 p, aca-miR- la-2-5p, aca-miR-1 a-3p, aca-miR- lb-3p, aca-miR- lb-5p, aca-miR-200a-3p, aca-miR-200a-5p, aca-miR-200b-3p, aca-miR-200b-5p, aca-miR- 202-3p. l, aca-miR-202-5p, aca-miR-202-5p.2, aca-miR-203-3p, aca-miR-203-5p, aca-miR- 204a-3p, aca-miR-204a-5p, aca-miR-205a, aca-miR-205b, aca-miR-206-3p, aca-miR-206-5p, aca-miR-208-3p, aca-miR-208-5p, aca-miR-20a-3p, aca-miR-20a-5p, aca-miR-20b-3p, aca- miR-20b-5p, aca-miR-21-3p, aca-miR-21-5p, aca-miR-210-3p, aca-miR-210-5p, aca-miR- 212-3p, aca-miR-212-5p, aca-miR-214-3p, aca-miR-214-5p, aca-miR-215-3p, aca-miR-215- 5p, aca-miR-216a, aca-miR-216b-3p, aca-miR-216b-5p, aca-miR-217-3p, aca-miR-217-5p, aca-miR-218-3p, aca-miR-218-5p, aca-miR-2188-3p, aca-miR-2188-5p, aca-miR-219-l-3p, aca-miR-219-2-3p, aca-miR-219-5p, aca-miR-22-3p, aca-miR-22-5p, aca-miR-221-3p, aca- miR-221-5p, aca-miR-222a-3p, aca-miR-222a-5p, aca-miR-222b-3p, aca-miR-222b-5p, aca- miR-223-3p, aca-miR-223-5p, aca-miR-23a-3p, aca-miR-23a-5p, aca-miR-23b-3p. aca-miR- 23b-5p, aca-miR-24-l-5p, aca-miR-24-2-5p, aca-miR-24-3p, aca-miR-26-l-3p, aca-miR-26- 2-3p, aca-miR-26-3-5p, aca-miR-26-3p, aca-miR-26-5p, aca-miR-27a-3p, aca-miR-27a-5p, aca-miR-27b-3p, aca-miR-27b-5p, aca-miR-2970-3p, aca-miR-2970-5p, aca-miR-29a-l-5p, aca-miR-29a-2-5p, aca-miR-29a-3p. aca-miR-29b, aca-miR-301a-3p. aca-miR-301a-5p, aca- miR-301b-3p, aca-miR-301b-5p, aca-miR-302a-3p. aca-miR-302b. aca-miR-30a-3p. aca- miR-30a-5p, aca-miR-30b-3p, aca-miR-30b-5p, aca-miR-30c-2-3p, aca-miR-30c-3p, aca- miR-30c-5p, aca-miR-30d-3p, aca-miR-30d-5p, aca-miR-30e-3p, aca-miR-30e-5p, aca-miR- 31-3p, aca-miR-31-5p, aca-miR-32-3p, aca-miR-32-5p, aca-miR-33-l-3p, aca-miR-33-2-3p, aca-miR-33-5p, aca-miR-338-3p, aca-miR-338-5p, aca-miR-34a-3p, aca-miR-34a-5p, aca- miR-34b-3p, aca-miR-34b-5p, aca-miR-34c-3p, aca-miR-34c-5p, aca-miR-363-3p, aca-miR-363-5p, aca-miR-365-3p, aca-miR-365-5p, aca-miR-367, aca-miR-375-3p, aca-miR-375-5p, aca-miR-383-3p. aca-miR-383-5p. aca-miR-425-3p, aca-miR-425-5p, aca-miR-429-3p, aca- miR-429-5p, aca-miR-449a, aca-miR-449b, aca-miR-449c-3p, aca-miR-449c-5p, aca-miR- 451-3p, aca-miR-451-5p, aca-miR-454-3p, aca-miR-454-5p, aca-miR-455-3p, aca-miR-455- 5p, aca-miR-456, aca-miR-457-3p, aca-miR-457-5p, aca-miR-458, aca-miR-460a-3p, aca- miR-460a-5p, aca-miR-460b-3p, aca-miR-460b-5p, aca-miR-489-3p, aca-miR-489-5p. aca- miR-490-3p. aca-miR-490-5p. aca-miR-497-3p. aca-miR-497-5p, aca-miR-499-3p, aca-miR- 499-5p, aca-miR-5390, aca-miR-5391 , aca-miR-5392, aca-miR-5393, aca-miR-5394-3p, aca- miR-5394-5p, aca-miR-5395, aca-miR-5396a, aca-miR-5396b-3p, aca-miR-5396b-5p, aca- miR-5397-3p, aca-miR-5397-5p, aca-miR-5398-3p, aca-miR-5398-5p, aca-miR-5399-3p, aca-miR-5399-5p, aca-miR-5400, aca-miR-5401, aca-miR-5402-3p, aca-miR-5402-5p, aca- miR-5403, aca-miR-5404, aca-miR-5405-3p, aca-miR-5405-5p, aca-miR-5406-3p, aca-miR- 5406-5p, aca-miR-5407-3p, aca-miR-5407-5p, aca-miR-5408a-3p, aca-miR-5408a-5p, aca- miR-5408b, aca-miR-5408c-3p, aca-miR-5408c-5p, aca-miR-5409, aca-miR-5410-3p, aca- miR-5410-5p, aca-miR-5411, aca-miR-5412-3p, aca-miR-5412-5p. aca-miR-5413-3p, aca- miR-5413-5p, aca-miR-5414, aca-miR-5415, aca-miR-5416, aca-miR-5417, aca-miR-5418, aca-miR-5419, aca-miR-5420, aca-miR-5421, aca-miR-5422, aca-miR-5423, aca-miR-5424, aca-miR-5425, aca-miR-5426-3p, aca-miR-5426-5p, aca-miR-5427, aca-miR-5428, aca-miR- 5429. aca-miR-5430, aca-miR-5431, aca-miR-5432, aca-miR-5433, aca-miR-5434, aca-miR- 5435a, aca-miR-5435b-3p. aca-miR-5435b-5p, aca-miR-5435c-3p, aca-miR-5435c-5p. aca- miR-5436-3p, aca-miR-5436-5p, aca-miR-5437, aca-miR-5438, aca-miR-5439, aca-miR- 5440, aca-miR-5441, aca-miR-5442, aca-miR-5443, aca-miR-5444a, aca-miR-5444b, aca- miR-5445, aca-miR-5446, aca-miR-5447, aca-miR-5448, aca-miR-5449, aca-miR-5450, aca- miR-5451, aca-miR-5452-3p, aca-miR-5452-5p, aca-miR-5453, aca-miR-5454, aca-miR- 5455-3p, aca-miR-5455-5p, aca-miR-5456, aca-miR-5457, aca-miR-5458, aca-miR-5459, aca-miR-5460, aca-miR-5461, aca-miR-5462, aca-miR-5463, aca-miR-5464-3p, aca-miR- 5464-5p, aca-miR-5465, aca-miR-5466, aca-miR-5467, aca-miR-5468, aca-miR-5469, aca- miR-5470, aca-miR-551, aca-miR-7-l-3p, aca-miR-7-2-3p, aca-miR-7-5p, aca-miR-726. aca- miR-727-3p. aca-miR-727-5p. aca-miR-737-3p. aca-miR-737-5p, aca-miR-875, aca-miR-9- 1 -3p, aca-miR-9-3-3p, aca-miR-9-5p, aca-miR-92a, aca-miR-9572-3p, aca-miR-9572-5p, aca-miR-9573-3p, aca-miR-9573-5p, aca-miR-9574-3p, aca-miR-9574-5p, aca-miR-9575-3p, aca-miR-9575-5p, aca-miR-9576-3p, aca-miR-9576-5p. aca-miR-9577-3p, aca-miR-9577-5p, aca-miR-98-3p, aca-miR-98-5p, aca-miR-99a-3p, aca-miR-99a-5p, aca-miR-99b-3p, aca- miR-99b-5p, aga-bantam, aga-let-7, aga-miR-1, aga-miR-10, aga-miR-100, aga-miR-1000,aga-miR-10355-3p, aga-miR-10355-5p, aga-miR-10356-3p, aga-miR-10356-5p, aga-miR- 10357-3p, aga-miR-10357-5p. aga-miR-10358-3p, aga-miR-10358-5p, aga-miR-10359-3p, aga-miR- 10359-5p, aga-miR-10360-3p, aga-miR-10360-5p, aga-miR-10361a-3p, aga-miR- 10361a-5p, aga-miR-10361b-3p, aga-miR-10361b-5p, aga-miR-10362-3p, aga-miR- 10362- 5p, aga-miR- 10363 -3 p, aga-miR- 10363-5p, aga-miR-10364-3p, aga-miR-10364-5p, aga- miR-10365-3p, aga-miR- 10365-5p, aga-miR- 10366a-2-5p, aga-miR- 10366a-3p, aga-miR- 10366a-5p. aga-miR- 10366b-3p, aga-miR- 10366b-5p, aga-miR-10367-3p, aga-miR- 10367- 5p, aga-miR-10368-3p, aga-miR-10368-5p, aga-miR- 10369-3p, aga-miR-10369-5p, aga- miR-10370-2-5p, aga-miR-10370-3p, aga-miR- 10370-5p, aga-miR- 1037 l-3p, aga-miR- 10371-5p, aga-miR- 10372a-3p, aga-miR-10372a-5p, aga-miR-10372b-3p, aga-miR- 10372b- 5p, aga-miR- 10373 -3 p, aga-miR-10373-5p, aga-miR-10374-3p, aga-miR-10375a-3p, aga- miR-10375a-5p, aga-miR- 10375b-3p, aga-miR-10375b-5p, aga-miR- 10376-3p, aga-miR- 10376-5p, aga-miR- 10377a-3p, aga-miR-10377a-5p, aga-miR-10377b-3p, aga-miR-10377b- 5p, aga-miR-10378 -3 p, aga-miR-10378-5p, aga-miR- 10379-3p, aga-miR-10379-5p, aga- miR-10380-3p, aga-miR-10380-5p, aga-miR- 1038 l-5p. aga-miR-11, aga-miR-1174, aga- miR-1175. aga-miR-12, aga-miR-124. aga-miR-12413-3p, aga-miR-12414-3p. aga-miR- 12415-3p, aga-miR-12416-3p, aga-miR-12417-5p, aga-miR- 12418 -3 p, aga-miR-12419-5p, aga-miR-125, aga-miR-133, aga-miR-137, aga-miR-13b, aga-miR-14, aga-miR-184, aga- miR-1889, aga-miR-1890, aga-miR-1891, aga-miR-190, aga-miR-2, aga-miR-210, aga-miR- 219, aga-miR-263a, aga-miR-263b, aga-miR-275. aga-miR-276-3p, aga-miR-276-5p, aga- miR-277, aga-miR-278, aga-miR-279, aga-miR-2796-3p, aga-miR-2796-5p, aga-miR-281, aga-miR-282, aga-miR-283, aga-miR-285-3p, aga-miR-285-5p, aga-miR-286, aga-miR- 286b-3p, aga-miR-286b-5p, aga-miR-2944a-3p, aga-miR-2944a-5p, aga-miR-2944b-3p, aga- miR-2944b-5p, aga-miR-2945-3p, aga-miR-2945-5p, aga-miR-2b-3p, aga-miR-2b-5p, aga- miR-2c-3p, aga-miR-2c-5p, aga-miR-305, aga-miR-306, aga-miR-307, aga-miR-308, aga- miR-309, aga-miR-31-3p, aga-miR-31-5p, aga-miR-315, aga-miR-317, aga-miR-33-3p, aga- miR-33-5p, aga-miR-34, aga-miR-375, aga-miR-7, aga-miR-79, aga-miR-8, aga-miR-87, aga-miR-927, aga-miR-929, aga-miR-92a, aga-miR-92b, aga-miR-932-3p, aga-miR-932-5p, aga-miR-957, aga-miR-965-3p, aga-miR-965-5p, aga-miR-970. aga-miR-980-3p, aga-miR- 980-5p, aga-miR-981, aga-miR-988, aga-miR-989, aga-miR-993, aga-miR-996, aga-miR- 998-3p, aga-miR-998-5p, aga-miR-9a, aga-miR-9b, aga-miR-9c, aga-miR-iab-4, age-miR- 100, age-miR-101, age-miR-103, age-miR-106a, age-miR-106b, age-miR-lOa, age-miR- 124a. age-miR-125b, age-miR-127, age-miR-128. age-miR-133a. age-miR-135, age-miR- 15a, age-miR-15b, age-miR-16, age-miR-17-3p, age-miR-17-5p, age-miR-18, age-miR-194,age-miR-196, age-miR-197, age-miR-198, age-miR-19a, age-miR-19b, age-miR-20, age- miR-205, age-miR-21, age-miR-214, age-miR-218, age-miR-22, age-miR-222. age-miR-23a, age-miR-27a, age-miR-28, age-miR-29a, age-miR-29b, age-miR-30b, age-miR-34a, age- miR-506, age-miR-507, age-miR-508, age-miR-509a, age-miR-509b, age-miR-510, age- miR-513a, age-miR-513b, age-miR-513c, age-miR-513d, age-miR-513e, age-miR-514, age- miR-9, age-miR-92, age-miR-93, age-miR-98, ahy-miR156a, ahy-miR156b-3p, ahy- miR156b-5p. ahy-miR156c, ahy-miR159, ahy-miR160-3p, ahy-miR160-5p, ahy-miR167-3p, ahy-miR167-5p, ahy-miR3508, ahy-miR3509-3p, ahy-miR3509-5p, ahy-miR3510 ahy- miR3511-3p, ahy-miR351 l-5p, ahy-miR3512, ahy-miR3513-3p, ahy-miR3513-5p, ahy- miR3514-3p, ahy-miR3514-5p, ahy-miR3515, ahy-miR3516, ahy-miR3517, ahy-miR3518, ahy-miR3519, ahy-miR3520-3p. ahy-miR3520-5p, ahy-miR3521, ahy-miR394, ahy-miR398, ahy-miR408-3p, ahy-miR408-5p, aja-let-7i, aja-miR-142, aja-miR-143, aja-miR-144, aja- miR-145, aja-miR-1893, aja-miR-21, aja-miR-214, aja-miR-22. aja-miR-25, aja-miR-29b, aja-miR-29c, aja-miR-3074, aja-miR-3120, aja-miR-331, aja-miR-3596, aja-miR-3618, aja- miR-671, aja-miR-7. aly-miR156a-3p. aly-miR156a-5p, aly-miR156b-3p, aly-miR156b-5p, aly-miR156c-3p. aly-miR156c-5p. aly-miR156d-3p, aly-miR156d-5p, aly-miR156e-3p, aly- miR156e-5p, aly-miR156f-3p, aly-miR156f-5p, aly-miR156g-3p, aly-miR156g-5p, aly- miR156h-3p, aly-miR156h-5p, aly-miR157a-3p, aly-miR157a-5p, aly-miR157b-3p, aly- miR157b-5p. aly-miR157c-3p. aly-miR157c-5p, aly-miR157d-3p, aly-miR157d-5p, aly- miR158a-3p. aly-miR158a-5p. aly-miR158b-3p, aly-miR158b-5p, aly-miR159a-3p, aly- miR159a-5p, aly-miR159b-3p, aly-miR159b-5p, aly-miR159c-3p, aly-miR159c-5p, aly- miR160a-3p, aly-miR160a-5p, aly-miR160b-3p, aly-miR160b-5p, aly-miR160c-3p, aly- miR160c-5p, aly-miR161-3p. 1, aly-miR161-3p.2, aly-miR161-5p. 1, aly-miR161-5p.2, aly- miR162a-3p. aly-miR162a-5p. aly-miR162b-3p, aly-miR162b-5p, aly-miR163-3p. l, aly- miR163-3p.2, aly-miR163-5p. l, aly-miR163-5p.2, aly-miR164a-3p, aly-miR164a-5p, aly- miR164b-3p, aly-miR164b-5p, aly-miR164c-3p, aly-miR164c-5p, aly-miR165a-3p, aly- miR165a-5p, aly-miR165b-3p, aly-miR165b-5p, aly-miR166a-3p, aly-miR166a-5p, aly- miR166b-3p. aly-miR166b-5p, aly-miR166c-3p, aly-miR166c-5p, aly-miR166d-3p, aly- miR166d-5p. aly-miR166e-3p?aly-miR166e-5p, aly-miR166f-3p, aly-miR166f-5p, aly- miR166g-3p, aly-miR166g-5p, aly-miR166h-3p, aly-miR166h-5p, aly-miR167a-3p, aly- miR167a-5p, aly-miR167b-3p, aly-miR167b-5p, aly-miR167c-3p, aly-miR167c-5p, aly- miR167d-3p, aly-miR167d-5p, aly-miR168a-3p, aly-miR168a-5p, aly-miR168b-3p, aly- miR168b-5p. aly-miR169a-3p?aly-miR169a-5p, aly-miR169b-3p, aly-miR169b-5p, aly- miR169c-3p, aly-miR169c-5p, aly-miR169d-3p, aly-miR169d-5p, aly-miR169e-3p, aly-miR169e-5p, aly-miR169f-3p, aly-miR169f-5p, aly-miR169g-3p, aly-miR169g-5p, aly- miR169h-3p. aly-miR169h-5p, aly-miR169i-3p. aly-miR169i-5p. aly-miR169j-3p, aly- miR169j-5p, aly-miR169k-3p, aly-miR169k-5p, aly-miR1691-3p, aly-miR1691-5p, aly- miR169m-3p, aly-miR169m-5p, aly-miR169n-3p, aly-miR169n-5p, aly-miR170-3p, aly- miR170-5p, aly-miR171a-3p, aly-miR171a-5p, aly-miR171b-3p, aly-miR171b-5p, aly- miR171c-3p, aly-miR171c-5p. aly-miR172a-3p, aly-miR172a-5p, aly-miR172b-3p, aly- miR172b-5p. aly-miR172c-3p?aly-miR172c-5p, aly-miR172d-3p, aly-miR172d-5p, aly- miR172e-3p, aly-miR172e-5p, aly-miR172f-3p, aly-miR172f-5p, aly-miR173a-3p, aly- miR173a-5p, aly-miR173b-3p, aly-miR173b-5p, aly-miR1887, aly-miR2111a-3p, aly- miR2111a-5p, aly-miR21 llb-3p, aly-miR2111b-5p, aly-miR211 lc-3p, aly-miR2111c-5p, aly-miR2112-3p. aly-miR2112-5p, aly-miR319a-3p, aly-miR319a-5p, aly-miR319b-3p, aly- miR319b-5p, aly-miR319c-3p aly-miR319c-5p, aly-miR319d-3p, aly-miR319d-5p, aly- miR3433-3p, aly-miR3433-5p, aly-miR3434-3p, aly-miR3434-5p, aly-miR3435-3p, aly- miR3435-5p, aly-miR3436-3p, aly-miR3436-5p, aly-miR3437-3p, aly-miR3437-5p, aly- miR3438-3p. aly-miR3438-5p, aly-miR3439-3p, aly-miR3439-5p, aly-miR3440-3p, aly- miR3440-5p. aly-miR3441-3p.1, aly-miR3441-3p.2, aly-miR3441-5p.l, aly-miR3441-5p.2, aly-miR3442-3p, aly-miR3442-5p, aly-miR3443-3p, aly-miR3443-5p, aly-miR3444a-3p, aly- miR3444a-5p, aly-miR3444b, aly-miR3445-3p.l, aly-miR3445-3p.2, aly-miR3445-5p.l. aly- miR3445-5p.2, aly-miR3446-3p, aly-miR3446-5p, aly-miR3447-3p, aly-miR3447-5p, aly- miR3448-3p. aly-miR3448-5p, aly-miR3449-3p, aly-miR3449-5p, aly-miR390a-3p, aly- miR390a-5p, aly-miR390b-3p, aly-miR390b-5p, aly-miR391-3p, aly-miR391-5p, aly- miR393a-3p, aly-miR393a-5p, aly-miR393b-3p, aly-miR393b-5p, aly-miR394a-3p, aly- miR394a-5p, aly-miR394b-3p, aly-miR394b-5p, aly-miR395b-3p, aly-miR395b-5p, aly- miR395c-3p. aly-miR395c-5p. aly-miR395d-3p, aly-miR395d-5p, aly-miR395e-3p, aly- miR395e-5p, aly-miR395f-3p, aly-miR395f-5p, aly-miR395g-3p, aly-miR395g-5p, aly- miR395h-3p, aly-miR395h-5p, aly-miR395i, aly-miR396a-3p, aly-miR396a-5p, aly- miR396b-3p, aly-miR396b-5p, aly-miR397a-3p, aly-miR397a-5p, aly-miR397b-3p, aly- miR397b-5p. aly-miR398a-3p. aly-miR398a-5p, aly-miR398b-3p, aly-miR398b-5p, aly- miR398c-3p. aly-miR398c-5p. aly-miR399a-3p, aly-miR399a-5p, aly-miR399b-3p, aly- miR399b-5p, aly-miR399c-3p aly-miR399c-5p, aly-miR399d-3p, aly-miR399d-5p, aly- miR399e-3p, aly-miR399e-5p, aly-miR399f-3p, aly-miR399f-5p, aly-miR399g-3p, aly- miR399g-5p, aly-miR399h-3p, aly-miR399h-5p, aly-miR399i-3p, aly-miR399i-5p, aly- miR400-3p, aly-miR400-5p. aly-miR402-3p, aly-miR402-5p. aly-miR403a-3p. aly-miR403a- 5p, aly-miR403b-3p, aly-miR403b-5p, aly-miR408-3p, aly-miR408-5p, aly-miR4221, aly-miR4222, aly-miR4223, aly-miR4224, aly-miR4225, aly-miR4226. aly-miR4227, aly- miR4228, aly-miR4229, aly-miR4230, aly-miR4231, aly-miR4232 aly-miR4233, aly- miR4234, aly-miR4235, aly-miR4236, aly-miR4237, aly-miR4238, aly-miR4239, aly- miR4240, aly-miR4241, aly-miR4242, aly-miR4243, aly-miR4244. aly-miR4245, aly- miR4246, aly-miR4247, aly-miR4248a, aly-miR4248b, aly-miR4248c, aly-miR4249, aly- miR4250, aly-miR472-3p, aly-miR472-5p, aly-miR771-3p, aly-miR771-5p, aly-miR773b-3p, aly-miR773b-5p. aly-miR774a-3p. 1?aly-miR774a-3p.2, aly-miR774a-5p. 1, aly-miR774a- 5p.2, aly-miR774b-3p, aly-miR774b-5p aly-miR781-3p, aly-miR781 -5p, aly-miR822-3p, aly-miR822-5p, aly-miR823-3p, aly-miR823-5p, aly-miR824-3p, aly-miR824-5p, aly- miR825-3p, aly-miR825-5p, aly-miR827-3p, aly-miR827-5p, aly-miR828-3p, aly-miR828- 5p, aly-miR829-3p, aly-miR829-5p. aly-miR831-3p, aly-miR831-5p. aly-miR833-3p, aly- miR833-5p, aly-miR834-3p, aly-miR834-5p, aly-miR835-3p, aly-miR835-5p, aly-miR837- 3p, aly-miR837-5p, aly-miR838-3p, aly-miR838-5p, aly-miR839-3p, aly-miR839-5p, aly- miR840-3p, aly-miR840-5p, aly-miR841, aly-miR842-3p, aly-miR842-5p, aly-miR844-3p, aly-miR844-5p, aly-miR845a-3p, aly-miR845a-5p, aly-miR845b-3p, aly-miR845b-5p, aly- miR846-3p, aly-miR846-5p. aly-miR847-3p, aly-miR847-5p. aly-miR848-3p, aly-miR848- 5p, aly-miR851-3p, aly-miR851-5p, aly-miR852-3p, aly-miR852-5p, aly-miR853-3p, aly- miR853-5p, aly-miR856-3p, aly-miR856-5p, aly-miR857-3p, aly-miR857-5p, aly-miR858- 3p, aly-miR858-5p, aly-miR859-3p, aly-miR859-5p, aly-miR860-3p, aly-miR860-5p, aly- miR861-3p, aly-miR861-5p. aly-miR862-3p, aly-miR862-5p. aly-miR868-3p, aly-miR868- 5p, aly-miR869-3p, aly-miR869-5p, ama-miR156, ama-miR396-3p, ama-miR396-5p, ame- bantam-3p, ame-let-7-5p, ame-miR-l-3p, ame-miR-10-5p, ame-miR-100-5p, ame-miR-1000- 5p, ame-miR-1006-3p, ame-miR-1 l-3p, ame-miR-1175-3p, ame-miR-12-5p, ame-miR-124- 3p, ame-miR-125-5p, ame-miR-133-3p, ame-miR-137-3p, ame-miR-13a-3p, ame-miR-13b- 3p, ame-miR-14-3p, ame-miR-184-3p, ame-miR-190-5p, ame-miR-193-3p, ame-miR-2-3p, ame-miR-210-3p, ame-miR-219-5p, ame-miR-252a-5p, ame-miR-252b-5p, ame-miR-263a- 5p, ame-miR-263b-5p, ame-miR-275-3p, ame-miR-276-3p, ame-miR-2765-3p, ame-miR- 2765-5p, ame-miR-277-3p, ame-miR-278-3p, ame-miR-2788-3p. ame-miR-2796-3p, ame- miR-279a-3p, ame-miR-279b-3p, ame-miR-279c-3p, ame-miR-279d-3p, ame-miR-281-3p, ame-miR-282-5p, ame-miR-283-5p, ame-miR-2944-3p, ame-miR-29b-3p, ame-miR-2b-5p, ame-miR-3049-3p, ame-miR-3049-5p, ame-miR-305-5p, ame-miR-306-5p, ame-miR-307- 3p, ame-miR-315-5p, ame-miR-316-5p, ame-miR-317-3p, ame-miR-318-3p, ame-miR-31a- 5p, ame-miR-33-5p, ame-miR-34-5p, ame-miR-3477-5p, ame-miR-3478-3p, ame-miR-3715- 5p, ame-miR-3716a-3p, ame-miR-3716b-3p, ame-miR-3717-5p, ame-miR-3718a-3p, ame-miR-3718b-5p. ame-miR-3718c-5p, ame-miR-3719-3p, ame-miR-3720-5p, ame-miR-3721- 3p, ame-miR-3722-5p. ame-miR-3723-5p, ame-miR-3724-3p, ame-miR-3725-3p, ame-miR- 3726-5p, ame-miR-3727-3p, ame-miR-3728-5p, ame-miR-3729-3p, ame-miR-3730-5p, ame- miR-3731-5p, ame-miR-3732-3p, ame-miR-3733-5p, ame-miR-3734-3p, ame-miR-3735-5p, ame-miR-3736-5p, ame-miR-3737-5p, ame-miR-3738-5p, ame-miR-3739-3p, ame-miR- 3740-5p, ame-miR-3741-3p, ame-miR-3742-5p, ame-miR-3743-3p, ame-miR-3744-5p, ame- miR-3745-3p, ame-miR-3746-3p, ame-miR-3747a-5p, ame-miR-3747b-5p, ame-miR-3748- 3p, ame-miR-3749-3p, ame-miR-375-3p, ame-miR-3750-5p, ame-miR-3751 -3p, ame-miR- 3752-3p, ame-miR-3753-5p, ame-miR-3754-5p, ame-miR-3755-5p, ame-miR-3756-5p, ame- miR-3757-3p, ame-miR-3758-5p, ame-miR-3759-3p, ame-miR-3760-5p, ame-miR-3761-5p, ame-miR-3762-5p. ame-miR-3763-5p, ame-miR-3764-3p, ame-miR-3765-5p, ame-miR- 3766-3p, ame-miR-3767-3p, ame-miR-3768-3p, ame-miR-3769-3p, ame-miR-3770-5p, ame- miR-3771-3p, ame-miR-3772-3p, ame-miR-3773-3p, ame-miR-3774-3p, ame-miR-3775-5p, ame-miR-3776-5p, ame-miR-3777-3p, ame-miR-3778-3p, ame-miR-3779-5p, ame-miR- 3780-5p, ame-miR-3781-3p. ame-miR-3782-5p, ame-miR-3783-3p, ame-miR-3784-3p, ame- miR-3785-3p, ame-miR-3786-3p, ame-miR-3786-5p. ame-miR-3787-5p. ame-miR-3788-5p, ame-miR-3789-3p, ame-miR-3790-5p, ame-miR-3791-3p, ame-miR-3792-5p, ame-miR- 3793-5p, ame-miR-3794-5p, ame-miR-3795-5p, ame-miR-3796-3p, ame-miR-3797-5p, ame- miR-3798-3p, ame-miR-3799-5p, ame-miR-3800-3p, ame-miR-3801-5p, ame-miR-6000a- 3p, ame-miR-6000a-5p, ame-miR-6000b-3p, ame-miR-6001-3p, ame-miR-6001-5p, ame- miR-6002-3p, ame-miR-6002-5p, ame-miR-6003-3p, ame-miR-6003-5p, ame-miR-6004-3p, ame-miR-6004-5p, ame-miR-6005-3p, ame-miR-6005-5p, ame-miR-6006-3p, ame-miR- 6006-5p, ame-miR-6012-3p, ame-miR-6037-3p, ame-miR-6038-5p, ame-miR-6039-5p, ame- miR-6040-3p, ame-miR-6041-3p, ame-miR-6042-3p, ame-miR-6043-3p. ame-miR-6044-5p, ame-miR-6045-5p, ame-miR-6046-3p, ame-miR-6047a-3p, ame-miR-6047a-5p, ame-miR- 6047b-3p, ame-miR-6048-3p, ame-miR-6049-5p, ame-miR-6050-5p, ame-miR-6051-3p, ame-miR-6052-5p, ame-miR-6053-5p, ame-miR-6054-3p, ame-miR-6055-5p, ame-miR- 6056-5p, ame-miR-6057-5p, ame-miR-6058-5p, ame-miR-6059-3p, ame-miR-6060-5p, ame- miR-6061-3p, ame-miR-6062-3p, ame-miR-6063-3p, ame-miR-6064-5p. ame-miR-6065-3p, ame-miR-6066-5p, ame-miR-6067-5p, ame-miR-7-5p, ame-miR-71-5p, ame-miR-750-3p, ame-miR-79-3p, ame-miR-8-3p, ame-miR-87-3p, ame-miR-927a-5p, ame-miR-927b-5p, ame-miR-928-5p, ame-miR-929-5p, ame-miR-92a-3p, ame-miR-92b-3p, ame-miR-92c-3p, ame-miR-92c-5p, ame-miR-932-5p, ame-miR-965-3p, ame-miR-965-5p, ame-miR-971-3p, ame-miR-980-3p, ame-miR-981-3p, ame-miR-985-3p, ame-miR-9864-5p, ame-miR-9865-5p, ame-miR-9866-5p, ame-miR-9867-5p, ame-miR-9868-3p, ame-miR-9869-5p, ame-miR- 9870-5p, ame-miR-9871-3p. ame-miR-9872-5p, ame-miR-9873-3p, ame-miR-9874-5p, ame- miR-9875-3p, ame-miR-9876-3p, ame-miR-9877-3p, ame-miR-9878-3p, ame-miR-9879-3p, ame-miR-9880-3p, ame-miR-9881-5p, ame-miR-9882-5p, ame-miR-9883-5p, ame-miR- 9884-3p, ame-miR-9885-5p, ame-miR-9886-3p, ame-miR-9887-5p, ame-miR-9888-5p, ame- miR-9889-3p, ame-miR-989-3p, ame-miR-9890-5p, ame-miR-9891-3p, ame-miR-9892-3p, ame-miR-9893-5p. ame-miR-9894-3p, ame-miR-9895-3p, ame-miR-9896-5p, ame-miR-993- 3p, ame-miR-996-3p, ame-miR-9a-5p, ame-miR-9b-5p, ame-miR-9c-3p, ame-miR-iab-4-5p, amg-miR2086, amg-miR319, amg-miR396, ami-let-7a-2-3p, ami-1 et-7a-3p, ami-let-7a-4-3p, ami-let-7a-5p, ami-let-7b-3p, ami-let-7b-5p, ami-let-7c-2-3p, ami-let-7c-3p, ami-let-7c-5p, ami-let-7d-3p, ami-let-7d-5p, ami-let-7e-3p. ami-let-7e-5p, ami-let-7f-3p, ami-let-7f-5p, ami- let-7g-3p, ami-let-7g-5p, ami-let-7i-3p, ami-let-7i-5p, ami-miR-100-3p, ami-miR-100-5p, ami-miR-101-2-5p, ami-miR-101-3p, ami-miR-101-5p, ami-miR-103-3p, ami-miR-106-5p, ami-miR-107-3p, ami-miR-107-5p, ami-miR-10a-3p, ami-miR-10a-5p, ami -miR-10b-3 p, ami-miR-10b-5p, ami-miR-10c-3p, ami-miR-10c-5p, ami-miR-122-3p, ami-miR-122-5p, ami-miR-124-3p, ami-miR-124-5p, ami-miR-125a-5p, ami-miR-125b-2-3p, ami-miR-125b- 3p, ami-miR-125b-5p, ami-miR-126-3p, ami-miR-126-5p, ami-miR-128-2-5p, ami-miR-128- 3p, ami-miR-128-5p. ami-miR-129a-3p, ami-miR-129a-5p, ami-miR-129b-3p, ami-miR- 129b-5p, ami-miR-1306-3p, ami-miR-1306-5p, ami-miR-130a-3p, ami-miR-130b-3p, ami- miR-130b-5p, ami-miR-130c-3p, ami-miR-132-3p, ami-miR-132-5p. ami-miR-1329-5p. ami- miR-133a-3p, ami-miR-133a-5p, ami-miR-133b-3p, ami-miR-135-2-3p, ami-miR-135-3-3p, ami-miR-135-3p, ami-miR-135-5p, ami-miR-137a-3p, ami-miR-137b-3p, ami-miR-138-2- 3p, ami-miR-138-3p. ami-miR-138-5p, ami-miR-1388-3p, ami-miR-1388-5p, ami-miR-139- 3p, ami-miR-139-5p?ami-miR-1397-3p. ami-miR-1397-5p. ami-miR-140-3p, ami-miR-140- 5p, ami-miR-1416-5p, ami-miR-142-2-5p, ami-miR-142-3p, ami-miR-142-5p, ami-miR-143- 3p, ami-miR-143-5p. ami-miR-144-3p, ami-miR-144-5p, ami-miR-145-3p, ami-miR-145-5p, ami-miR-146a-5p, ami-miR-146b-3p, ami-miR-146b-5p, ami-miR-146c-3p, ami-miR-146c- 5p, ami -miR-147-3 p. ami-miR-147-5p, ami-miR-148b-3p, ami-miR-148b-5p, ami-miR-150- 3p, ami-miR-150-5p ami-miR-152-3p, ami-miR-152-5p, ami-miR-153-3p. ami-miR-155-5p, ami-miR-15a-3p ami-miR-15a-5p, ami-miR-15b-3p, ami-miR-15b-5p, ami-miR-15c-3p, ami-miR-15c-5p. ami-miR-1641-5p, ami-miR-1662-5p, ami -miR-1677a-3p, ami -miR-1677b- 3p, ami-miR-1677b-5p, ami-miR-1677c-3p, ami-miR-1677c-5p, ami-miR-16a-2-3p, ami- miR-16a-3p, ami-miR-16a-5p. ami-miR-16b-3p, ami-miR-16b-5p, ami-miR-17-3p, ami-miR- 17-5p, ami-miR-1720-3p, ami-miR-1788-3p, ami-miR-1788-5p, ami-miR-1791-3p, ami-miR-1791-5p, ami-miR-18-3p, ami-miR-18-5p, ami-miR-1805-3p. ami-miR-1805-5p, ami-miR- 181a-2-3p, ami-miR-181a-3-3p, ami-miR-181a-3p, ami-miR-181a-5p, ami-miR-181b-2-3p, ami-miR-181b-3-3p, ami-miR-181b-3p, ami-miR-181b-5p, ami-miR-182-3p, ami-miR-182- 5p, ami-miR-183-3p. ami-miR-183-5p, ami-miR-184-3p, ami-miR-184-5p, ami-miR-187-3p, ami-miR-187-5p, ami-miR-190a-3p, ami-miR-190a-5p, ami-miR-190b-5p, ami-miR-191-5p, ami-miR-192-3p, ami-miR-192-5p, ami-miR-193a-3p, ami-miR-193a-5p, ami-miR-193b-3p, ami-miR-193b-5p. ami-miR-194-2-3p, ami-miR-194-3p, ami-miR-194-5p. ami-miR-196-5p, ami-miR-199-3p, ami-miR-199-5p, ami-miR-19a-5p, ami-miR-19b-3p, ami-miR-19b-5p, ami-miR-la-2-5p, ami-miR-la-3p, ami-miR-la-5p, ami-miR-lb-3p, ami-miR-lb-5p, ami- miR-200a-3p, ami-miR-200a-5p, ami-miR-200b-3p, ami-miR-200b-5p, ami-miR-202-5p, ami-miR-203-3p, ami-miR-203-5p, ami-miR-204-2-3p. ami-miR-204-3p, ami-miR-204-5p, ami-miR-205a-3p, ami-miR-205a-5p, ami-miR-205b-5p, ami-miR-206-3p, ami-miR-206-5p, ami-miR-208-3p, ami-miR-20a-3p, ami-miR-20a-5p, ami-miR-21-3p, ami-miR-21-5p, ami- miR-210-3p, ami-miR-210-5p, ami-miR-212-3p, ami-miR-212-5p, ami-miR-214-3p, ami- miR-214-5p, ami-miR-215-3p, ami-miR-215-5p, ami-miR-216a-5p, ami-miR-216b-3p, ami- miR-216b-5p, ami-miR-217-3p. ami-miR-217-5p. ami-miR-218-5p, ami-miR-2184-3p, ami- miR-2184-5p, ami-miR-2188-3p, ami-miR-2188-5p, ami-miR-219a-3p, ami-miR-219a-5p, ami-miR-219b-3p, ami-miR-219b-5p, ami-miR-221-3p, ami-miR-221-5p, ami-miR-222a-3p, ami-miR-222a-5p, ami-miR-222b-3p, ami-miR-222b-5p, ami-miR-223-3p, ami-miR-223-5p, ami-miR-23a-3p?ami-miR-23b-3p, ami-miR-23b-5p, ami-miR-24-2-5p, ami-miR-24-3p?ami-miR-24-5p, ami-miR-26-2-3p, ami-miR-26-3p, ami-miR-26-5p, ami-miR-27a-3p, ami- miR-27a-5p, ami-miR-27b-3p, ami-miR-27b-5p, ami-miR-2970-3p, ami-miR-2970-5p, ami- miR-2984-3p, ami-miR-29a-2-5p, ami-miR-29a-3p, ami-miR-29a-5p, ami-miR-29b-2-5p, ami-miR-29b-3p, ami-miR-29b-5p, ami-miR-301a-3p, ami-miR-301a-5p, ami-miR-301b-3p, ami-miR-301b-5p, ami-miR-302a-3p, ami-miR-302b-3p, ami-miR-302c-3p, ami-miR-302d- 3p, ami-miR-3064-3p, ami-miR-30a-3p, ami-miR-30a-5p, ami-miR-30b-3p, ami-miR-30b- 5p, ami-miR-30c-2-3p, ami-miR-30c-3p, ami-miR-30c-5p, ami-miR-30d-3p, ami-miR-30d- 5p, ami-miR-30e-3p. ami-miR-30e-5p, ami-miR-31-3p, ami-miR-31-5p, ami-miR-32-3p, ami-miR-32-5p, ami-miR-33-2-3p, ami-miR-33-3p. ami-miR-33-5p, ami-miR-338-2-5p. ami- miR-338-3p, ami-miR-338-5p, ami-miR-34a-3p, ami-miR-34a-5p, ami-miR-34b-3p, ami- miR-34b-5p, ami-miR-34c-3p, ami-miR-34c-5p, ami-miR-3618-3p, ami-miR-365-2-5p, ami- miR-365-3p, ami-miR-365-5p, ami-miR-367-3p, ami-miR-375-3p, ami-miR-383-5p, ami- miR-425-3p, ami-miR-425-5p, ami-miR-429-3p, ami-miR-429-5p, ami-miR-449a-5p, ami- miR-449b-5p, ami-miR-449c-5p, ami-miR-449d-5p, ami-miR-454-3p, ami-miR-454-5p, ami-miR-455-3p, ami-miR-455-5p, ami-miR-456-3p, ami-miR-458-3p, ami-miR-459-5p, ami- miR-460a-5p, ami-miR-460b-3p, ami-miR-460b-5p, ami-miR-489-3p, ami-miR-489-5p. ami- miR-490-3p, ami-miR-490-5p, ami-miR-497-3p, ami-miR-497-5p, ami-miR-499-3p, ami- miR-499-5p, ami-miR-551-3p, ami-miR-551-5p, ami-miR-599-3p, ami-miR-599-5p, ami- miR-737-5p, ami-miR-7a-2-3p, ami-miR-7a-3p, ami-miR-7a-5p, ami-miR-7b-5p, ami-miR- 875-5p, ami-miR-9-3p, ami-miR-9-4-3p, ami-miR-9-5p, ami-miR-92a-3p, ami-miR-92a-5p, ami-miR-92b-3p, ami-miR-93-3p. ami-miR-93-5p, ami-miR-9598-3p, ami-miR-9598-5p, ami-miR-9599-3p, ami-miR-9599-5p, ami-miR-96-3p, ami-miR-96-5p, ami-miR-9600-3p, ami-miR-9600-5p, ami-miR-9601-3p, ami-miR-9601-5p, ami-miR-9602-3p, ami-miR-9602- 5p, ami-miR-9603-3p, ami-miR-9603-5p, ami-miR-9604-3p, ami-miR-9604-5p, ami-miR- 9605-3p, ami-miR-9605-5p, ami-miR-9606-3p, ami-miR-9606-5p, ami-miR-9607-3p, ami- miR-9607-5p, ami-miR-9608-3p, ami-miR-9608-5p, ami-miR-9609-3p, ami-miR-9609-5p, ami-miR-9610-3p, ami-miR-9610-5p, ami-miR-961 l-3p, ami-miR-961 l-5p, ami-miR-9612- 3p, ami-miR-9612-5p, ami-miR-9613-3p, ami-miR-9613-5p, ami-miR-98-3p, ami-miR-98- 5p, ami-miR-99a-3p. ami-miR-99a-5p, ami-miR-99b-3p, ami-miR-99b-5p, aof-miR12137. aof-miR12138. aof-miR12139, aof-miR12140, aof-miR12141, aof-miR12142, aof- miR12143, aof-miR12144, aof-miR12145, aof-miR12146, aof-miR12147, aof-miR12148, aof-miR12149, aof-miR12150, aof-miR12151, aof-miR12152, aof-miR12153, aof- miR12154, aof-miR12155, aof-miR12156, aof-miR12157, aof-miR12158, aof-miR12159, aof-miR12160. aof-miR12161, aof-miR12162, aof-miR12163, aof-miR12164, aof- miR12165, aof-miR12166, aof-miR12167, aof-miR12168, aof-miR12169, aof-miR12170, aof-miR12171, aof-miR12172, aof-miR12173, aof-miR12174, aof-miR12175, aof- miR12176, aof-miR12177, aof-miR156a, aof-miR156b. aof-miR156c, aof-miR159, aof- miRl 60a, aof-miRl 60b, aof-miR160c, aof-miR164. aof-miR166a, aof-miR166b. aof- miR166c, aof-miR166d, aof-miR167a, aof-miR167b, aof-miR167c, aof-miR168a, aof- miRl 68b, aof-miR169a, aof-miRl 69b, aof-miR169c, aof-miR171a, aof-miR171b, aof- miR171c, aof-miR172, aof-miR2118a, aof-miR2118b, aof-miR2118c, aof-miR2275a, aof- miR2275b, aof-miR2275c. aof-miR2275d, aof-miR319a, aof-miR319b, aof-miR390. aof- miR391, aof-miR393a, aof-miR393b, aof-miR394, aof-miR395a. aof-miR395b, aof- miR396a, aof-miR396b, aof-miR398, aof-miR399a, aof-miR399b, aof-miR399c, aof- miR408, aof-miR477a, aof-miR477b, aof-miR479, aof-miR482a, aof-miR482b, aof- miR482c, aof-miR5139a, aof-miR5139b, aof-miR535, aof-miR536, aof-miR8155, aof- miR827, aof-miR828, api-bantam. api-let-7. api-miR-1. api-miR-10, api-miR-100, api-miR- 1000, api-miR-124, api-miR-137, api-miR-13a, api-miR-14, api-miR-184a, api-miR-184b,api-miR-190. api-miR-1923, api-miR-210, api-miR-219, api-miR-252a, api-miR-252b, api- miR-263a, api-miR-263b, api-miR-275, api-miR-276. api-miR-2765, api-miR-277, api-miR- 278, api-miR-2796, api-miR-279a, api-miR-279b, api-miR-281, api-miR-29, api-miR-2a, api- miR-2b, api-miR-2c, api-miR-3015a, api-miR-3015b, api-miR-3015c, api-miR-3016, api- miR-3017a, api-miR-3017b, api-miR-3018, api-miR-3019, api-miR-3020, api-miR-3021, api- miR-3022, api-miR-3023, api-miR-3024, api-miR-3025, api-miR-3026, api-miR-3027, api- miR-3028, api-miR-3029, api-miR-3030, api-miR-3031, api-miR-3032, api-miR-3033, api- miR-3034, api-miR-3035, api-miR-3036, api-miR-3037, api-miR-3038, api-miR-3039, api- miR-3040, api-miR-3041, api-miR-3042, api-miR-3043, api-miR-3044, api-miR-3045a, api- miR-3045b, api-miR-3046, api-miR-3047, api-miR-3048, api-miR-3049, api-miR-3050, api- miR-3051, api-miR-3052, api-miR-3053, api-miR-3054, api-miR-3055, api-miR-3056, api- miR-306, api-miR-307, api-miR-315, api-miR-316, api-miR-317, api-miR-34, api-miR-7, api-miR-71, api-miR-8, api-miR-87a, api-miR-87b, api-miR-927, api-miR-929, api-miR-92a, api-miR-92b, api-miR-965, api-miR-971, api-miR-981, api-miR-993, api-miR-996, api-miR- 998, api-miR-9a. api-miR-9b, api-miR-iab-4, apl-miR-11588-3p, apl-miR-11588-5p. apl- miR-11589-3p. apl-miR-11589-5p, apl-miR-1 1590-3p, apl-miR-11590-5p. apl-miR- 11591- 3p, apl-miR-11591-5p, aqc-miR156a, aqc-miR156b, aqc-miR159, aqc-miR160a, aqc- miR160b, aqc-miR166a, aqc-miR166b, aqc-miR166c, aqc-miR166d, aqc-miR166e, aqc- miR167, aqc-miR168, aqc-miR169a, aqc-miR169b, aqc-miR169c, aqc-miR171a, aqc- miR171b, aqc-miR171c. aqc-miR171d, aqc-miR171e, aqc-miR171f, aqc-miR172a, aqc- miR172b, aqc-miR319, aqc-miR395a, aqc-miR395b, aqc-miR396a, aqc-miR396b, aqc- miR398a, aqc-miR398b, aqc-miR399, aqc-miR408, aqc-miR477a, aqc-miR477b, aqc- miR477c, aqc-miR477d, aqc-miR477e, aqc-miR477f, aqc-miR477g, aqc-miR482a, aqc- miR482b, aqc-miR482c, aqc-miR529, aqc-miR530, aqc-miR535. aqu-miR-2014-3p, aqu- miR-2014-5p, aqu-miR-2015-3p, aqu-miR-2015-5p, aqu-miR-2016-3p, aqu-miR-2016-5p, aqu-miR-2017-3p, aqu-miR-2017-5p, aqu-miR-2018-3p, aqu-miR-2018-5p, aqu-miR-2019- 3p, aqu-miR-2019-5p, aqu-miR-2020-3p, aqu-miR-2020-5p, aqu-miR-2021-3p, aqu-miR- 2021-5p, asu-let-7-3p, asu-let-7-5p, asu-lin-4-3p, asu-lin-4-5p, asu-miR-l-3p, asu-miR-l-5p. asu-miR-100a-l-3p, asu-miR-100a-2-3p, asu-miR-100a-5p. asu-miR-100b-3p, asu-miR- 100b-5p, asu-miR-100c-3p, asu-miR-100c-5p, asu-miR-100d-3p, asu-miR-100d-5p, asu- miR-100e-3p, asu-miR-100e-5p, asu-miR-1175-3p, asu-miR-1175-5p, asu-miR-124-3p, asu- miR-124-5p, asu-miR-133 -3p, asu-miR-133-5p, asu-miR-1822-3p, asu-miR-1822-5p, asu- miR-184-3p, asu-miR-184-5p, asu-miR-228-3p. asu-miR-228-5p, asu-miR-234-3p, asu-miR- 234-5p, asu-miR-236-3p, asu-miR-236-5p, asu-miR-239-3p, asu-miR-239-5p, asu-miR-250-3p, asu-miR-250-5p, asu-miR-252-3p, asu-miR-252-5p. asu-miR-279a-3p, asu-miR-279a-5p, asu-miR-279b-3p, asu-miR-279b-5p, asu-miR-279c-3p. asu-miR-279c-5p, asu-miR-283-3p, asu-rmR-283-5p, asu-miR-2a-3p, asu-miR-2a-5p, asu-miR-2b-3p, asu-miR-2b-5p, asu-miR- 34-3p, asu-miR-34-5p, asu-miR-36a-3p, asu-miR-36a-5p, asu-miR-36b-3p, asu-miR-36b-5p, asu-miR-36c-3p, asu-miR-36c-5p, asu-miR-36d-3p, asu-miR-36d-5p, asu-miR-36e-3p, asu- miR-36e-5p, asu-miR-36f-3p, asu-miR-36f-5p, asu-miR-375-3p, asu-miR-375-5p, asu-miR- 43a-3p. asu-miR-43a-5p?asu-miR-43b-3p, asu-miR-43b-5p, asu-miR-43c-l-5p, asu-miR- 43c-2-5p, asu-miR-43c-3p, asu-miR-43d-3p, asu-miR-43d-5p, asu-miR-43e-3p, asu-miR- 43e-5p, asu-miR-44a-3p, asu-miR-44a-5p, asu-miR-44b-3p, asu-miR-44b-5p, asu-miR-46- 3p, asu-miR-46-5p, asu-miR-49-3p, asu-miR-49-5p, asu-miR-50-3p, asu-miR-50-5p. asu- miR-5342-3p, asu-miR-5342-5p, asu-miR-5345a-3p, asu-miR-5345a-5p, asu-miR-5345b, asu-miR-5346-3p, asu-miR-5346-5p, asu-miR-5347-3p, asu-miR-5347-5p, asu-miR-5348-3p, asu-miR-5348-5p, asu-miR-5349-3p, asu-miR-5349-5p, asu-miR-5350a-3p, asu-miR-5350a- 5p, asu-miR-5350b-3p, asu-miR-5350b-5p, asu-miR-5350c-3p, asu-miR-5350c-5p, asu-miR- 5350d-3p, asu-miR-5350d-5p, asu-miR-5351-3p, asu-miR-5351-5p, asu-miR-5352-3p. asu- miR-5352-5p, asu-miR-5353-3p, asu-miR-5353-5p. asu-miR-5354-3p, asu-miR-5354-5p, asu-miR-5355-3p, asu-miR-5355-5p, asu-miR-5356a-3p, asu-miR-5356a-5p, asu-miR- 5356b-3p, asu-miR-5356b-5p, asu-miR-5357-3p, asu-miR-5357-5p, asu-miR-5358a-3p, asu- miR-5358a-5p. asu-miR-5358b-3p, asu-miR-5358b-5p, asu-miR-5359-3p, asu-miR-5359-5p, asu-miR-5360-3p, asu-miR-5360-5p, asu-miR-5361-3p. asu-miR-5361-5p, asu-miR-5362-3p, asu-miR-5362-5p, asu-miR-5363-3p, asu-miR-5363-5p, asu-miR-5364-3p, asu-miR-5364-5p, asu-miR-5365a-3p, asu-miR-5365a-5p, asu-miR-5365b-3p, asu-miR-5365b-5p, asu-miR- 5366-3p, asu-miR-5366-5p, asu-miR-5367-3p, asu-miR-5367-5p, asu-miR-56, asu-miR-57- 3p, asu-miR-57-5p, asu-miR-67-3p, asu-miR-67-5p, asu-miR-7-3p. asu-miR-7-5p, asu-miR- 71-3p, asu-miR-71-5p, asu-miR-72-3p, asu-miR-72-5p, asu-miR-750-3p, asu-miR-750-5p, asu-miR-76-3p, asu-miR-76-5p, asu-miR-79-3p, asu-miR-79-5p, asu-miR-791-3p, asu-miR- 791-5p, asu-miR-81a, asu-miR-81b-3p, asu-miR-81b-5p, asu-miR-81c-3p, asu-miR-81c-5p, asu-miR-83-3p, asu-miR-83-5p, asu-miR-84-3p, asu-miR-84-5p, asu-miR-86-3p?asu-miR- 86-5p, asu-miR-87a-3p, asu-miR-87a-5p, asu-miR-87b-3p, asu-miR-87b-5p, asu-miR-9-3p, asu-miR-9-5p, asu-miR-92-3p, asu-miR-92-5p, asu-miR-993-3p, asu-miR-993-5p, ata- miR1432-3p, ata-miR1432-5p, ata-miR156a-3p, ata-miR156a-5p, ata-miR156b-3p, ata- miR156b-5p, ata-miR156c-3p, ata-miR156c-5p, ata-miR156d-3p, ata-miR156d-5p, ata- miR156e-3p. ata-miR156e-5p. ata-miR160a-3p. ata-miR160a-5p. ata-miR160b-3p, ata- miR160b-5p, ata-miRl 60c-3p, ata-miR160c-5p, ata-miR164a-3p, ata-miR164a-5p, ata-miR164b-3p, ata-miRl 64b-5p, ata-miR164c-3p, ata-miR164c-5p, ata-miR166a-3p, ata- miR166a-5p. ata-miRl 66b-3p. ata-miRl 66b-5p, ata-miRl 66c-3p, ata-miRl 66c-5p, ata- miRl 66d-3p, ata-miRl 66d-5p, ata-miRl 66e-3p, ata-miRl 66e-5p, ata-miR167a-3p, ata- miR167a-5p, ata-miRl 67b-3p, ata-miRl 67b-5p, ata-miR167c-3p, ata-miR167c-5p, ata- miR167d-3p, ata-miRl 67d-5p, ata-miRl 67e-3p, ata-miR167e-5p, ata-miRl 67f-3p, ata- miR167f-5p, ata-miRl 68-3p, ata-miR168-5p, ata-miRl 69a-3p, ata-miRl 69a-5p, ata- miR169b-3p. ata-miRl 69b-5p, ata-miR169c-3p, ata-miRl 69c-5p, ata-miRl 69d-3p, ata- miRl 69d-5p, ata-miRl 69e-5p, ata-miRl 69f-3p, ata-miRl 69f-5p, ata-miRl 69g-3p, ata- miRl 69g-5p, ata-miRl 69h-3p, ata-miRl 69h-5p, ata-miRl 69i-3p, ata-miRl 69i-5p, ata- miR169j-3p, ata-miRl 69j-5p, ata-miRl 7 la-3p, ata-miRl 7 la-5p, ata-miRl 7 lb-3p, ata- miR171b-5p. ata-miRl 7 lc-3p. ata-miRl 7 lc-5p. ata-miRl 7 ld-3p, ata-miRl 7 ld-5p, ata- miR172a-3p, ata-miRl 72a-5p, ata-miR172b-3p, ata-miR172b-5p, ata-miRl 72c-3p, ata- miR172c-5p, ata-miR2118a-3p, ata-miR2118a-5p, ata-miR2118b-3p, ata-miR2118b-5p, ata- miR2118c-3p, ata-miR2118d-3p, ata-miR2275a-3p, ata-miR2275a-5p, ata-miR2275b-3p, ata- miR2275b-5p, ata-miR2275c-3p, ata-miR2275c-5p. ata-miR319-3p, ata-miR319-5p, ata- miR390-3p, ata-miR390-5p. ata-miR393-3p, ata-mi R393 -5 p. ata-miR394-3p, ata-miR394-5p, ata-miR395a-3p, ata-miR395a-5p, ata-miR395b-3p, ata-miR395b-5p ata-miR395c-3p, ata- miR395c-5p, ata-miR395d-3p, ata-miR395d-5p, ata-miR395e-3p, ata-miR395e-5p, ata- miR395f-3p, ata-miR395f-5p, ata-miR396a-3p, ata-miR396a-5p, ata-miR396b-3p, ata- miR396b-5p. ata-miR396c-3p. ata-miR396c-5p. ata-miR396d-3p, ata-miR396d-5p, ata- miR396e-3p, ata-miR396e-5p, ata-miR398f-3p, ata-miR398f-5p, ata-miR398g-3p, ata- miR398g-5p, ata-miR399a-3p, ata-miR399a-5p, ata-miR399b-3p, ata-miR399b-5p, ata- miR408-3p, ata-miR408-5p, ata-miR5062a-3p, ata-miR5062a-5p, ata-miR5062b-3p, ata- miR5062b-5p, ata-miR5070-3p, ata-miR5070-5p, ata-miR5084-3p. ata-miR5084-5p. ata- miR5168-3p, ata-miR5168-5p, ata-miR5181-3p, ata-miR5181-5p, ata-miR5200-3p, ata- miR5200-5p, ata-miR528-3p, ata-miR528-5p, ata-miR6201-3p, ata-miR6201-5p. ata- miR9672-3p, ata-miR9672-5p, ata-miR9674a-3p, ata-miR9674a-5p, ata-miR9674b-3p, ata- miR9674b-5p, ata-miR9674c-3p, ata-miR9674c-5p. ata-miR9677-3p. ata-miR9677-5p, ata- miR9772a-3p, ata-miR9772a-5p, ata-miR9772b-3p. ata-miR9772b-5p, ata-miR9776-3p. ata- miR9776-5p, ata-miR9783-3p, ata-miR9783-5p, ata-miR9863a-3p, ata-miR9863a-5p, ata- miR9863b-3p, ata-miR9863b-5p, ath-miR10515, ath-miR156a-3p, ath-miR156a-5p, ath- miR156b-3p, ath-miR156b-5p, ath-miR156c-3p, ath-miR156c-5p, ath-miR156d-3p, ath- miR156d-5p. ath-miR156e, ath-miR156f-3p, ath-miR156f-5p, ath-miR156g, ath-miR156h, ath-miR156i, ath-miR156j, ath-miR157a-3p, ath-miR157a-5p, ath-miR157b-3p, ath-miR157b-5p, ath-miR157c-3p. ath-miR157c-5p, ath-miR157d, ath-miR158a-3p, ath- miR158a-5p. ath-miRl 58b, ath-miRl 59a, ath-miR159b-3p. ath-miRl 59b-5p, ath-miR159c, ath-miRl 60a-3p, ath-miRl 60a-5p, ath-miR160b, ath-miR160c-3p, ath-miRl 60c-5p, ath- miR161.1, ath-miR161.2, ath-miR162a-3p, ath-miRl 62a-5p, ath-miR162b-3p, ath-miR162b- 5p, ath-miR163, ath-miR164a, ath-miRl 64b-3p, ath-miRl 64b-5p, ath-miRl 64c-3p, ath- miR164c-5p, ath-miRl 65a-3p. ath-miR165a-5p, ath-miR165b, ath-miRl 66a-3p, ath- miR166a-5p. ath-miRl 66b-3p, ath-miR166b-5p, ath-miR166c, ath-miR166d, ath-miR166e- 3p, ath-miRl 66e-5p, ath-miRl 66f, ath-miRl 66g, ath-miRl 67a-3p, ath-miRl 67a-5p, ath- miR167b, ath-miR167c-3p, ath-miRl 67c-5p, ath-miR167d, ath-miRl 68a-3p, ath-miR168a- 5p, ath-miRl 68b-3p, ath-miRl 68b-5p, ath-miRl 69a-3p, ath-miRl 69a-5p, ath-miRl 69b-3p, ath-miR169b-5p. ath-miR169c, ath-miR169d, ath-miR169e, ath-miRl 69f-3p, ath-miR169f- 5p, ath-miRl 69g-3p, ath-miRl 69g-5p, ath-miRl 69h, ath-miRl 69i, ath-miRl 69j, ath- miRl 69k, ath-miR1691, ath-miR169m, ath-miR169n, ath-miRl 70-3p, ath-miRl 70-5p, ath- miR171a-3p, ath-miRl 71 a-5p, ath-miR171b-3p, ath-miR171b-5p, ath-miRl 7 lc-3p, ath- miR171c-5p. ath-miR172a, ath-miRl 72b-3p, ath-miRl 72b-5p, ath-miR172c. ath-miR172d- 3p. ath-miRl 72d-5p. ath-miRl 72e-3p. ath-miRl 72e-5p, ath-miR173-3p, ath-miR173-5p, ath- miR1886.1, ath-miR1886.2, ath-miRl 886.3, ath-miR1887, ath-miRl 888a, ath-miRl 888b, ath-miR2111a-3p, ath-miR2111a-5p, ath-miR2111b-3p, ath-miR211 lb-5p, ath-miR2112-3p, ath-miR2112-5p, ath-miR2933a. ath-miR2933b, ath-miR2934-3p, ath-miR2934-5p, ath- miR2936, ath-miR2937, ath-miR2938, ath-miR2939, ath-miR319a. ath-miR319b, ath- miR319c, ath-miR3434-3p, ath-miR3434-5p, ath-miR3440b-3p, ath-miR3440b-5p, ath- miR390a-3p, ath-miR390a-5p, ath-miR390b-3p, ath-miR390b-5p, ath-miR391-3p, ath- miR391-5p, ath-miR3932a, ath-miR3932b-3p, ath-miR3932b-5p, ath-miR3933, ath- miR393a-3p. ath-miR393a-5p. ath-miR393b-3p, ath-miR393b-5p, ath-miR394a, ath- miR394b-3p, ath-miR394b-5p, ath-miR395a, ath-miR395b, ath-miR395c, ath-miR395d, ath- miR395e, ath-miR395f, ath-miR396a-3p, ath-miR396a-5p, ath-miR396b-3p, ath-miR396b- 5p, ath-miR397a, ath-miR397b, ath-miR398a-3p, ath-miR398a-5p, ath-miR398b-3p, ath- miR398b-5p. ath-miR398c-3p, ath-miR398c-5p, ath-miR399a, ath-miR399b. ath-miR399c- 3p, ath-miR399c-5p. ath-miR399d, ath-miR399e, ath-miR399f. ath-miR400, ath-miR401, ath-miR402, ath-miR403-3p, ath-miR403-5p, ath-miR404, ath-miR405a, ath-miR405b, ath- miR405d, ath-miR406, ath-miR407, ath-miR408-3p, ath-miR408-5p, ath-miR413, ath- miR414, ath-miR415, ath-miR416, ath-miR417, ath-miR418, ath-miR419, ath-miR420, ath- miR4221, ath-miR4227, ath-miR4228-3p, ath-miR4228-5p, ath-miR4239, ath-miR4240. ath- miR4243, ath-miR4245, ath-miR426, ath-miR447a-3p, ath-miR447a.2-3p, ath-miR447b, ath-miR447c-3p, ath-miR447c-5p, ath-miR472-3p, ath-miR472-5p. ath-miR5012, ath-miR5013, ath-miR5014a-3p, ath-miR5014a-5p, ath-miR5014b, ath-miR5015. ath-miR5016, ath- miR5017-3p, ath-miR5017-5p, ath-miR5018, ath-miR5019, ath-miR5020a, ath-miR5020b, ath-miR5020c, ath-miR5021, ath-miR5022, ath-miR5023, ath-miR5024-3p, ath-miR5024-5p, ath-miR5025, ath-miR5026, ath-miR5027, ath-miR5028, ath-miR5029, ath-miR5595a, ath- miR5628, ath-miR5629, ath-miR5630a, ath-miR5630b, ath-miR5631, ath-miR5632-3p, alh- miR5632-5p. ath-miR5633, ath-miR5634. ath-miR5635a. ath-miR5635b. ath-miR5635c. ath- miR5635d, ath-miR5636, ath-miR5637, ath-miR5638a, ath-miR5638b, ath-miR5639-3p, ath- miR5639-5p, ath-miR5640, ath-miR5641, ath-miR5642a, ath-miR5642b, ath-miR5643a, ath- miR5643b, ath-miR5644, ath-miR5645a, ath-miR5645b, ath-miR5645c, ath-miR5645d, ath- miR5645e. ath-miR5645f, ath-miR5646, ath-miR5647, ath-miR5648-3p, ath-miR5648-5p. ath-miR5649a, ath-miR5649b, ath-miR5650, ath-miR5651, ath-miR5652, ath-miR5653, ath- miR5654-3p, ath-miR5654-5p, ath-miR5655, ath-miR5656. ath-miR5657, ath-miR5658, ath- miR5659, ath-miR5660, ath-miR5661, ath-miR5662, ath-miR5663-3p, ath-miR5663-5p, ath- miR5664, ath-miR5665, ath-miR5666, ath-miR5995b, ath-miR5996, ath-miR5997, ath- miR5998a. ath-miR5998b. ath-miR5999, ath-miR771, ath-miR773a, ath-miR773b-3p. ath- miR773b-5p, ath-miR774a, ath-miR774b-3p, ath-miR774b-5p, ath-miR775, ath-miR776, ath- miR777, ath-miR778, ath-miR779. 1, ath-miR779.2, ath-miR780.1, ath-miR780.2, ath- miR781a, ath-miR781b, ath-miR782, ath-miR8121, ath-miR8165, ath-miR8166, ath- miR8167a. ath-miR8167b. ath-miR8167c. ath-miR8167d ath-miR8167e?ath-miR8167f. ath- miR8168, ath-miR8169, ath-miR8170-3p, ath-miR8170-5p ath-miR8171, ath-miR8172, ath- miR8173, ath-miR8174, ath-miR8175, ath-miR8176, ath-miR8177. ath-miR8178, ath- miR8179, ath-miR8180, ath-miR8181, ath-miR8182, ath-miR8183. ath-miR8184, ath- miR822-3p, ath-miR822-5p, ath-miR823, ath-miR824-3p, ath-miR824-5p, ath-miR825, ath- miR826a, ath-miR826b, ath-miR827, ath-miR828, ath-miR829-3p. l, ath-miR829-3p.2, ath- miR829-5p, ath-miR830-3p, ath-miR830-5p, ath-miR831-3p, ath-miR831-5p, ath-miR832- 3p, ath-miR832-5p, ath-miR833a-3p, ath-miR833a-5p, ath-miR833b, ath-miR834, ath- miR835-3p, ath-miR835-5p, ath-miR836, ath-miR837-3p, ath-miR837-5p, ath-miR838, ath- miR839-5p, ath-miR840-3p. ath-miR840-5p, ath-miR841a-3p, ath-miR841a-5p, ath- miR841b-3p, ath-miR841b-5p, ath-miR842, ath-miR843, ath-miR844-3p, ath-miR844-5p, ath-miR845a, ath-miR845b, ath-miR846-3p, ath-miR846-5p, ath-miR847, ath-miR848, ath- miR849, ath-miR850, ath-miR851-3p, ath-miR851-5p, ath-miR852, ath-miR853, ath- miR854a, ath-miR854b, ath-miR854c. ath-miR854d, ath-miR854e. ath-miR855, ath-miR856, ath-miR857, ath-miR858a, ath-miR858b, ath-miR859, ath-miR860, ath-miR861-3p, ath-miR861-5p, ath-miR862-3p, ath-miR862-5p, ath-miR863-3p, ath-miR863-5p, ath-miR864- 3p, ath-miR864-5p, ath-miR865-3p, ath-miR865-5p, ath-miR866-3p, ath-miR866-5p, ath- miR867, ath-miR868-3p, ath-miR868-5p, ath-miR869.1, ath-miR869.2, ath-miR870-3p, ath- miR870-5p, atr-miR156a, atr-miR156b, atr-miR156c, atr-miR156d, atr-miR159, atr-miR160, atr-miR164a, atr-miR164b, atr-miR166a, atr-miR166b, atr-miR166c, atr-miR166d, atr- miR167, atr-miR168, atr-miR169a, alr-miR169b, atr-miR169c, atr-miR171a, atr-miR171b, atr-miR171c. atr-miR172, atr-miR2111. atr-miR2950. atr-miR319a, atr-miR319b, atr- miR319c, atr-miR319d, atr-miR319e, atr-miR390.1 , atr-miR390.2, atr-miR393, atr-miR394, atr-miR395, atr-miR396a, atr-miR396b, atr-miR396c, atr-miR396d, atr-miR396e, atr- miR397a, atr-miR397b, atr-miR398. atr-miR477, atr-miR535, atr-miR828, atr-miR8551. atr- miR8552a. atr-miR8552b, atr-miR8552c, atr-miR8552d, atr-miR8553a, atr-miR8553b, atr- miR8554, atr-miR8555, atr-miR8556, atr-miR8557, atr-miR8558a, atr-miR8558b, atr- miR8559, atr-miR8560, atr-miR8561.1, atr-miR8561.2, atr-miR8562a, atr-miR8562b, atr- miR8562c, atr-miR8563. atr-miR8564, atr-miR8565a, atr-miR8565b, atr-miR8565c, atr- miR8565d. atr-miR8565e, atr-miR8565f, atr-miR8565g, atr-miR8565h, atr-miR8566, atr- miR8567, atr-miR8568, atr-miR8569. atr-miR8570. atr-miR8571, atr-miR8572, atr- miR8573, atr-miR8574, atr-miR8575, atr-miR8576, atr-miR8577, atr-miR8578.1, atr- miR8578.2, atr-miR8579, atr-miR8580, atr-miR8581, atr-miR8582, atr-miR8583, atr- miR8584, atr-miR8585, atr-miR8586, atr-miR8587, atr-miR8588, atr-miR8589, atr- miR8590, atr-miR8591, atr-miR8592, atr-miR8593. atr-miR8594. 1, atr-miR8594.2, atr- miR8595, atr-miR8596, atr-miR8597, atr-miR8598, atr-miR8599, atr-miR8600, atr- miR8601, atr-miR8602, atr-miR8603, atr-miR8604, atr-miR8605, atr-miR8606, atr- miR8607, atr-miR8608, atr-miR8609, atr-miR8610.1, atr-miR8610.2, atr-miR8611, atr- miR8612, atr-miR8613, atr-miR8614, atr-miR8615. atr-miR8616, atr-miR8617, bbe-let-7a-2- 3p, bbe-let-7a-3p, bbe-let-7a-5p, bbe-miR-l-3p, bbe-miR-l-5p, bbe-miR-100-3p, bbe-miR- 100-5p, bbe-miR-10a-3p, bbe-miR-10a-5p, bbe-miR-10b-3p, bbe-miR-10b-5p, bbe-miR-lOc- 5p, bbe-miR-124-3p, bbe-miR-124-5p, bbe-miR-125a-3p, bbe-miR-125a-5p, bbe-miR-125b- 3p, bbe-miR-129a-3p, bbe-miR-129a-5p, bbe-miR-129b-5p, bbe-miR-133-3p, bbe-miR-133- 5p, bbe-miR-135a-3p, bbe-miR-135a-5p, bbe-miR-135b-5p, bbe-miR-137-3p, bbe-miR-153- 3p, bbe-miR-182a-3p, bbe-miR-182a-5p, bbe-miR-182b-3p, bbe-miR-182b-5p, bbe-miR- 182c-5p, bbe-miR-182d-3p, bbe-miR-183-5p, bbe-miR-184-3p, bbe-miR-184-5p, bbe-miR- 190-3p, bbe-miR-190-5p, bbe-miR-193b-3p, bbe-miR-200a-3p. bbe-miR-200a-5p, bbe-miR- 200b-3p, bbe-miR-200b-5p, bbe-miR-200c-3p, bbe-miR-2013-3p, bbe-miR-2056-3p, bbe- miR-2057-3p, bbe-miR-2057-5p, bbe-miR-2O58-3p, bbe-miR-2O58-5p, bbe-miR-2059-3p,bbe-miR-2059-5p, bbe-miR-2060a-3p, bbe-miR-2060b-3p, bbe-miR-2060c-3p, bbe-miR- 2061-3p, bbe-miR-2061-5p, bbe-miR-2062-3p, bbe-miR-2062-5p, bbe-miR-2063-3p, bbe- miR-2063-5p, bbe-miR-2064-3p, bbe-miR-2064-5p, bbe-miR-2066-3p, bbe-miR-2066-5p, bbe-miR-2067-3p, bbe-miR-2067-5p, bbe-miR-2068-3p, bbe-miR-2068-5p, bbe-miR-2069- 3p, bbe-miR-2070-3p, bbe-miR-2070-5p, bbe-miR-2071-3p, bbe-miR-2071-5p, bbe-miR- 2072-3p, bbe-miR-2072-5p, bbe-miR-2076-3p, bbe-miR-2076-5p, bbe-miR-210-3p, bbe- miR-210-5p. bbe-miR-216-3p. bbe-miR-216-5p, bbe-miR-217-3p, bbe-miR-217-5p. bbe- miR-219-3p, bbe-miR-219-5p, bbe-miR-22-3p, bbe-miR-22-5p, bbe-miR-242-5p, bbe-miR- 252a-3p, bbe-miR-252a-5p, bbe-miR-252b-3p, bbe-miR-252b-5p, bbe-miR-278-5p, bbe- miR-281-3p, bbe-miR-281-5p, bbe-miR-29a-3p, bbe-miR-29a-5p, bbe-miR-29b-3p, bbe- miR-29b-5p, bbe-miR-31-3p, bbe-miR-31-5p. bbe-miR-33-2-3p, bbe-miR-33-3p, bbe-miR- 33-5p, bbe-miR-34a-5p, bbe-miR-34b-3p, bbe-miR-34b-5p, bbe-miR-34c-5p, bbe-miR-34d- 5p, bbe-miR-34f-5p, bbe-miR-34g-5p, bbe-miR-34h-5p, bbe-miR-375-3p, bbe-miR-4057-3p, bbe-miR-4856a-3p, bbe-miR-4856a-5p, bbe-miR-4857-3p, bbe-miR-4857-5p, bbe-miR- 4859-3p, bbe-miR-4859-5p, bbe-miR-4860-3p, bbe-miR-4860-5p, bbe-miR-4861-3p, bbe- miR-4863-3p, bbe-miR-4863-5p, bbe-miR-4864-3p, bbe-miR-4864-5p. bbe-miR-4865-3p. bbe-miR-4865-5p, bbe-miR-4866-3p, bbe-miR-4866-5p, bbe-miR-4867-3p, bbe-miR-4868a- 3p, bbe-miR-4868b-3p, bbe-miR-4868c-3p, bbe-miR-4868c-5p, bbe-miR-4869-3p, bbe-miR- 4869-5p, bbe-miR-4873-5p, bbe-miR-4874-3p, bbe-miR-4874-5p, bbe-miR-4876-3p, bbe- miR-4877-3p, bbe-miR-4878-5p, bbe-miR-4879-5p, bbe-miR-4880-5p?bbe-miR-4887-5p. bbe-miR-4888-5p, bbe-miR-4889b-3p, bbe-miR-4890-5p, bbe-miR-4891-3p, bbe-miR-4891- 5p, bbe-miR-4899-5p, bbe-miR-4904-3p, bbe-miR-4904-5p, bbe-miR-4928-3p, bbe-miR-7- 3p, bbe-miR-7-5p, bbe-miR-705-5p, bbe-miR-71-3p, bbe-miR-71-5p, bbe-miR-9-3p, bbe- miR-9-5p, bbe-miR-92a-3p, bbe-miR-92a-5p, bbe-miR-92b-3p?bbe-miR-92b-5p, bbe-miR- 92c-3p, bbe-miR-92d-3p, bbe-miR-92d-5p, bbe-miR-96-3p, bbe-miR-96-5p, bcy-miR156, bcy-miR396a, bcy-miR396b, bcy-miR529, bdi-miR1122, bdi-miR1127, bdi-miR1135, bdi- miR1139, bdi-miR1432, bdi-miR156a, bdi-miR156b-3p, bdi-miR156b-5p, bdi-miR156c, bdi- miR156d-3p. bdi-miR156d-5p, bdi-miR156e-3p, bdi-miR156e-5p, bdi-miR156f-3p, bdi- miR156f-5p. bdi-miR156g-3p. bdi-miR156g-5p, bdi-miR156h-3p, bdi-miR156h-5p, bdi- miR156i-3p, bdi-miR156i-5p, bdi-miR156j, bdi-miR159a-3p bdi-miR159a-5p, bdi- miR159b-3p.l, bdi-miR159b-3p.2, bdi-miR159b-3p.3, bdi-miR159b-5p. 1, bdi-miR159b- 5p.2, bdi-miR159b-5p.3, bdi-miR159c, bdi-miR160a-3p, bdi-miR160a-5p, bdi-miR160b-3p, bdi-miR160b-5p?bdi-miR160c-3p, bdi-miR160c-5p, bdi-miR160d-3p, bdi-miR160d-5p. bdi- miR160e-3p, bdi-miR160e-5p, bdi-miR160f, bdi-miR162, bdi-miR164a-3p, bdi-miR164a-5p,bdi-miR164b, bdi-miR164c-3p, bdi-miR164c-5p, bdi-miR164e, bdi-miR164f, bdi-miR166a- 3p, bdi-miR166a-5p. bdi-miR166b-3p, bdi-miR166b-5p, bdi-miR166c-3p, bdi-miR166c-5p, bdi-miR166d-3p, bdi-miR166d-5p, bdi-miR166e-3p, bdi-miR166e-5p, bdi-miR166f, bdi- miR166g-3p, bdi-miR166g-5p, bdi-miR166h-3p, bdi-miR166h-5p, bdi-miR166i-3p, bdi- miR166i-5p, bdi-miR166j, bdi-miR167a, bdi-miR167b, bdi-miR167c-3p, bdi-miR167c-5p, bdi-miR167d-3p. bdi-miR167d-5p, bdi-miR167e-3p, bdi-miR167e-5p, bdi-miR167f. bdi- miR167g, bdi-miR168-3p. bdi-miR168-5p, bdi-miR169a-3p, bdi-miR169a-5p. bdi-miR169b, bdi-miR169c-3p, bdi-miR169c-5p, bdi-miR169d, bdi-miR169e-3p, bdi-miR169e-5p, bdi- miR169f. bdi-miR169g, bdi-miR169h-3p, bdi-miR169h-5p. bdi-miR169i, bdi-miR169j-3p, bdi-miR169j-5p, bdi-miR169k-3p, bdi-miR169k-5p, bdi-miR1691, bdi-miR169m, bdi- miR169n, bdi-miR171a, bdi-miR171b, bdi-miR171c-3p, bdi-miR171c-5p, bdi-miR171d-3p. bdi-miR171d-5p, bdi-miR171e, bdi-miR171f, bdi-miR172a-3p, bdi-miR172a-5p, bdi- miR172b, bdi-miR172d, bdi-miR1878-3p, bdi-miR1878-5p, bdi-miR2118a, bdi-miR2118b, bdi-miR2275a, bdi-miR2275b, bdi-miR2275c, bdi-miR319a, bdi-miR319b-3p, bdi-miR319b- 5p, bdi-miR390a-3p. bdi-miR390a-5p, bdi-miR393a, bdi-miR393b-3p, bdi-miR393b-5p. bdi- miR394, bdi-miR395a, bdi-miR395b, bdi-miR395c-3p. bdi-miR395c-5p. bdi-miR395d-3p, bdi-miR395d-5p, bdi-miR395e-3p, bdi-miR395e-5p, bdi-miR395f-3p, bdi-miR395f-5p, bdi- miR395g-3p, bdi-miR395g-5p, bdi-miR395h-3p, bdi-miR395h-5p, bdi-miR395j-3p, bdi- miR395j-5p, bdi-miR395k-3p, bdi-miR395k-5p, bdi-miR3951-3p, bdi-miR3951-5p, bdi- miR395m, bdi-miR395n-3p. bdi-miR395n-5p, bdi-miR395o-3p, bdi-miR395o-5p, bdi- miR395p-3p, bdi-miR395p-5p, bdi-miR395q, bdi-miR396a-3p, bdi-miR396a-5p, bdi- miR396b-3p, bdi-miR396b-5p, bdi-miR396c-3p, bdi-miR396c-5p, bdi-miR396d-3p, bdi- miR396d-5p, bdi-miR396e-3p, bdi-miR396e-5p, bdi-miR397a, bdi-miR397b-3p, bdi- miR397b-5p. bdi-miR398a, bdi-miR398b. bdi-miR399a, bdi-miR399b. bdi-miR399c, bdi- miR399d, bdi-miR408-3p, bdi-miR408-5p, bdi-miR437, bdi-miR444a, bdi-miR444b, bdi- miR444c, bdi-miR444d, bdi-miR5049-3p, bdi-miR5049-5p, bdi-miR5054, bdi-miR5055, bdi-miR5056, bdi-miR5057, bdi-miR5058, bdi-miR5059, bdi-miR5060, bdi-miR5061, bdi- miR5062a, bdi-miR5063, bdi-miR5064, bdi-miR5065, bdi-miR5066, bdi-miR5067, bdi- miR5068, bdi-miR5069. bdi-miR5070, bdi-miR5163a-3p, bdi-miR5163a-5p. bdi-miR5163b- 3p, bdi-miR5163b-5p, bdi-miR5164, bdi-miR5165-3p, bdi-miR5165-5p, bdi-miR5166, bdi- miR5167a-3p, bdi-miR5167a-5p, bdi-miR5167b-3p, bdi-miR5167b-5p, bdi-miR5169a, bdi- miR5169b, bdi-miR5170, bdi-miR5171a, bdi-miR5171b, bdi-miR5172-3p, bdi-miR5172-5p, bdi-miR5173-3p, bdi-miR5173-5p, bdi-miR5174a, bdi-miR5174b-3p, bdi-miR5174b-5p, bdi- miR5174c-3p, bdi-miR5174c-5p, bdi-miR5174d-3p, bdi-miR5174d-5p, bdi-miR5174e-3p.l,bdi-miR5174e-3p.2, bdi-miR5174e-5p.l, bdi-miR5174e-5p.2, bdi-miR5174f, bdi-miR5175a, bdi-miR5175b. bdi-miR5176-3p, bdi-miR5176-5p, bdi-miR5177. bdi-miR5178-3p, bdi- miR5178-5p, bdi-miR5179, bdi-miR5180a, bdi-miR5180b, bdi-miR5181a-3p, bdi- miR5181a-5p, bdi-miR5181b, bdi-miR5181c-3p, bdi-miR5181c-5p, bdi-miR5181d, bdi- miR5181e, bdi-miR5182, bdi-miR5183, bdi-miR5184, bdi-miR5185a-3p, bdi-miR5185a-5p, bdi-miR5185b-3p, bdi-miR5185b-5p, bdi-miR5185c-3p, bdi-miR5185c-5p, bdi-miR5185d- 3p. bdi-miR5185d-5p, bdi-miR5185e-3p, bdi-miR5185e-5p, bdi-miR5185f-3p. bdi- miR5185f-5p, bdi-miR5185g-3p, bdi-miR5185g-5p, bdi-miR5185h-3p bdi-miR5185h-5p, bdi-miR5185i-3p, bdi-miR5185i-5p, bdi-miR5185j-3p, bdi-miR5185j-5p, bdi-miR5185k-3p, bdi-miR5185k-5p, bdi-miR51851-3p, bdi-miR51851-5p, bdi-miR5185m-3p, bdi-miR5185m- 5p, bdi-miR5198, bdi-miR5199, bdi-miR5200a-3p, bdi-miR5200a-5p, bdi-miR5200b-3p, bdi-miR5200b-5p, bdi-miR5200c, bdi-miR5201-3p, bdi-miR5201-5p, bdi-miR5202, bdi- miR528-3p, bdi-miR528-5p, bdi-miR5281a, bdi-miR5281b, bdi-miR529-3p, bdi-miR529-5p, bdi-miR530a, bdi-miR530b, bdi-miR531, bdi-miR7707-3p, bdi-miR7707-5p, bdi-miR7708a- 3p, bdi-miR7708a-5p, bdi-miR7708b-3p, bdi-miR7708b-5p, bdi-miR7709-3p, bdi-miR7709- 5p. bdi-miR7710-3p. bdi-miR7710-5p, bdi-miR771 l-3p.l, bdi-miR771 l-3p.3, bdi-miR7711- 3p.4, bdi-miR771 l-5p.l, bdi-miR7711-5p.2, bdi-miR771 l-5p.3, bdi-miR771 l-5p,4, bdi- miR7712-3p, bdi-miR7712-5p, bdi-miR7713-3p, bdi-miR7713-5p, bdi-miR7714-3p, bdi- miR7714-5p. bdi-miR7715-3p, bdi-miR7715-5p, bdi-miR7716-3p, bdi-miR7716-5p, bdi- miR7717a-3p, bdi-miR7717a-5p, bdi-miR7717b-3p, bdi-miR7717b-5p, bdi-miR7717c-3p. bdi-miR7717c-5p, bdi-miR7718-3p, bdi-miR7718-5p, bdi-miR7719-3p, bdi-miR7719-5p, bdi-miR7720-3p. bdi-miR7720-5p, bdi-miR7721-3p, bdi-miR7721-5p, bdi-miR7722-3p, bdi- miR7722-5p, bdi-miR7723a-3p, bdi-miR7723a-5p, bdi-miR7723b-3p, bdi-miR7723b-5p, bdi-miR7724a-3p, bdi-miR7724a-5p, bdi-miR7724b-3p, bdi-miR7724b-5p, bdi-miR7725a- 3p, bdi-miR7725a-5p, bdi-miR7725b-3p.l, bdi-miR7725b-3p.2, bdi-miR7725b-5p.1, bdi- miR7725b-5p.2, bdi-miR7726a-3p, bdi-miR7726a-5p, bdi-miR7726b-3p, bdi-miR7726b-5p, bdi-miR7727-3p, bdi-miR7727-5p, bdi-miR7728-3p, bdi-miR7728-5p, bdi-miR7729a-3p, bdi-miR7729a-5p, bdi-miR7729b-3p, bdi-miR7729b-5p, bdi-miR7730-3p, bdi-miR7730-5p, bdi-miR7731-3p bdi-miR7731-5p, bdi-miR7732-3p, bdi-miR7732-5p. bdi-miR7733-3p. bdi- miR7733-5p, bdi-miR7734-3p, bdi-miR7734-5p, bdi-miR7735-3p, bdi-miR7735-5p, bdi- miR7736-3p, bdi-miR7736-5p, bdi-miR7737-3p, bdi-miR7737-5p, bdi-miR7738-3p, bdi- miR7738-5p, bdi-miR7739-3p, bdi-miR7739-5p, bdi-miR7740-3p, bdi-miR7740-5p, bdi- miR7741-3p.l. bdi-miR7741-3p.2, bdi-miR7741-5p.l, bdi-miR7741-5p.2, bdi-miR7742-3p, bdi-miR7742-5p, bdi-miR7743-3p, bdi-miR7743-5p, bdi-miR7744-3p, bdi-miR7744-5p, bdi-miR7745-3p, bdi-miR7745-5p, bdi-miR7746-3p, bdi-miR7746-5p, bdi-miR7747-3p, bdi- miR7747-5p. bdi-miR7748a-3p, bdi-miR7748a-5p, bdi-miR7748b-3p, bdi-miR7748b-5p, bdi-miR7749-3p, bdi-miR7749-5p, bdi-miR7750-3p, bdi-miR7750-5p, bdi-miR7751-3p, bdi- miR7751-5p, bdi-miR7752-3p, bdi-miR7752-5p, bdi-miR7753-3p, bdi-miR7753-5p, bdi- miR7754-3p, bdi-miR7754-5p, bdi-miR7755-3p, bdi-miR7755-5p, bdi-miR7756-3p, bdi- miR7756-5p. bdi-miR7757-3p.1, bdi-miR7757-3p.2, bdi-miR7757-5p.l, bdi-miR7757-5p.2, bdi-miR7758-3p, bdi-miR7758-5p, bdi-miR7759-3p, bdi-miR7759-5p. bdi-miR7760-3p. bdi- miR7760-5p, bdi-miR7761-3p, bdi-miR7761-5p, bdi-miR7762-3p, bdi-miR7762-5p, bdi- miR7763-3p, bdi-miR7763-5p, bdi-miR7764-3p, bdi-miR7764-5p, bdi-miR7765-3p, bdi- miR7765-5p, bdi-miR7766-3p, bdi-miR7766-5p, bdi-miR7767-3p, bdi-miR7767-5p, bdi- miR7768a-3p, bdi-miR7768a-5p, bdi-miR7768b-3p, bdi-miR7768b-5p, bdi-miR7769-3p, bdi-miR7769-5p, bdi-miR7770-3p, bdi-miR7770-5p, bdi-miR7771-3p, bdi-miR7771-5p, bdi- miR7772-3p, bdi-miR7772-5p, bdi-miR7773-3p, bdi-miR7773-5p, bdi-miR7774-3p, bdi- miR7774-5p, bdi-miR7775-3p, bdi-miR7775-5p, bdi-miR7776-3p.l, bdi-miR7776-3p.2, bdi- miR7776-5p.l. bdi-miR7776-5p.2, bdi-miR7777-3p.l, bdi-miR7777-3p.2, bdi-miR7777- 5p.1. bdi-miR7777-5p.2. bdi-miR7778-3p, bdi-miR7778-5p, bdi-miR7779-3p, bdi-miR7779- 5p, bdi-miR7780-3p, bdi-miR7780-5p, bdi-miR7781-3p, bdi-miR7781-5p, bdi-miR7782-3p, bdi-miR7782-5p, bdi-miR7783-3p, bdi-miR7783-5p, bdi-miR7784a-3p, bdi-miR7784a-5p, bdi-miR7784b-3p, bdi-miR7784b-5p, bdi-miR7785-3p, bdi-miR7785-5p, bdi-miR7786-3p, bdi-miR7786-5p, bdi-miR7787-3p, bdi-miR7787-5p, bdi-miR827-3p, bdi-miR827-5p, bdi- miR845, bdi-miR9480a, bdi-miR9480b, bdi-miR9481a, bdi-miR9481b, bdi-miR9482, bdi- miR9483a, bdi-miR9483b, bdi-miR9484, bdi-miR9485, bdi-miR9486a, bdi-miR9486b, bdi- miR9487, bdi-miR9488, bdi-miR9489, bdi-miR9490, bdi-miR9491, bdi-miR9492, bdi- miR9493, bdi-miR9494, bdi-miR9495, bdi-miR9496, bdi-miR9497, bdi-miR9498, bdi- miR9499, bdo-bantam, bdo-let-7, bdo-miR-1, bdo-miR-10, bdo-miR-100, bdo-miR-1000, bdo-miR-11, bdo-miR-11593, bdo-miR-11594, bdo-miR-11595, bdo-miR-11596, bdo-miR- 11597, bdo-miR-12, bdo-miR-124, bdo-miR-125, bdo-miR-137, bdo-miR-13a, bdo-miR-13b, bdo-miR-14, bdo-miR-184, bdo-miR-190, bdo-miR-193, bdo-miR-210, bdo-miR-219, bdo- miR-252, bdo-miR-263a, bdo-miR-263b, bdo-miR-275, bdo-miR-276a, bdo-miR-276b, bdo- miR-281, bdo-miR-282, bdo-miR-283, bdo-miR-284, bdo-miR-286, bdo-miR-2a, bdo-miR- 2a-2, bdo-miR-2b, bdo-miR-2c, bdo-miR-304, bdo-miR-305, bdo-miR-306, bdo-miR-307, bdo-miR-308, bdo-miR-309a, bdo-miR-309b, bdo-miR-315, bdo-miR-316, bdo-miR-318, bdo-miR-375, bdo-miR-4, bdo-miR-5a, bdo-miR-5b, bdo-miR-6, bdo-miR-7, bdo-miR-79, bdo-miR-8, bdo-miR-87, bdo-miR-927, bdo-miR-929, bdo-miR-92b, bdo-miR-932, bdo-miR-958, bdo-miR-970, bdo-miR-971, bdo-miR-980, bdo-miR-981, bdo-miR-988. bdo-miR- 993, bdo-miR-994. bdo-miR-995, bdo-miR-996, bdo-miR-998, bdo-miR-999, bdo-miR-9b, bdo-miR-9c, bdo-miR-iab-4, bdo-miR-iab-8, bfl-let-7a-3p, bfl-let-7a-5p, bfl-let-7b, bfl-miR- l-3p, bfl-miR-l-5p, bfl-miR-100-3p, bfl-miR-100-5p, bfl-miR-10a-3p, bfl-miR-10a-5p, bfl- miR-lOb, bfl-miR-lOc, bfl-miR-124-3p, bfl-miR-124-5p, bfl-miR-125a-3p, bfl-miR-125a-5p, bfl-miR-125b, bfl-miR-129a-3p, bfl-miR-129a-5p, bfl-miR-129b, bfl-miR-133, bfl-miR- 135a. bfl-miR-135b, bfl-miR-137. bfl-miR-153. bfl-miR-182a, bfl-miR-182b-3p. bfl-miR- 182c, bfl-miR-182d, bfl-miR-183, bfl-miR-184-3p, bfl-miR-184-5p, bfl-miR-19-3p, bfl-miR- 190, bfl-miR-193a, bfl-miR-193b, bfl-miR-200a, bfl-miR-200b, bfl-miR-200c, bfl-miR-2013, bfl-miR-2056, bfl-miR-2057, bfl-miR-20 8-3p, bfl-miR-2058-5p, bfl-miR-2059-3p, bfl-miR- 2059-5p, bfl-miR-2060, bfl-miR-2061, bfl-miR-2062-3p, bfl-miR-2062-5p, bfl-miR-2063. bfl-miR-2064, bfl-miR-2065, bfl-miR-2066, bfl-miR-2067, bfl-miR-2068-3p, bfl-miR-2068- 5p, bfl-miR-2069, bfl-miR-2070-3p, bfl-miR-2070-5p, bfl-miR-2071-3p, bfl-miR-2071-5p, bfl-miR-2072-3p, bfl-miR-2072-5p, bfl-miR-2073, bfl-miR-2075, bfl-miR-2076-3p, bfl-miR- 2076-5p, bfl-miR-210-3p, bfl-miR-210-5p, bfl-miR-216-3p, bfl-miR-216-5p, bfl-miR-217, bfl-miR-219. bfl-miR-22-3p. bfl-miR-22-5p, bfl-miR-242, bfl-miR-252a. bfl-miR-252b-3p, bfl-miR-252b-5p, bfl-miR-278, bfl-miR-281, bfl-miR-29a-3p, bfl-miR-29a-5p, bfl-miR-29b- 3p, bfl-miR-29b-5p, bfl-miR-31-3p, bfl-miR-31-5p, bfl-miR-33, bfl-miR-34a, bfl-miR-34b- 3p, bfl-miR-34b-5p, bfl-miR-34c, bfl-miR-34d, bfl-miR-34e, bfl-miR-375, bfl-miR-4057, bfl-miR-4856a, bfl-miR-4856b-3p, bfl-miR-4856b-5p, bfl-miR-4857, bfl-miR-4858-3p, bfl- miR-4858-5p, bfl-miR-4859-3p, bfl-miR-4859-5p, bfl-miR-4860-3p, bfl-miR-4860-5p, bfl- miR-4861, bfl-miR-4862-3p, bfl-miR-4862-5p, bfl-miR-4863-3p, bfl-miR-4863-5p, bfl-miR- 4864-3p, bfl-miR-4864-5p, bfl-miR-4865-3p, bfl-miR-4865-5p, bfl-miR-4866-3p, bfl-miR- 4866-5p, bfl-miR-4867, bfl-miR-4868a, bfl-miR-4868b, bfl-miR-4868c-3p, bfl-miR-4868c- 5p, bfl-miR-4869-3p, bfl-miR-4869-5p, bfl-miR-4870, bfl-miR-4871-3p, bfl-miR-4871-5p, bfl-miR-4872a, bfl-miR-4872b, bfl-miR-4872c, bfl-miR-4873, bfl-miR-4874-3p, bfl-miR- 4874-5p, bfl-miR-4875a-5p, bfl-miR-4875b-5p, bfl-miR-4875c-3p, bfl-miR-4875d-3p, bfl- miR-4876, bfl-miR-4877, bfl-miR-4878, bfl-miR-4879, bfl-miR-4880, bfl-miR-4881, bfl- miR-4882a, bfl-miR-4882b, bfl-miR-4882c. bfl-miR-4883, bfl-miR-4884, bfl-miR-4885, bfl- nuR-4886, bfl-miR-4887, bfl-miR-4888, bfl-miR-4889a, bfl-miR-4889b, bfl-miR-4890, bfl- miR-4891-3p, bfl-miR-4891-5p, bfl-miR-4892, bfl-miR-4893, bfl-miR-4894, bfl-miR-4895, bfl-miR-4897, bfl-miR-4898, bfl-miR-4899, bfl-miR-4900a, bfl-miR-4900b, bfl-miR-4901, bfl-miR-4902, bfl-miR-4903, bfl-miR-4904-3p, bfl-miR-4904-5p, bfl-miR-4905. bfl-miR- 4906, bfl-miR-4928, bfl-miR-7, bfl-miR-705, bfl-miR-71-3p, bfl-miR-71-5p, bfl-miR-9-3p,bfl-miR-9-5p, bfl-miR-92a, bfl-miR-92b-3p, bfl-miR-92b-5p, bfl-miR-92c, bfl-miR-92d-5p, bfl-miR-96-3p. bfl-miR-96-5p, bfv-miR-BFl-3p, bfv-miR-BFl-5p. bfv-miR-BF2-3p, bfv- miR-BF2-5p, bgy-miR156, bgy-miR396a, bgy-miR396b, bgy-miR529, bhvl-miR-Bl, bhvl- miR-BlO, bhvl-miR-B2, bhvl-miR-B3, bhvl-miR-B4, bhvl-miR-B5, bhvl-miR-B6-3p, bhvl-miR-B6-5p, bhvl-miR-B7, bhvl-miR-B8-3p, bhvl-miR-B8-5p, bhvl-miR-B9, bhv5- miR-Bl l, bhv5-miR-B12, bhv5-miR-B13, bhv5-miR-B14, bhv5-miR-B8, bib-miR-193, bib- miR-2788, bkv-miR-Bl-3p, bkv-miR-Bl-5p, blv-miR-Bl-3p, blv-miR-Bl-5p, blv-miR-B2- 3p, blv-miR-B2-5p, blv-miR-B3-3p, blv-miR-B3-5p, blv-miR-B4-3p, blv-miR-B4-5p, blv- miR-B5-3p, blv-miR-B5-5p, bma-let-7, bma-lin-4, bma-miR-lOOa, bma-miR-lOOb, bma- miR-lOOc, bma-miR-lOOd, bma-miR-1175, bma-miR-124, bma-miR-133, bma-miR-153, bma-miR- 1822, bma-miR-228, bma-miR-232, bma-miR-234. bma-miR-236. bma-miR-239- 3p, bma-miR-239-5p, bma-miR-250, bma-miR-252, bma-miR-268, bma-miR-279, bma-miR- 281-3p, bma-miR-281-5p, bma-miR-283, bma-miR-2a, bma-miR-2b-3p, bma-miR-2b-5p, bma-miR-2c, bma-miR-2d, bma-miR-2e, bma-miR-2f, bma-miR-2g-3p, bma-miR-2g-5p, bma-miR-2h-3p, bma-miR-2h-5p, bma-miR-2i-3p, bma-miR-2i-5p. bma-miR-307. bma-miR- 34. bma-miR-36a, bma-miR-36a-3, bma-miR-36b-3p. bma-miR-36b-5p, bma-miR-36c-3p, bma-miR-36c-5p, bma-miR-36d-3p, bma-miR-36d-5p, bma-miR-45, bma-miR-49, bma-miR- 50, bma-miR-5360, bma-miR-5361, bma-miR-5363-3p, bma-miR-5363-5p, bma-miR-5364, bma-miR-5365a, bma-miR-5365b, bma-miR-5366-3p, bma-miR-5366-5p, bma-miR-57, bma-miR-5838-3p. bma-miR-5838-5p, bma-miR-5839-3p, bma-miR-5839-5p, bma-miR- 5840, bma-miR-5841-3p, bma-miR-5841-5p, bma-miR-5842-3p, bma-miR-5842-5p, bma- miR-5843, bma-miR-5844, bma-miR-5845, bma-miR-5846, bma-miR-5847, bma-miR-5848, bma-miR-5849, bma-miR-5851, bma-miR-5852, bma-miR-5853, bma-miR-5854, bma-miR- 5855, bma-miR-5856a, bma-miR-5856b, bma-miR-5857, bma-miR-5858-3p, bma-miR- 5858-5p, bma-miR-5859, bma-miR-5861, bma-miR-5862-3p, bma-miR-5862-5p, bma-miR- 5863, bma-miR-5864, bma-miR-5865, bma-miR-5866, bma-miR-5867, bma-miR-5868, bma- miR-5869, bma-miR-5871, bma-miR-5872, bma-miR-5873, bma-miR-5874, bma-miR-5875, bma-miR-5876, bma-miR-5877, bma-miR-5878, bma-miR-5879a, bma-miR-5879b, bma- miR-5880a, bma-miR-5880b, bma-miR-5881a, bma-miR-5881b, bma-miR-5882a. bma-miR- 5882b, bma-miR-5883, bma-miR-60, bma-miR-7, bma-miR-71, bma-miR-72, bma-miR-750, bma-miR-81, bma-miR-84-3p, bma-miR-84-5p, bma-miR-86, bma-miR-87a, bma-miR-87b, bma-miR-9-3p, bma-miR-9-5p, bma-miR-92, bma-miR-9501-3p, bma-miR-9502, bma-miR- 9503, bma-miR-9504, bma-miR-9505-3p, bma-miR-9505-5p, bma-miR-9506-3p, bma-miR- 9507, bma-miR-9508-5p, bma-miR-9509-3p, bma-miR-9510, bma-miR-9511-3p, bma-miR-9512. bma-miR-9513-5p, bma-miR-9514, bma-miR-9515, bma-miR-9516, bma-miR-9517- 3p, bma-miR-9517-5p. bma-miR-9518, bma-miR-9519. bma-miR-9520, bma-miR-9521, bma-miR-9522, bma-miR-9523, bma-miR-9525, bma-miR-9526, bma-miR-9527, bma-miR- 9528, bma-miR-9529, bma-miR-9530, bma-miR-9531, bma-miR-9532, bma-miR-9533, bma- miR-9534, bma-miR-9535, bma-miR-9536, bma-miR-9537, bmo-bantam-3p, bmo-bantam- 5p, bmo-lel-7-3p, bmo-let-7-5p, bmo-miR-10-3p, bmo-miR-10-5p, bmo-miR-100, bmo-miR- 1000, bmo-miR-1 l-3p, bmo-miR-1 l-5p, bmo-miR-1175-3p, bmo-miR-1175-5p, bmo-miR- 12, bmo-miR-124, bmo-miR-133, bmo-miR-137, bmo-miR-13a-3p, bmo-miR-13a-5p, bmo- miR-13b-3p, bmo-miR-13b-5p, bmo-miR-14-3p, bmo-miR-14-5p, bmo-miR-184-3p, bmo- miR-184-5p, bmo-miR-190-3p, bmo-miR-190-5p, bmo-miR-1923, bmo-miR-1926, bmo- miR-la-3p. bmo-miR-la-5p. bmo-miR-1 b-3p. bmo-miR-1 b-5p. bmo-miR-210. bmo-miR- 252-3p, bmo-miR-252-5p, bmo-miR-263a-3p, bmo-miR-263a-5p, bmo-miR-263b-3p, bmo- miR-263b-5p, bmo-miR-2723, bmo-miR-2724, bmo-miR-2729, bmo-miR-2731, bmo-miR- 2733a-3p, bmo-miR-2733a-5p, bmo-miR-2733b, bmo-miR-2733c, bmo-miR-2733d, bmo- miR-2733e, bmo-miR-2733f, bmo-miR-2733g, bmo-miR-2733h, bmo-miR-2733i-3p, bmo- miR-2733i-5p. bmo-miR-2733j. bmo-miR-2734, bmo-miR-2736. bmo-miR-2737, bmo-miR- 2738, bmo-miR-2739, bmo-miR-274-3p, bmo-miR-274-5p, bmo-miR-2742, bmo-miR-2744, bmo-miR-2745, bmo-miR-2748, bmo-miR-275-3p, bmo-miR-275-5p, bmo-miR-2751, bmo- miR-2752, bmo-miR-2753, bmo-miR-2754, bmo-miR-2755-3p, bmo-miR-2755-5p, bmo- miR-2756-3p, bmo-miR-2756-5p, bmo-miR-2757-3p. bmo-miR-2757-5p, bmo-miR-2758- 3p, bmo-miR-2758-5p, bmo-miR-2759, bmo-miR-276-3p, bmo-miR-276-5p, bmo-miR- 2760-3p, bmo-miR-2760-5p, bmo-miR-2761-3p, bmo-miR-2761-5p, bmo-miR-2762, bmo- miR-2763-3p, bmo-miR-2763-5p, bmo-miR-2764, bmo-miR-2765, bmo-miR-2766-3p, bmo- miR-2766-5p, bmo-miR-2767. bmo-miR-2768-3p, bmo-miR-2768-5p, bmo-miR-2769, bmo- miR-277-3p, bmo-miR-277-5p, bmo-miR-2770-3p, bmo-miR-2770-5p, bmo-miR-2771-3p, bmo-miR-2771-5p, bmo-miR-2772a, bmo-miR-2772b, bmo-miR-2774a, bmo-miR-2774b, bmo-miR-2774c, bmo-miR-2775a, bmo-miR-2775b, bmo-miR-2776, bmo-miR-2777-3p, bmo-miR-2777-5p, bmo-miR-2778a-2-5p, bmo-miR-2778a-3p. bmo-miR-2778a-4-5p, bmo- miR-2778a-5p. bmo-miR-2778b-3p. bmo-miR-2778b-5p. bmo-miR-2778c-3p. bmo-miR- 2778c-5p, bmo-miR-2778d-3p, bmo-miR-2778d-5p, bmo-miR-2779, bmo-miR-278-3p, bmo- miR-278-5p, bmo-miR-2780a-3p, bmo-miR-2780a-5p, bmo-miR-2780b, bmo-miR-2780c, bmo-miR-2780d. bmo-miR-2781, bmo-miR-2782, bmo-miR-2783, bmo-miR-2784, bmo- miR-2785, bmo-miR-2786, bmo-miR-2787-3p, bmo-miR-2787-5p. bmo-miR-2788, bmo- miR-2789, bmo-miR-2790-3p, bmo-miR-2790-5p, bmo-miR-2791, bmo-miR-2792-3p, bmo-miR-2792-5p, bmo-miR-2794. bmo-miR-2795, bmo-miR-2796-3p, bmo-miR-2796-5p, bmo- miR-2797a, bmo-miR-2797b, bmo-miR-2797c, bmo-miR-2797d. bmo-miR-2798, bmo-miR- 2799, bmo-miR-279a, bmo-miR-279b-3p, bmo-miR-279b-5p, bmo-miR-279c-3p, bmo-miR- 279c-5p, bmo-miR-279d-3p, bmo-miR-279d-5p, bmo-miR-279e, bmo-miR-2800, bmo-miR- 2801, bmo-miR-2803, bmo-miR-2804-3p, bmo-miR-2804-5p, bmo-miR-2805, bmo-miR- 2806, bmo-miR-2807a, bmo-miR-2807b, bmo-miR-2807c-3p, bmo-miR-2807c-5p, bmo- miR-2807d, bmo-miR-2808a-3p, bmo-miR-2808a-5p, bmo-miR-2808b, bmo-miR-2808c, bmo-miR-2808d, bmo-miR-2808e, bmo-miR-2809, bmo-miR-281-3p, bmo-miR-281-5p, bmo-miR-2810, bmo-miR-2812, bmo-miR-2813, bmo-miR-2814, bmo-miR-2816, bmo-miR- 2817, bmo-miR-2818, bmo-miR-2819, bmo-miR-282-3p, bmo-miR-282-5p, bmo-miR-2820, bmo-miR-2821, bmo-miR-2822. bmo-miR-2824, bmo-miR-2825, bmo-miR-2826, bmo-miR- 2827, bmo-miR-2828, bmo-miR-283-3p, bmo-miR-283-5p, bmo-miR-2830, bmo-miR-2831, bmo-miR-2832, bmo-miR-2833, bmo-miR-2833b, bmo-miR-2834, bmo-miR-2835, bmo- miR-2836, bmo-miR-2837, bmo-miR-2838, bmo-miR-2839-3p, bmo-miR-2839-5p, bmo- miR-2840, bmo-miR-2841, bmo-miR-2842, bmo-miR-2843-l-3p, bmo-miR-2843-2-3p, bmo-miR-2843-5p, bmo-miR-2845. bmo-miR-2846, bmo-miR-2847. bmo-miR-2848, bmo- miR-2849, bmo-miR-285, bmo-miR-2851, bmo-miR-2852, bmo-miR-2854, bmo-miR-2855, bmo-miR-2856-3p, bmo-miR-2856-5p, bmo-miR-2857, bmo-miR-2859, bmo-miR-2860, bmo-miR-2998, bmo-miR-2999. bmo-miR-2a-l-5p. bmo-miR-2a-2-5p, bmo-miR-2a-3p. bmo-miR-2b-3p. bmo-miR-2b-5p. bmo-miR-3000, bmo-miR-3001, bmo-miR-305-3p, bmo- miR-305-5p, bmo-miR-306a-3p, bmo-miR-306a-5p, bmo-miR-306b, bmo-miR-307-3p, bmo- miR-307-5p, bmo-miR-308-3p, bmo-miR-308-5p, bmo-miR-31-3p, bmo-miR-31-5p, bmo- miR-316-3p, bmo-miR-316-5p, bmo-miR-317-3p, bmo-miR-317-5p, bmo-miR-3203-3p, bmo-miR-3203-5p, bmo-miR-3204a-3p. bmo-miR-3204a-5p. bmo-miR-3204b, bmo-miR- 3205, bmo-miR-3206, bmo-miR-3207, bmo-miR-3208, bmo-miR-3209, bmo-miR-3210, bmo-miR-3211, bmo-miR-3212, bmo-miR-3213-3p, bmo-miR-3213-5p, bmo-miR-3214, bmo-miR-3215, bmo-miR-3216, bmo-miR-3217, bmo-miR-3218, bmo-miR-3219, bmo-miR- 3220, bmo-miR-3221, bmo-miR-3222, bmo-miR-3223-3p, bmo-miR-3223-5p, bmo-miR- 3224, bmo-miR-3225, bmo-miR-3226, bmo-miR-3227. bmo-miR-3228, bmo-miR-3229. bmo-miR-3230, bmo-miR-3231 , bmo-miR-3232, bmo-miR-3233, bmo-miR-3234, bmo-miR- 3235, bmo-miR-3236, bmo-miR-3237, bmo-miR-3238, bmo-miR-3239, bmo-miR-3241, bmo-miR-3242, bmo-miR-3243, bmo-miR-3244, bmo-miR-3245, bmo-miR-3246, bmo-miR- 3247, bmo-miR-3248, bmo-miR-3249, bmo-miR-3250, bmo-miR-3251, bmo-miR-3252. bmo-miR-3253, bmo-miR-3254, bmo-miR-3255, bmo-miR-3256, bmo-miR-3257-3p, bmo-miR-3257-5p, bmo-miR-3258. bmo-miR-3259, bmo-miR-3260, bmo-miR-3261, bmo-miR- 3262, bmo-miR-3263, bmo-miR-3264, bmo-miR-3265, bmo-miR-3266, bmo-miR-3267a, bmo-miR-3267b, bmo-miR-3267c, bmo-miR-3268-3p, bmo-miR-3268-5p, bmo-miR-3269, bmo-miR-3270, bmo-miR-3271, bmo-miR-3272, bmo-miR-3273, bmo-miR-3274, bmo-miR- 3275, bmo-miR-3276, bmo-miR-3277, bmo-miR-3278, bmo-miR-3279, bmo-miR-3280, bmo-miR-3282, bmo-miR-3283. bmo-miR-3284, bmo-miR-3285, bmo-miR-3286-3p, bmo- miR-3286-5p, bmo-miR-3287. bmo-miR-3288, bmo-miR-3289, bmo-miR-3290. bmo-miR- 3291 , bmo-miR-3292, bmo-miR-3293, bmo-miR-3294, bmo-miR-3295, bmo-miR-3296-3p, bmo-miR-3296-5p, bmo-miR-3297-3p, bmo-miR-3297-5p, bmo-miR-3298, bmo-miR-3299, bmo-miR-33-3p, bmo-miR-33-5p, bmo-miR-3301, bmo-miR-3302, bmo-miR-3303, bmo- miR-3304a, bmo-miR-3305. bmo-miR-3306, bmo-miR-3307, bmo-miR-3308-3p, bmo-miR- 3308-5p, bmo-miR-3309, bmo-miR-3310, bmo-miR-3311, bmo-miR-3312, bmo-miR-3314, bmo-miR-3315, bmo-miR-3316, bmo-miR-3317, bmo-miR-3318, bmo-miR-3319, bmo-miR- 3321, bmo-miR-3322, bmo-miR-3323, bmo-miR-3324, bmo-miR-3325, bmo-miR-3326, bmo-miR-3327-3p, bmo-miR-3327-5p, bmo-miR-3328, bmo-miR-3329, bmo-miR-3330, bmo-miR-3332, bmo-miR-3333. bmo-miR-3334, bmo-miR-3335, bmo-miR-3336. bmo-miR- 3337, bmo-miR-3338-3p, bmo-miR-3338-5p, bmo-miR-3339, bmo-miR-3340, bmo-miR- 3342, bmo-miR-3343, bmo-miR-3344, bmo-miR-3345, bmo-miR-3347a, bmo-miR-3347b, bmo-miR-3348, bmo-miR-3350. bmo-miR-3351, bmo-miR-3352, bmo-miR-3353, bmo-miR- 3354, bmo-miR-3355, bmo-miR-3356, bmo-miR-3357. bmo-miR-3358, bmo-miR-3359. bmo-miR-3360, bmo-miR-3361, bmo-miR-3362, bmo-miR-3363, bmo-miR-3364, bmo-miR- 3365, bmo-miR-3366, bmo-miR-3367, bmo-miR-3368, bmo-miR-3369, bmo-miR-3370, bmo-miR-3371, bmo-miR-3372-3p, bmo-miR-3372-5p, bmo-miR-3373-3p, bmo-miR-3373- 5p, bmo-miR-3374-3p, bmo-miR-3374-5p, bmo-miR-3375-3p, bmo-miR-3375-5p. bmo- miR-3377-3p, bmo-miR-3377-5p, bmo-miR-3378-3p, bmo-miR-3378-5p, bmo-miR-3381- 3p, bmo-miR-3381-5p, bmo-miR-3382-3p, bmo-miR-3382-5p, bmo-miR-3383-3p, bmo- miR-3383-5p, bmo-miR-3384-3p, bmo-miR-3384-5p, bmo-miR-3385-3p, bmo-miR-3385- 5p, bmo-miR-3386-3p, bmo-miR-3386-5p, bmo-miR-3387-3p, bmo-miR-3387-5p. bmo- miR-3388-3p, bmo-miR-3388-5p, bmo-miR-3389-3p. bmo-miR-3389-5p, bmo-miR-3391- 3p, bmo-miR-3391-5p, bmo-miR-3392, bmo-miR-3393, bmo-miR-3394, bmo-miR-3395, bmo-miR-3396, bmo-miR-3397, bmo-miR-3398, bmo-miR-3399, bmo-miR-34-3p, bmo- miR-34-5p, bmo-miR-3400, bmo-miR-3401, bmo-miR-3402, bmo-miR-3403, bmo-miR- 3404, bmo-miR-3405, bmo-miR-3406-3p. bmo-miR-3406-5p, bmo-miR-3407. bmo-miR- 3408, bmo-miR-3409, bmo-miR-3410, bmo-miR-3411, bmo-miR-3412, bmo-miR-3413,bmo-miR-3414-3p, bmo-miR-3414-5p, bmo-miR-3415. bmo-miR-3416, bmo-miR-3417, bmo-miR-3418, bmo-miR-3419. bmo-miR-3420, bmo-miR-3421, bmo-miR-3422, bmo-miR- 3423, bmo-miR-3424, bmo-miR-3425, bmo-miR-3426, bmo-miR-3427, bmo-miR-3428, bmo-miR-3429, bmo-miR-3430, bmo-miR-375-3p, bmo-miR-375-5p, bmo-miR-6497-3p, bmo-miR-6497-5p, bmo-miR-6498-3p, bmo-miR-6498-5p, bmo-miR-7-3p, bmo-miR-7-5p, bmo-miR-71-3p, bmo-miR-71-5p, bmo-miR-745-3p, bmo-miR-745-5p, bmo-miR-750-3p, bmo-miR-750-5p, bmo-miR-79-3p, bmo-miR-79-5p, bmo-miR-8-3p. bmo-miR-8-5p, bmo- miR-87, bmo-miR-927-3p, bmo-miR-927-5p, bmo-miR-929-3p, bmo-miR-929-5p, bmo- miR-92a, bmo-miR-92b, bmo-miR-932, bmo-miR-965-3p, bmo-miR-965-5p, bmo-miR-970- 3p, bmo-miR-970-5p, bmo-miR-989a, bmo-miR-989b, bmo-miR-993a-3p, bmo-miR-993a- 5p, bmo-miR-993b-3p, bmo-miR-993b-5p, bmo-miR-998, bmo-miR-9a-3p, bmo-miR-9a-5p, bmo-miR-9b-3p, bmo-miR-9b-5p, bmo-miR-9c-3p, bmo-miR-9c-5p, bmo-miR-9d, bmo- miR-iab-4-3p, bmo-miR-iab-4-5p, bmo-miR-iab-8, bna-miR1140, bna-miR156a, bna- miR156b, bna-miR156c, bna-miR156d, bna-miR156e, bna-miR156f, bna-miR156g, bna- miR159, bna-miR160a, bna-miR160b. bna-miR160c, bna-miR160d, bna-miR161, bna- miR162a, bna-miR164a. bna-miR164b, bna-miR164c, bna-miR164d. bna-miR166a, bna- miR166b, bna-miR166c, bna-miR166d, bna-miR166e, bna-miR166f, bna-miR167a, bna- miR167b, bna-miR167c, bna-miR167d, bna-miR168a, bna-miR168b, bna-miR169a, bna- miR169b, bna-miR169c, bna-miR169d, bna-miR169e, bna-miR169f, bna-miR169g, bna- miR169h, bna-miR169i, bna-miR169j, bna-miR169k. bna-miR1691, bna-miR169m, bna- miR169n, bna-miR171a, bna-miR171b, bna-miR171c, bna-miR171d, bna-miR171e, bna- miR171f, bna-miR171g, bna-miR172a, bna-miR172b, bna-miR172c, bna-miR172d, bna- miR211 la-3p, bna-miR211 la-5p, bna-miR211 lb-3p, bna-miR211 lb-5p, bna-miR2111c. bna-miR211 Id, bna-miR390a, bna-miR390b, bna-miR390c, bna-miR393, bna-miR394a. bna- miR394b, bna-miR395a, bna-miR395b, bna-miR395c, bna-miR395d, bna-miR395e, bna- miR395f, bna-miR396a, bna-miR397a, bna-miR397b, bna-miR399a, bna-miR399b, bna- miR399c, bna-miR403, bna-miR6028, bna-miR6029, bna-miR6030, bna-miR6031, bna- miR6032, bna-miR6033. bna-miR6034, bna-miR6035, bna-miR6036, bna-miR824, bna- miR860, bol-miR157a, bol-miR171a, bol-miR172a. bol-miR172b, bol-miR398a-3p, bol- miR398a-5p, bol-miR824, bol-miR9408, bol-miR9409, bol-miR9410, bol-miR9411, bpcvl- miR-Bl, bpcv2-miR-Bl, bra-miR1140, bra-miR156a-3p, bra-miR156a-5p, bra-miR156b-3p, bra-miR156b-5p, bra-miR156c-3p, bra-miR156c-5p, bra-miR156d-3p, bra-miR156d-5p, bra- miR156e-3p. bra-miR156e-5p, bra-miR156f-3p, bra-miR156f-5p, bra-miR156g-3p, bra- miR156g-5p, bra-miR157a, bra-miR158-3p, bra-miR158-5p, bra-miR159a, bra-miR160a-3p,bra-miRl 60a-5p, bra-miR161-3p, bra-miR161-5p, bra-miR162-3p, bra-miR162-5p, bra- miRl 64a, bra-miRl 64b-3p, bra-miR164b-5p, bra-miRl 64c-3p, bra-miRl 64c-5p. bra- miRl 64d-3p, bra-miRl 64d-5p, bra-miRl 64e-3p, bra-miRl 64e-5p, bra-miR167a, bra- miR167b, bra-miR167c, bra-miR167d, bra-miRl 68a-3p, bra-miRl 68a-5p, bra-miRl 68b-3p, bra-miRl 68b-5p, bra-miRl 68c-3p, bra-miRl 68c-5p, bra-miR171a, bra-miR171b, bra- miRl 71c, bra-miRl 7 Id, bra-miRl 7 le, bra-miRl 72a, bra-miRl 72b-3p, bra-miRl 72b-5p, bra- miR172c-3p. bra-miRl 72c-5p, bra-miRl 72d-3p, bra-miRl 72d-5p, bra-miR1885a, bra- miRl 885b, bra-miR21 11 -3p, bra-miR2111 -5p, bra-miR211 la-3p, bra-miR211 la-5p, bra- miR2111b-3p, bra-miR2111b-5p, bra-miR319-3p, bra-miR319-5p, bra-miR390-3p, bra- miR390-5p, bra-miR391-3p, bra-miR391-5p, bra-miR395a-3p, bra-miR395a-5p, bra- miR395b-3p. bra-miR395b-5p, bra-miR395c-3p, bra-miR395c-5p, bra-miR395d-3p, bra- miR395d-5p, bra-miR396-3p, bra-miR396-5p, bra-miR398-3p, bra-miR398-5p, bra-miR400- 3p, bra-miR400-5p, bra-miR403-3p, bra-miR403-5p, bra-miR408-3p, bra-miR408-5p, bra- miR5654a, bra-miR5654b, bra-miR5711, bra-miR5712, bra-miR5713, bra-miR5714, bra- miR5715, bra-miR5716, bra-miR5717, bra-miR5718, bra-miR5719, bra-miR5720, bra- miR5721, bra-miR5722. bra-miR5723, bra-miR5724. bra-miR5725, bra-miR5726. bra- miR6032-3p, bra-miR6032-5p, bra-miR824, bra-miR860-3p, bra-miR860-5p, bra-miR9408- 3p, bra-miR9408-5p, bra-miR9552a-3p, bra-miR9552a-5p, bra-miR9552b-3p, bra- miR9552b-5p, bra-miR9553-3p, bra-miR9553-5p, bra-miR9554-3p, bra-miR9554-5p, bra- miR9555a-3p, bra-miR9555a-5p, bra-miR9555b-3p, bra-miR9555b-5p, bra-miR9556-3p, bra-miR9556-5p, bra-miR9557-3p, bra-miR9557-5p, bra-miR9558-3p, bra-miR9558-5p, bra- miR9559-3p, bra-miR9559-5p, bra-miR9560a-3p, bra-miR9560a-5p, bra-miR9560b-3p, bra- miR9560b-5p, bra-miR9561-3p, bra-miR9561-5p, bra-miR9562-3p, bra-miR9562-5p, bra- miR9563a-3p, bra-miR9563a-5p, bra-miR9563b-3p, bra-miR9563b-5p, bra-miR9564-3p, bra-miR9564-5p, bra-miR9565-3p, bra-miR9565-5p, bra-miR9566-3p, bra-miR9566-5p, bra- miR9567-3p, bra-miR9567-5p, bra-miR9568-3p, bra-miR9568-5p, bra-miR9569-3p, bra- miR9569-5p, bta-let-7a-3p, bta-let-7a-5p, bta-let-7b, bta-let-7c, bta-let-7d, bta-let-7e, bta-let- 7f, bta-let-7g, bta-let-7i, bta-miR-1, bta-miR-100, bta-miR- 10020, bta-miR-101, bta-miR- 1016 l-5p, bta-miR- 10162-5p, bta-miR- 10163-3 p. bta-miR-10164-3p, bta-miR-10165 -5 p, bta-miR-10166-5p, bta-miR-10167-3p, bta-miR-10168-5p, bta-miR-10169-3p, bta-miR- 10170-5p, bta-miR-10171-3p, bta-miR-10172-3p, bta-miR-10172-5p, bta-miR-10173-5p, bta-miR-10174-3p. bta-miR-10174-5p, bta-miR-10175-3 p, bta-miR-10175-5 p, bta-miR- 10176-5p, bta-miR-10177-5p, bta-miR-10178-5p. bta-miR-10179-5p, bta-miR-10180-3p, bta-miR-10181 -5 p, bta-miR-10182-3p, bta-miR-10182-5p, bta-miR-10183-5p, bta-miR-10184-3p, bta-miR-10185-5p, bta-miR- 10225 a, bta-miR- 10225b, bta-miR-103, bta-miR- 105a. bta-miR-105b, bta-miR-106a, bta-miR-106b, bta-miR-107, bta-miR-lOa. bta-miR-lOb, bta-miR-1179, bta-miR-1185, bta-miR-1193, bta-miR-1197, bta-miR- 11971, bta-miR- 11972, bta-miR- 11973, bta-miR-11974, bta-miR-11975, bta-miR- 11976, bta-miR- 11977, bta-miR- 11978, bta-miR-11979, bta-miR-11980, bta-miR-11981, bta-miR- 11982, bta-miR-11983, bta- miR-11984, bta-miR-11985, bta-miR-11986, bta-miR- 11986b, bta-miR-11986c, bta-miR- 11987, bta-miR-11988, bta-miR-11989. bta-miR-11990, bta-miR-11991. bta-miR-11992, bta- miR-11993, bta-miR-11994, bta-miR-11995, bta-miR-11996, bta-miR-11997, bta-miR- 11998, bta-miR-11999, bta-miR- 12000, bta-miR- 12001, bta-miR- 12002a, bta-miR-12002b, bta-miR-12003, bta-miR- 12004, bta-miR- 12005, bta-miR- 12006, bta-miR- 12007, bta-miR- 12008, bta-miR- 12009, bta-miR- 12010, bta-miR-12011, bta-miR- 12012, bta-miR-12013, bta- miR-12014, bta-miR-12015, bta-miR- 12016, bta-miR-12017, bta-miR- 12018, bta-miR- 12019, bta-miR- 12020, bta-miR- 12021, bta-miR- 12022, bta-miR- 12023, bta-miR- 12024, bta- miR-12025, bta-miR- 12026, bta-miR- 12027, bta-miR- 12028, bta-miR- 12029, bta-miR- 12030, bta-miR- 12031, bta-miR- 12032, bta-miR- 12033, bta-miR-12034, bta-miR-12035, bta- miR-12036, bta-miR- 12037. bta-miR- 12038, bta-miR- 12039. bta-miR- 12040, bta-miR- 12041, bta-miR- 12042, bta-miR-12043, bta-miR- 12044, bta-miR- 12045, bta-miR- 12046, bta- miR-12047, bta-miR-12048, bta-miR-12049, bta-miR-12050, bta-miR- 12051, bta-miR- 12052, bta-miR- 12053, bta-miR- 12054, bta-miR- 12055, bta-miR- 12056, bta-miR-12057, bta- miR-12058, bta-miR-12059. bta-miR- 12060, bta-miR- 12061. bta-miR- 12062, bta-miR- 12063, bta-miR- 12064, bta-miR-122, bta-miR-1224, bta-miR-1225-3p, bta-miR-1246, bta- miR-1247-3p, bta-miR- 1247-5p, bta-miR-1248, bta-miR-1249, bta-miR-124a, bta-miR-124b, bta-miR-1251, bta-miR-1256, bta-miR-125a, bta-miR-125b, bta-miR-126-3p, bta-miR-126- 5p, bta-miR- 1260b, bta-miR-1264, bta-miR-127, bta-miR-1271, bta-miR-1277, bta-miR-128, bta-miR-1281, bta-miR-1282, bta-miR-1284, bta-miR-1287, bta-miR-129, bta-miR- 129-3p, bta-miR- 129-5p, bta-miR-1291, bta-miR-1296, bta-miR-1298, bta-miR-1301, bta-miR-1306, bta-miR-1307, bta-miR-130a, bta-miR-130b, bta-miR-132, bta-miR-133a, bta-miR-133b, bta- miR-133c, bta-miR-134, bta-miR-1343-3p, bta-miR- 1343-5p, bta-miR-135a, bta-miR-135b, bta-miR-136, bta-miR-137, bta-miR-138, bta-miR- 1388-3p, bta-miR-1388-5p, bta-miR-139. bta-miR-140, bta-miR-141, bta-miR- 142-3p, bta-miR-142-5p, bta-miR-143, bta-miR-1434- 3p, bta-miR-1434-5p, bta-miR-144, bta-miR-145, bta-miR-1468, bta-miR-146a, bta-miR- 146b. bta-miR-147, bta-miR-148a, bta-miR-148b, bta-miR-148c, bta-miR-148d, bta-miR- 149-3p, bta-miR- 149-5p, bta-miR-150, bta-miR-151-3p, bta-miR-15 l-5p, bta-miR-152, bta- miR-153, bta-miR- 154a, bta-miR-154b, bta-miR-154c, bta-miR-155, bta-miR-1584-3p, bta-miR-1584-5p, bta-miR-15a, bta-miR-15b, bta-miR-1603, bta-miR-16a, bta-miR-16b. bta- miR-17-3p, bta-miR-17-5p, bta-miR-1721, bta-miR-1777a, bta-miR-1777b, bta-miR-1814a, bta-miR-1814b, bta-miR-1814c, bta-miR-181a, bta-miR-181b, bta-miR-181c, bta-miR-181d, bta-miR-182, bta-miR-183, bta-miR-1835, bta-miR-1839, bta-miR-184, bta-miR-1842, bta- miR-1843, bta-miR-185, bta-miR-186, bta-miR-187, bta-miR-188, bta-miR-18a, bta-miR- 18b, bla-miR-190a, bta-miR-190b, bta-miR-191, bta-miR-1911, bta-miR-191b, bta-miR-192, bta-miR-193a, bta-miR-193a-3p, bta-miR-193a-5p, bta-miR-193b, bta-miR-194. bta-miR- 1949, bta-miR-194b, bta-miR-194b-3p, bta-miR-195, bta-miR-196a, bta-miR-196b, bta-miR- 197, bta-miR-199a-3p, bta-miR-199a-5p, bta-miR-199b, bta-miR-199c, bta-miR-19a, bta- miR-19b, bta-miR-200a, bta-miR-200b, bta-miR-200c, bta-miR-202, bta-miR-204. bta-miR- 205, bta-miR-206, bta-miR-208a, bta-miR-208b, bta-miR-20a, bta-miR-20b, bta-miR-21-3p, bta-miR-21-5p, bta-miR-210, bta-miR-211, bta-miR-212, bta-miR-214, bta-miR-215, bta- miR-216a, bta-miR-216b, bta-miR-217, bta-miR-218, bta-miR-219, bta-miR-219-3p, bta- miR-219-5p, bta-miR-219b-3p, bta-miR-22-3p, bta-miR-22-5p, bta-miR-221, bta-miR-222, bta-miR-223, bta-miR-224, bta-miR-2284a, bta-miR-2284aa, bta-miR-2284ab, bta-miR- 2284ac, bta-miR-2284b. bta-miR-2284c, bta-miR-2284d. bta-miR-2284e, bta-miR-2284f, bta-miR-2284g, bta-miR-2284h-3p, bta-miR-2284h-5p, bta-miR-2284i, bta-miR-2284j, bta- miR-2284k, bta-miR-22841, bta-miR-2284m, bta-miR-2284n, bta-miR-2284o, bta-miR- 2284p, bta-miR-2284q, bta-miR-2284r, bta-miR-2284s, bta-miR-2284t-3p, bta-miR-2284t- 5p, bta-miR-2284u, bta-miR-2284v. bta-miR-2284w, bta-miR-2284x, bta-miR-2284y, bta- miR-2284z, bta-miR-2285a, bta-miR-2285aa, bta-miR-2285ab, bta-miR-2285ac, bta-miR- 2285ad, bta-miR-2285ae, bta-miR-2285af, bta-miR-2285ag-3p, bta-miR-2285ah-5p, bta- miR-2285ai-5p, bta-miR-2285aj-5p, bta-miR-2285ak-5p, bta-miR-2285al-5p, bta-miR- 2285am-5p, bta-miR-2285an, bta-miR-2285ao, bta-miR-2285ap, bta-miR-2285aq, bta-miR- 2285ar, bta-miR-2285as, bta-miR-2285at, bta-miR-2285au, bta-miR-2285av, bta-miR- 2285aw, bta-miR-2285ax, bta-miR-2285ay, bta-miR-2285az, bta-miR-2285b, bta-miR- 2285ba, bta-miR-2285bb, bta-miR-2285bc, bta-miR-2285bd, bta-miR-2285be, bta-miR- 2285bf, bta-miR-2285bg, bta-miR-2285bh, bta-miR-2285bi, bta-miR-2285bj, bta-miR- 2285bk, bta-miR-2285bl, bta-miR-2285bm, bta-miR-2285bn. bta-miR-2285bo, bta-miR- 2285bp, bta-miR-2285bq, bta-miR-2285br, bta-miR-2285bs, bta-miR-2285bt, bta-miR- 2285bu, bta-miR-2285bv, bta-miR-2285bw, bta-miR-2285bx, bta-miR-2285by, bta-miR- 2285bz, bta-miR-2285c, bta-miR-2285ca, bta-miR-2285cb, bta-miR-2285cc, bta-miR- 2285cd, bta-miR-2285ce, bta-miR-2285cf, bta-miR-2285cg, bta-miR-2285ch, bta-miR- 2285ci, bta-miR-2285cj, bta-miR-2285ck, bta-miR-2285cl, bta-miR-2285cm, bta-miR-2285cn, bta-miR-2285co, bta-miR-2285cp, bta-miR-2285cq, bta-miR-2285cr, bta-miR- 2285cs, bta-miR-2285ct. bta-miR-2285cu. bta-miR-2285cv, bta-miR-2285cw, bta-miR- 2285cx, bta-miR-2285cy, bta-miR-2285cz, bta-miR-2285d, bta-miR-2285da, bta-miR- 2285db, bta-miR-2285dc, bta-miR-2285dd, bta-miR-2285de, bta-miR-2285df, bta-miR- 2285dg, bta-miR-2285dh, bta-miR-2285di, bta-miR-2285dj, bta-miR-2285dk, bta-miR- 2285dl-3p, bta-miR-2285dm, bla-miR-2285e, bta-miR-2285f, bta-miR-2285g, bta-miR- 2285h, bta-miR-2285i. bta-miR-2285j, bta-miR-2285k. bta-miR-22851. bta-miR-2285m. bta- miR-2285n, bta-miR-2285o, bta-miR-2285p, bta-miR-2285q, bta-miR-2285r, bta-miR-2285s, bta-miR-2285t, bta-miR-2285u, bta-miR-2285v, bta-miR-2285w, bta-miR-2285x, bta-miR- 2285y, bta-miR-2285z, bta-miR-2286, bta-miR-2287, bta-miR-2288, bta-miR-2289, bta-miR- 2290. bta-miR-2291. bta-miR-2292. bta-miR-2293, bta-miR-2294, bta-miR-2295, bta-miR- 2296, bta-miR-2297, bta-miR-2298, bta-miR-2299-3p, bta-miR-2299-5p, bta-miR-2300a-5p, bta-miR-2300b-3p, bta-miR-2301, bta-miR-2302, bta-miR-2303, bta-miR-2304, bta-miR- 2305, bta-miR-2306, bta-miR-2307, bta-miR-2308, bta-miR-2309, bta-miR-2310, bta-miR- 2311, bta-miR-2312. bta-miR-2313-3p, bta-miR-2313-5p, bta-miR-2314. bta-miR-2315, bta- miR-2316. bta-miR-2317, bta-miR-2318, bta-miR-2319a. bta-miR-2319b, bta-miR-2320-3p. bta-miR-2320-5p, bta-miR-2321, bta-miR-2322-3p, bta-miR-2322-5p, bta-miR-2323, bta- miR-2324, bta-miR-2325a, bta-miR-2325b, bta-miR-2325c, bta-miR-2326, bta-miR-2327, bta-miR-2328-3p, bta-miR-2328-5p. bta-miR-2329-3p, bta-miR-2329-5p, bta-miR-2330-3p, bta-miR-2330-5p, bta-miR-2331-3p. bta-miR-233 l-5p, bta-miR-2332, bta-miR-2333, bta- miR-2334, bta-miR-2335, bta-miR-2336, bta-miR-2337, bta-miR-2338, bta-miR-2339, bta- miR-2340, bta-miR-2341, bta-miR-2342, bta-miR-2343, bta-miR-2344, bta-miR-2345, bta- miR-2346, bta-miR-2347, bta-miR-2348, bta-miR-2349, bta-miR-2350, bta-miR-2351, bta- miR-2352, bta-miR-2353, bta-miR-2354, bta-miR-2355-3p, bta-miR-2355 -5p, bta-miR-2356, bta-miR-2357, bta-miR-2358, bta-miR-2359, bta-miR-2360, bta-miR-2361, bta-miR-2362, bta-miR-2363, bta-miR-2364, bta-miR-2365, bta-miR-2366, bta-miR-2367-3p, bta-miR- 2367-5p, bta-miR-2368-3p, bta-miR-2368-5p, bta-miR-2369, bta-miR-2370-3p, bta-miR- 2370-5p, bta-miR-2371, bta-miR-2372, bta-miR-2373 -3 p, bta-miR-2373-5p, bta-miR-2374, bta-miR-2375, bta-miR-2376, bta-miR-2377, bta-miR-2378, bta-miR-2379, bta-miR-2380, bta-miR-2381, bta-miR-2382-3p, bta-miR-2382-5p, bta-miR-2383, bta-miR-2384, bta-miR- 2385-3p, bta-miR-2385-5p, bta-miR-2386, bta-miR-2387, bta-miR-2388-3p, bta-miR-2388- 5p, bta-miR-2389, bta-miR-2390, bta-miR-2392, bta-miR-2393, bta-miR-2394, bta-miR- 2395, bta-miR-2396. bta-miR-2397-3p, bta-miR-2397-5p, bta-miR-2398. bta-miR-2399-3p, bta-miR-2399-5p, bta-miR-23a, bta-miR-23b-3p, bta-miR-23b-5p, bta-miR-24, bta-miR-24-3p, bta-miR-2400, bta-miR-2401, bta-miR-2402, bta-miR-2403, bta-miR-2404, bta-miR- 2405. bta-miR-2406. bta-miR-2407, bta-miR-2408, bta-miR-2409, bta-miR-2410, bta-miR- 241 l-3p, bta-miR-2411-5p, bta-miR-2412, bta-miR-2413, bta-miR-2414, bta-miR-2415-3p, bta-miR-2415-5p, bta-miR-2416, bta-miR-2417, bta-miR-2418, bta-miR-2419-3p, bta-miR- 2419-5p, bta-miR-2420, bta-miR-2421, bta-miR-2422, bta-miR-2423, bta-miR-2424, bta- miR-2425-3p, bta-miR-2425-5p. bta-miR-2426, bta-miR-2427, bta-miR-2428, bta-miR-2429, bta-miR-2430, bta-miR-2431-3p, bta-miR-2431-5p. bta-miR-2432. bta-miR-2433, bta-miR- 2434, bta-miR-2435, bta-miR-2436-3p, bta-miR-2436-5p, bta-miR-2437, bta-miR-2438, bta- miR-2439-3p, bta-miR-2439-5p, bta-miR-2440, bta-miR-2441, bta-miR-2442, bta-miR-2443, bta-miR-2444, bta-miR-2446, bta-miR-2447, bta-miR-2448-3p. bta-miR-2448-5p, bta-miR- 2449, bta-miR- 2450a, bta-miR-2450b. bta-miR-2450c, bta-miR-2450d. bta-miR-2451. bta- miR-2452, bta-miR-2453, bta-miR-2454-3p, bta-miR-2454-5p, bta-miR-2455, bta-miR-2456, bta-miR-2457, bta-miR-2458, bta-miR-2459, bta-miR-2460, bta-miR-2461-3p, bta-miR- 2461 -5p, bta-miR-2462, bta-miR-2463, bta-miR-2464-3p, bta-miR-2464-5p, bta-miR-2465, bta-miR-2466-3p, bta-miR-2466-5p. bta-miR-2467-3p, bta-miR-2467-5p, bta-miR-2468, bta- miR-2469. bta-miR-2470, bta-miR-2471-3p, bta-miR-2471-5p. bta-miR-2472, bta-miR-2473, bta-miR-2474, bta-miR-2475, bta-miR-2477, bta-miR-2478, bta-miR-2479, bta-miR-2480, bta-miR-2481, bta-miR-2482, bta-miR-2483-3p, bta-miR-2483-5p, bta-miR-2484, bta-miR- 2485, bta-miR-2486-3p, bta-miR-2486-5p, bta-miR-2488, bta-miR-2489, bta-miR-25, bta- miR-26a. bta-miR-26b, bta-miR-26c, bta-miR-27a-3p, bta-miR-27a-5p, bta-miR-27b, bta- miR-28, bta-miR-2881, bta-miR-2882, bta-miR-2883, bta-miR-2885, bta-miR-2886, bta- miR-2887, bta-miR-2888, bta-miR-2889, bta-miR-2890, bta-miR-2891, bta-miR-2892, bta- miR-2893, bta-miR-2894, bta-miR-2895, bta-miR-2896, bta-miR-2897, bta-miR-2898, bta- miR-2899, bta-miR-2900, bta-miR-2901, bta-miR-2902, bta-miR-2903, bta-miR-2904, bta- miR-2917, bta-miR-296-3p, bta-miR-296-5p, bta-miR-299, bta-miR-299-2, bta-miR-29a, bta- miR-29b, bta-miR-29c, bta-miR-29d-3p, bta-miR-29d-5p, bta-miR-29e, bta-miR-301a, bta- miR-301b, bta-miR-302a, bta-miR-302b, bta-miR-302c, bta-miR-302d, bta-miR-3064, bta- miR-3065, bta-miR-30a-5p, bta-miR-30b-3p, bta-miR-30b-5p, bta-miR-30c, bta-miR-30d, bta-miR-30e-5p, bta-miR-30f, bta-miR-31, bta-miR-3120, bta-miR-3141, bta-miR-3154. bta- miR-32, bta-miR-320a, bta-miR-320b, bta-miR-323, bta-miR-323b-3p, bta-miR-324, bta- miR-326, bta-miR-328, bta-miR-329a, bta-miR-329b, bta-miR-330, bta-miR-331-3p, bta- miR-331-5p, bta-miR-335, bta-miR-338, bta-miR-339a. bta-miR-339b, bta-miR-33a, bta- miR-33b, bta-miR-340, bta-miR-342, bta-miR-3431 , bta-miR-3432a, bta-miR-3432b, bta- miR-345-3p, bta-miR-345-5p, bta-miR-346, bta-miR-34a, bta-miR-34b, bta-miR-34c, bta-miR-3533, bta-miR-3578, bta-miR-3596, bta-miR-3600, bta-miR-3601, bta-miR-3602, bta- miR-3604, bta-miR-361. bta-miR-3613a, bta-miR-3613b. bta-miR-362-3p, bta-miR-362-5p, bta-miR-363, bta-miR-365-3p, bta-miR-365-5p, bta-miR-3660, bta-miR-367, bta-miR-369- 3p, bta-miR-369-5p, bta-miR-370, bta-miR-371, bta-miR-374a, bta-miR-374b, bta-miR- 374c, bta-miR-375, bta-miR-376a, bta-miR-376b, bta-miR-376c, bta-miR-376d, bta-miR- 376e. bta-miR-377, bta-miR-378, bta-miR-378b, bla-miR-378c, bta-miR-378d. bta-miR-379, bta-miR-380-3p. bta-miR-380-5p, bta-miR-381. bta-miR-382, bta-miR-383, bta-miR-3956, bta-miR-3957, bta-miR-409a, bta-miR-409b, bta-miR-410, bta-miR-41 la, bta-miR-41 lb, bta- miR-411c-3p, bta-miR-41 lc-5p, bta-miR-412, bta-miR-421, bta-miR-423-3p, bta-miR-423- 5p, bta-miR-424-3p, bta-miR-424-5p, bta-miR-425-3p, bta-miR-425-5p, bta-miR-4286, bta- miR-429, bta-miR-431, bta-miR-432, bta-miR-433, bta-miR-4444, bta-miR-4449, bta-miR- 448, bta-miR-449a, bta-miR-449b, bta-miR-449c, bta-miR-449d, bta-miR-450a, bta-miR- 450b, bta-miR-451, bta-miR-452, bta-miR-4523, bta-miR-453, bta-miR-454, bta-miR-455- 3p, bta-miR-455-5p, bta-miR-4657, bta-miR-4680, bta-miR-483, bta-miR-484, bta-miR-485, bta-miR-486, bta-miR-487a, bta-miR-487b, bta-miR-488. bta-miR-489, bta-miR-490, bta- miR-491, bta-miR-493, bta-miR-494, bta-miR-495. bta-miR-496. bta-miR-497, bta-miR-499, bta-miR-500, bta-miR-502a, bta-miR-502b, bta-miR-503-3p, bta-miR-503-5p, bta-miR-504, bta-miR-505, bta-miR-507-3p, bta-miR-507b, bta-miR-532, bta-miR-539, bta-miR-541, bta- miR-542-5p, bta-miR-543. bta-miR-544a, bta-miR-544b, bta-miR-545-3p, bta-miR-545-5p, bta-miR-551a, bta-miR-551b, bta-miR-562, bta-miR-568. bta-miR-574, bta-miR-582, bta- miR-584, bta-miR-592, bta-miR-599, bta-miR-6119-3p, bta-miR-6119-5p, bta-miR-6120-3p, bta-miR-6120-5p, bta-miR-6121-3p, bta-miR-6121-5p, bta-miR-6122-3p, bta-miR-6122-5p, bta-miR-6123, bta-miR-615, bta-miR-628, bta-miR-631, bta-miR-6501, bta-miR-6516, bta- miR-6 17, bta-miR-6518, bta-miR-6519, bta-miR-652, bta-miR-6520, bta-miR-6521, bta- miR-6522, bta-miR-6523a, bta-miR-6523b, bta-miR-6524, bta-miR-6525, bta-miR-6526, bta- miR-6527, bta-miR-6528, bta-miR-6529a, bta-miR-6529b, bta-miR-653, bta-miR-6530, bta- miR-6531, bta-miR-6532, bta-miR-6533, bta-miR-6534, bta-miR-6535, bta-miR-6536, bta- miR-654, bta-miR-655, bta-miR-656, bta-miR-658, bta-miR-660. bta-miR-664a, bta-miR- 664b, bta-miR-665, bta-miR-668-3p, bta-miR-669, bta-miR-670, bta-miR-671. bta-miR- 6715, bta-miR-677, bta-miR-6775, bta-miR-7, bta-miR-708, bta-miR-7180, bta-miR-744, bta-miR-758, bta-miR-759, bta-miR-760-3p, bta-miR-760-5p, bta-miR-761, bta-miR-763, bta-miR-764, bta-miR-767, bta-miR-769, bta-miR-7691, bta-miR-7857-3p, bta-miR-7857-5p, bta-miR-7858, bta-miR-7859, bta-miR-7860, bta-miR-7861, bta-miR-7862, bta-miR-7863, bta-miR-7864, bta-miR-7865, bta-miR-8548, bta-miR-8549, bta-miR-8550, bta-miR-873,bta-miR-874. bta-miR-875, bta-miR-876, bta-miR-877, bta-miR-885, bta-miR-9-3p, bta-miR- 9-5p, bta-miR-92a. bta-miR-92b, bta-miR-93, bta-miR-935. bta-miR-940, bta-miR-95. bta- miR-96, bta-miR-98, bta-miR-9851, bta-miR-99a-3p, bta-miR-99a-5p, bta-miR-99b, cas- miR11592, cas-miR156a, cas-miR156b-3p, cas-miR156b-5p, cas-miR156c-3p, cas-miR156c- 5p, cas-miR156d-3p, cas-miR156d-5p, cas-miR156e-3p, cas-miR156e-5p, cas-miR156f-3p, cas-miR156f-5p, cas-miR156g, cas-miR156h, cas-miR156i, cas-miR156j, cas-miR156k-3p, cas-miR156k-5p, cas-miR157a, cas-miR157b. cas-miR157c, cas-miR157d. cas-miR158a, cas-miR158b, cas-miR159a, cas-miR159b-3p, cas-miR159b-5p, cas-miR159c-3p, cas- miR159c-5, cas-miR160a, cas-miR160b-3p, cas-miR160b-5p, cas-miR161, cas-miR162a, cas-miR162b, cas-miR164, cas-miR165a, cas-miR165b, cas-miR166a, cas-miR166b, cas- miR166c-3p. cas-miR166c-5p, cas-miR166d, cas-miR166e, cas-miR166f-3p, cas-miR166f- 5p, cas-miR167a, cas-miR167b, cas-miR167c, cas-miR168, cas-miR169a, cas-miR169b, cas- miR169c, cas-miR169d, cas-miR169e-3p, cas-miR169e-5p, cas-miR169f, cas-miR169g-3p, cas-miR169g-5p, cas-miR170, cas-miR171a-3p, cas-miR171a-5p, cas-miR171b, cas- miR171c-3p. cas-miR171c-5p, cas-miR172a-3p, cas-miRl 72a-5p, cas-miR172b. cas- miR172c, cas-miR172d. cas-miR173, cas-miR2111a. cas-miR2111b. cas-miR319a, cas- miR319b, cas-miR319c, cas-miR3435, cas-miR390a-3p, cas-miR390a-5p, cas-miR390b, cas- miR393-3p, cas-miR393-5p, cas-miR394, cas-miR395a, cas-miR395b, cas-miR395c-3p, cas- miR395c-5p, cas-miR395d-3p, cas-miR395d-5p, cas-miR396a, cas-miR396b, cas-miR397, cas-miR398a-3p. cas-miR398a-5p, cas-miR398b, cas-miR399a, cas-miR399b, cas-miR400, cas-miR403, cas-miR408, cas-miR472, cas-miR5139, cas-miR8171, cas-miR825, cas- miR827a, cas-miR827b, cas-miR828, cas-miR845, cas-miR857, cas-miR858, cas-miR860, cas-miR9560, cbn-let-7, cbn4in-4, cbn-miR-1, cbn-miR-124, cbn-miR-1822, cbn-miR- 1824a, cbn-miR-1824b, cbn-miR-2, cbn-miR-228, cbn-miR-230, cbn-miR-231, cbn-miR- 232, cbn-miR-233, cbn-miR-234, cbn-miR-235, cbn-miR-236, cbn-miR-237, cbn-miR-238, cbn-miR-239a, cbn-miR-239b, cbn-miR-239c, cbn-miR-239d, cbn-miR-241, cbn-miR-242, cbn-miR-244, cbn-miR-245, cbn-miR-246, cbn-miR-248, cbn-miR-249, cbn-miR-250, cbn- miR-251a, cbn-miR-251b, cbn-miR-254, cbn-miR-255, cbn-miR-259, cbn-miR-34, cbn-miR- 355, cbn-miR-356. cbn-miR-357, cbn-miR-359. cbn-miR-35a, cbn-miR-35b. cbn-miR-35c, cbn-miR-35d, cbn-miR-35e, cbn-miR-35f, cbn-miR-35g, cbn-miR-35h, cbn-miR-35i, cbn- miR-35j, cbn-miR-35k, cbn-miR-351, cbn-miR-35m, cbn-miR-35n, cbn-miR-36, cbn-miR- 360, cbn-miR-38, cbn-miR-39, cbn-miR-43, cbn-miR-44, cbn-miR-46, cbn-miR-47, cbn- miR-48, cbn-miR-49, cbn-miR-50, cbn-miR-51. cbn-miR-52. cbn-miR-54, cbn-miR-55, cbn- miR-56, cbn-miR-57, cbn-miR-58a, cbn-miR-58b, cbn-miR-59, cbn-miR-60, cbn-miR-61,cbn-miR-62, cbn-miR-63, cbn-miR-64a. cbn-miR-64b, cbn-miR-64c, cbn-miR-64d, cbn- miR-64e. cbn-miR-64f, cbn-miR-64g, cbn-miR-64h, cbn-miR-64i, cbn-miR-64j, cbn-miR- 64k, cbn-miR-641, cbn-miR-64m, cbn-miR-67, cbn-miR-70, cbn-miR-72a, cbn-miR-72b, cbn-miR-73a, cbn-miR-73b, cbn-miR-74a, cbn-miR-74b, cbn-miR-74c, cbn-miR-74d, cbn- miR-75, cbn-miR-7579, cbn-miR-7597, cbn-miR-76, cbn-miR-7614, cbn-miR-7615, cbn- miR-7616, cbn-miR-7617, cbn-miR-7618. cbn-miR-7619, cbn-miR-7620a, cbn-miR-7620b, cbn-miR-7621a, cbn-miR-7621b, cbn-miR-7622, cbn-miR-7623, cbn-miR-7624. cbn-miR- 7625, cbn-miR-7626, cbn-miR-7627, cbn-miR-7628, cbn-miR-7629, cbn-miR-7630, cbn- miR-7631, cbn-miR-7632, cbn-miR-7633, cbn-miR-7634, cbn-miR-7635, cbn-miR-7636, cbn-miR-7637, cbn-miR-7638, cbn-miR-7639, cbn-miR-7640, cbn-miR-7690, cbn-miR-77, cbn-miR-784, cbn-miR-785. cbn-miR-787, cbn-miR-789a, cbn-miR-789b, cbn-miR-79, cbn- miR-790, cbn-miR-80, cbn-miR-81, cbn-miR-82, cbn-miR-83, cbn-miR-84, cbn-miR-85, cbn-miR-86, cbn-miR-87, cbn-miR-90, cbr-let-7, cbr-lin-4, cbr-lsy-6, cbr-miR-1, cbr-miR- 124a, cbr-miR-124b, cbr-miR-124c, cbr-miR-1817, cbr-miR-1822, cbr-miR-2, cbr-miR- 2222, cbr-miR-2223. cbr-miR-2224. cbr-miR-2225-3p, cbr-miR-2225-5p, cbr-miR-2226-3p. cbr-miR-2226-5p, cbr-miR-2227, cbr-miR-2231 , cbr-miR-228, cbr-miR-230. cbr-miR-231, cbr-miR-232, cbr-miR-233, cbr-miR-234, cbr-miR-235a, cbr-miR-235b-3p, cbr-miR-235b- 5p, cbr-miR-236, cbr-miR-237-3p, cbr-miR-237-5p, cbr-miR-238, cbr-miR-239a, cbr-miR- 239b, cbr-miR-240, cbr-miR-241, cbr-miR-242, cbr-miR-244, cbr-miR-245, cbr-miR-246, cbr-miR-247, cbr-miR-248, cbr-miR-249, cbr-miR-250, cbr-miR-251, cbr-miR-252, cbr- miR-253, cbr-miR-254, cbr-miR-255, cbr-miR-259, cbr-miR-268, cbr-miR-34, cbr-miR-354, cbr-miR-355, cbr-miR-356, cbr-miR-357, cbr-miR-358, cbr-miR-359, cbr-miR-35a, cbr-miR- 35b, cbr-miR-35c, cbr-miR-35d-3p, cbr-miR-35d-5p, cbr-miR-35e, cbr-miR-35f, cbr-miR- 35g, cbr-miR-36, cbr-miR-360, cbr-miR-38. cbr-miR-39, cbr-miR-392. cbr-miR-40, cbr- miR-41a, cbr-miR-41b, cbr-miR-42, cbr-miR-43, cbr-miR-44, cbr-miR-45, cbr-miR-46, cbr- miR-47, cbr-miR-48, cbr-miR-4813, cbr-miR-49, cbr-miR-50, cbr-miR-51, cbr-miR-52, cbr- miR-54a-3p, cbr-miR-54a-5p, cbr-miR-54b, cbr-miR-54c, cbr-miR-54d, cbr-miR-55, cbr- miR-56-3p, cbr-miR-56-5p, cbr-miR-57, cbr-miR-58a, cbr-miR-58b, cbr-miR-60, cbr-miR- 61, cbr-miR-62, cbr-miR-64a, cbr-miR-64b. cbr-miR-64c, cbr-miR-65-3p, cbr-miR-65-5p. cbr-miR-67, cbr-miR-70, cbr-miR-71, cbr-miR-72, cbr-miR-73a, cbr-miR-73b, cbr-miR-74a, cbr-miR-74b-3p, cbr-miR-74b-5p, cbr-miR-75, cbr-miR-7579, cbr-miR-7580, cbr-miR-7581, cbr-miR-7582, cbr-miR-7583a-3p, cbr-miR-7583 a-5p, cbr-miR-7583b, cbr-miR-7583 c-3p, cbr-miR-7583c-5p. cbr-miR-7583d, cbr-miR-7584, cbr-miR-7585, cbr-miR-7586, cbr-miR- 7587, cbr-miR-7588, cbr-miR-7589, cbr-miR-7590, cbr-miR-7591, cbr-miR-7592, cbr-miR-7593. cbr-miR-7594a, cbr-miR-7594b, cbr-miR-7595, cbr-miR-7596. cbr-miR-76, cbr-miR- 77, cbr-miR-784, cbr-miR-785a. cbr-miR-785b. cbr-miR-786, cbr-miR-787, cbr-miR-788, cbr-miR-789, cbr-miR-79, cbr-miR-790, cbr-miR-791, cbr-miR-792, cbr-miR-80, cbr-miR- 81, cbr-miR-82, cbr-miR-83, cbr-miR-84, cbr-miR-85, cbr-miR-86, cbr-miR-87, cbr-miR- 90a, cbr-miR-90b-3p, cbr-miR-90b-5p, cca-miR156a, cca-miR156b, cca-miR156c, cca- miR160a, cca-miR160b, cca-miR164, cca-miR167, cca-miR168a, cca-miR169a, cca- miR169b, cca-miR171, cca-miR172, cca-miR319, cca-miR390. cca-miR393. cca-miR394. cca-miR395a, cca-miR395b, cca-miR395c, cca-miR396a-3p, cca-miR396a-5p, cca-miR396b, cca-miR396c, cca-miR398, cca-miR399, cca-miR408, cca-miR6103-3p, cca-miR6103-5p, cca-miR6104, cca-miR6105a, cca-miR6105b, cca-miR6106-3p, cca-miR6106-5p, cca- miR6107, cca-miR6108a, cca-miR6108b, cca-miR6108c. cca-miR6108d, cca-miR6108e-3p. cca-miR6108e-5p, cca-miR6108f, cca-miR6108g, cca-miR6109, cca-miR6110-3p, cca- miR6110-5p, cca-miR6111-3p, cca-miR6111-5p, cca-miR6112, cca-miR6113, cca-miR6114- 3p, cca-miR6114-5p, cca-miR6115, cca-miR6116-3p, cca-miR6116-5p, cca-miR6117, cca- miR6118-3p. cca-miR6118-5p, ccl-miR167a, ccl-miR167b. ccl-miR168, ccl-miR171, ccl- miR396, ccr-let-7a, ccr-let-7b. ccr4et-7g, ccr-let-7i. ccr4et-7j, ccr-miR-1, ccr-miR-100, ccr- miR-lOla, ccr-miR-lOlb, ccr-miR-103, ccr-miR-107, ccr-miR-lOb, ccr-miR-lOc, ccr-miR- lOd, ccr-miR-122, ccr-miR-124a, ccr-miR-124b, ccr-miR-125b, ccr-miR-125c, ccr-miR-126- 3p, ccr-miR-126-5p, ccr-miR-128, ccr-miR-129, ccr-miR-130a, ccr-miR-130b, ccr-miR- 130c. ccr-miR-132a, ccr-miR-132b, ccr-miR-133a-3p, ccr-miR-133a-5p, ccr-miR-135c, ccr- miR-137, ccr-miR-138, ccr-miR-139, ccr-miR-140-3p, ccr-miR-140-5p, ccr-miR-142-3p, ccr-miR-142-5p, ccr-miR-143, ccr-miR-144, ccr-miR-146a, ccr-miR-148, ccr-miR-153b, ccr- miR-153c, ccr-miR-155, ccr-miR-15a, ccr-miR-15b, ccr-miR-16a, ccr-miR-16b, ccr-miR- 16c, ccr-miR-17-3p, ccr-miR-17-5p. ccr-miR-181a, ccr-miR-181b, ccr-miR-181c, ccr-miR- 182-3p, ccr-miR-182-5p, ccr-miR-183, ccr-miR-184, ccr-miR-187, ccr-miR-18a, ccr-miR- 18b, ccr-miR-18c, ccr-miR-190, ccr-miR-192, ccr-miR-193a, ccr-miR-194, ccr-miR-196a, ccr-miR-196b, ccr-miR-199-3p, ccr-miR-199-5p, ccr-miR-19d, ccr-miR-200a, ccr-miR-200b, ccr-miR-203a, ccr-miR-203b-3p, ccr-miR-203b-5p, ccr-miR-205, ccr-miR-206, ccr-miR-20a- 3p, ccr-miR-20a-5p, ccr-miR-21, ccr-miR-210, ccr-miR-214, ccr-miR-217. ccr-miR-218a, ccr-miR-218b, ccr-miR-2192, ccr-miR-221, ccr-miR-222, ccr-miR-22a, ccr-miR-22b, ccr- miR-23a, ccr-miR-23b, ccr-miR-24, ccr-miR-25, ccr-miR-26a, ccr-miR-27a, ccr-miR-27c-3p, ccr-miR-27c-5p, ccr-miR-27d, ccr-miR-29a, ccr-miR-29b, ccr-miR-301a, ccr-miR-30b, ccr- miR-30d, ccr-miR-338, ccr-miR-34, ccr-miR-363, ccr-miR-365, ccr-miR-375, ccr-miR-429, ccr-miR-430, ccr-miR-454a, ccr-miR-454b, ccr-miR-455, ccr-miR-457a, ccr-miR-457b, ccr-miR-459-3p, ccr-miR-459-5p, ccr-miR-460-3p, ccr-miR-460-5p, ccr-miR-489, ccr-miR-499, ccr-miR-551. ccr-miR-7132. ccr-miR-7133, ccr-miR-722, ccr-miR-724, ccr-miR-725, ccr- miR-726, ccr-miR-727-3p, ccr-miR-727-5p, ccr-miR-729, ccr-miR-730, ccr-miR-734, ccr- miR-738, ccr-miR-7a, ccr-miR-7b, ccr-miR-9-3p, ccr-miR-9-5p, ccr-miR-92a, ccr-miR-92b, ccr-miR-93, ccr-miR-96, ccr-miR-99, cel-let-7-3p, cel-let-7-5p, cel-lin-4-3p, cel4in-4-5p, cel- lsy-6-3p, cel-lsy-6-5p, cel-miR-l-3p, cel-miR-l-5p, cel-miR-1018, cel-miR-1019-3p, cel- miR-1019-5p, cel-miR-1020-3p. cel-miR-1020-5p, cel-miR-1021, cel-miR-1022-3p. cel- miR-1022-5p, cel-miR-12134, cel-miR-124-3p, cel-miR-124-5p, cel-miR-1817, cel-miR- 1818. cel-miR-1819-3p, cel-miR-1819-5p, cel-miR-1820-3p, cel-miR-1820-5p, cel-miR- 1821-3p, cel-miR-1821-5p, cel-miR-1822-3p, cel-miR-1822-5p, cel-miR-1823-3p, cel-miR- 1823-5p, cel-miR-1824-3p, cel-miR-1824-5p, cel-miR-1828, cel-miR-1829a-3p, cel-miR- 1829a-5p, cel-miR-1829b-3p, cel-miR-1829b-5p, cel-miR-1829c-3p, cel-miR-1829c-5p, cel- miR-1830-3p, cel-miR-1830-5p, cel-miR-1832a-3p, cel-miR-1832a-5p, cel-miR-1832b-3p, cel-miR-1832b-5p, cel-miR-1833, cel-miR-2-3p, cel-miR-2-5p, cel-miR-2207-3p, cel-miR- 2207-5p, cel-miR-2208a-3p, cel-miR-2208a-5p. cel-miR-2208b-3p, cel-miR-2208b-5p, cel- miR-2209a-3p. cel-miR-2209a-5p, cel-miR-2209b-3p, cel-miR-2209b-5p, cel-miR-2209c-3p, cel-miR-2209c-5p, cel-miR-2210-3p, cel-miR-2210-5p, cel-miR-221 l-3p, cel-miR-221 l-5p, cel-miR-2212-3p, cel-miR-2212-5p, cel-miR-2213-3p, cel-miR-2213-5p, cel-miR-2215-3p, cel-miR-2215 -5p, cel-miR-2216-3p, cel-miR-2216-5p, cel-miR-2217a-3p, cel-miR-2217a-5p, cel-miR-2217b- l-5p, cel-miR-2217b-3p, cel-miR-2217b-5p, cel-miR-2218a-3p, cel-miR- 2218a-5p, cel-miR-2218b-3p, cel-miR-2218b-5p, cel-miR-2219-3p, cel-miR-2219-5p, cel- miR-2220-3p, cel-miR-2220-5p, cel-miR-2221, cel-miR-228-3p, cel-miR-228-5p, cel-miR- 229-3p, cel-miR-229-5p, cel-miR-230-3p, cel-miR-230-5p, cel-miR-231-3p, cel-miR-231-5p, cel-miR-232-3p, cel-miR-232-5p, cel-miR-233-3p, cel-miR-233-5p, cel-miR-234-3p, cel- miR-234-5p, cel-miR-235-3p, cel-miR-235-5p, cel-miR-236-3p, cel-miR-236-5p, cel-miR- 237-3p, cel-miR-237-5p, cel-miR-238-3p, cel-miR-238-5p, cel-miR-239a-3p, cel-miR-239a- 5p, cel-miR-239b-3p, cel-miR-239b-5p, cel-miR-240-3p, cel-miR-240-5p, cel-miR-241-3p, cel-miR-241-5p, cel-miR-242, cel-miR-243-3p, cel-miR-243-5p, cel-miR-244-3p, cel-miR- 244-5p, cel-miR-245-3p. cel-miR-245-5p. cel-miR-246-3p, cel-miR-246-5p, cel-miR-247-3p, cel-miR-247-5p, cel-miR-248, cel-miR-249-3p, cel-miR-249-5p, cel-miR-250-3p, cel-miR- 250-5p, cel-miR-251, cel-miR-252-3p, cel-miR-252-5p, cel-miR-253-3p, cel-miR-253-5p, cel-miR-254-3p, cel-miR-254-5p, cel-miR-255-3p, cel-miR-255-5p, cel-miR-256, cel-miR- 259-3p, cel-miR-259-5p. cel-miR-261, cel-miR-264, cel-miR-265, cel-miR-266, cel-miR- 267, cel-miR-268, cel-miR-269, cel-miR-270, cel-miR-271, cel-miR-272, cel-miR-273, cel-miR-2953-3p, cel-miR-2953-5p, cel-miR-34-3p, cel-miR-34-5p, cel-miR-35-3p, cel-miR-35- 5p, cel-miR-354-3p, cel-miR-354-5p, cel-miR-355-3p, cel-miR-355-5p, cel-miR-356a. cel- miR-356b-3p, cel-miR-356b-5p, cel-miR-357-3p, cel-miR-357-5p, cel-miR-358-3p, cel-miR- 358-5p, cel-miR-359, cel-miR-36-3p, cel-miR-36-5p, cel-miR-360-3p, cel-miR-360-5p, cel- miR-37-3p, cel-miR-37-5p, cel-miR-38-3p, cel-miR-38-5p, cel-miR-39-3p, cel-miR-39-5p, cel-miR-392-3p, cel-miR-392-5p, cel-miR-40-3p, cel-miR-40-5p, cel-miR-41-3p, cel-miR- 41-5p, cel-miR-42-3p, cel-miR-42-5p. cel-miR-43-3p, cel-miR-43-5p, cel-miR-44-3p, cel- miR-44-5p, cel-miR-45-3p, cel-miR-45-5p, cel-miR-46-3p, cel-miR-46-5p, cel-miR-47-3p, cel-miR-47-5p, cel-miR-48-3p, cel-miR-48-5p, cel-miR-4805-3p, cel-miR-4805-5p, cel-miR- 4806-3p, cel-miR-4806-5p, cel-miR-4807, cel-miR-4808-3p, cel-miR-4808-5p, cel-miR- 4809-3p, cel-miR-4809-5p, cel-miR-4810a, cel-miR-4810b-3p, cel-miR-4810b-5p. cel-miR- 481 l-3p, cel-miR-4811-5p, cel-miR-4812-3p, cel-miR-4812-5p, cel-miR-4813-3p, cel-miR- 4813-5p, cel-miR-4814-3p, cel-miR-4814-5p, cel-miR-4815, cel-miR-4816-3p, cel-miR- 4816-5p, cel-miR-49-3p, cel-miR-49-5p, cel-miR-4920, cel-miR-4921, cel-miR-4922, cel- miR-4923a, cel-miR-4923b, cel-miR-4924, cel-miR-4925, cel-miR-4926, cel-miR-4927. cel- miR-4929. cel-miR-4930, cel-miR-4931, cel-miR-4932, cel-miR-4933. cel-miR-4934. cel- miR-4935, cel-miR-4936, cel-miR-4937, cel-miR-4938, cel-miR-50-3p, cel-miR-50-5p, cel- miR-51-3p, cel-miR-51-5p, cel-miR-52-3p, cel-miR-52-5p, cel-miR-53-3p, cel-miR-53-5p, cel-miR-54-3p, cel-miR-54-5p, cel-miR-55-3p, cel-miR-55-5p, cel-miR-5545-3p, cel-miR- 5545-5p, cel-miR-5546-3p, cel-miR-5546-5p, cel-miR-5547-3p, cel-miR-5547-5p. cel-miR- 5548-3p, cel-miR-5548-5p, cel-miR-5549-3p, cel-miR-5549-5p, cel-miR-5550-3p, cel-miR- 5550-5p, cel-miR-5551-3p, cel-miR-5551-5p, cel-miR-5552-3p, cel-miR-5552-5p, cel-miR- 5553-3p, cel-miR-5553-5p, cel-miR-5592-3p, cel-miR-5592-5p, cel-miR-5593-3p, cel-miR- 5593-5p, cel-miR-5594-3p, cel-miR-5594-5p, cel-miR-5595-3p, cel-miR-5595-5p, cel-miR- 55b, cel-miR-56-3p, cel-miR-56-5p, cel-miR-57-3p, cel-miR-57-5p, cel-miR-58a-3p, cel- miR-58a-5p, cel-miR-58b-3p, cel-miR-58b-5p, cel-miR-58c, cel-miR-59-3p, cel-miR-59-5p, cel-miR-60-3p, cel-miR-60-5p, cel-miR-61-3p, cel-miR-61-5p, cel-miR-62, cel-miR-63-3p, cel-miR-63-5p, cel-miR-64-3p, cel-miR-64-5p, cel-miR-65-3p, cel-miR-65-5p. cel-miR-66- 3p, cel-miR-66-5p. cel-miR-67-3p, cel-miR-67-5p, cel-miR-70-3p, cel-miR-70-5p. cel-miR- 71-3p, cel-miR-71-5p, cel-miR-72-3p, cel-miR-72-5p, cel-miR-73-3p, cel-miR-73-5p, cel- miR-74-3p, cel-miR-74-5p, cel-miR-75-3p, cel-miR-75-5p, cel-miR-76-3p, cel-miR-76-5p, cel-miR-77-3p, cel-miR-77-5p, cel-miR-78, cel-miR-784-3p, cel-miR-784-5p, cel-miR-785- 3p, cel-miR-785-5p, cel-miR-786-3p, cel-miR-786-5p, cel-miR-787-3p, cel-miR-787-5p, cel- miR-788-3p, cel-miR-788-5p, cel-miR-789-2-5p, cel-miR-789-3p, cel-miR-789-5p, cel-miR-79-3p, cel-miR-79-5p, cel-miR-790-3p, cel-miR-790-5p, cel-miR-791-3p, cel-miR-791-5p, cel-miR-792-3p, cel-miR-792-5p, cel-miR-793, cel-miR-794-3p, cel-miR-794-5p, cel-miR- 795-3p, cel-miR-795-5p, cel-miR-796, cel-miR-797-3p, cel-miR-797-5p, cel-miR-798, cel- miR-799, cel-miR-80-3p, cel-miR-80-5p, cel-miR-800-3p, cel-miR-800-5p, cel-miR-81-3p, cel-miR-81-5p, cel-miR-8186-3p, cel-miR-8186-5p, cel-miR-8187-3p, cel-miR-8187-5p, cel- miR-8188-3p, cel-miR-8188-5p, cel-miR-8189-3p, cel-miR-8189-5p. cel-miR-8190-3p, cel- miR-8190-5p, cel-miR-8191-3p. cel-miR-8191-5p, cel-miR-8192-3p. cel-miR-8192-5p, cel- miR-8193-3p, cel-miR-8193-5p, cel-miR-8194-3p, cel-miR-8194-5p, cel-miR-8195-3p, cel- miR-8195-5p, cel-miR-8196a-3p, cel-miR-8196a-5p, cel-miR-8196b-3p, cel-miR-8196b-5p, cel-miR-8197-3p, cel-miR-8197-5p, cel-miR-8198-3p, cel-miR-8198-5p, cel-miR-8199-3p, cel-miR-8199-5p, cel-miR-82-3p, cel-miR-82-5p, cel-miR-8200-3p, cel-miR-8200-5p. cel- miR-8201-3p, cel-miR-8201-5p, cel-miR-8202-3p, cel-miR-8202-5p, cel-miR-8203-3p, cel- miR-8203-5p, cel-miR-8204-3p, cel-miR-8204-5p, cel-miR-8205-3p, cel-miR-8205-5p, cel- miR-8206-3p, cel-miR-8206-5p, cel-miR-8207-3p, cel-miR-8207-5p, cel-miR-8208-3p, cel- miR-8208-5p, cel-miR-8209-3p. cel-miR-8209-5p, cel-miR-8210-3p. cel-miR-8210-5p, cel- miR-8211-3p, cel-miR-821 l-5p. cel-miR-8212-3p, cel-miR-8212-5p. cel-miR-83-3p, cel- miR-83-5p, cel-miR-84-3p, cel-miR-84-5p, cel-miR-85-3p, cel-miR-85-5p, cel-miR-86-3p, cel-miR-86-5p. cel-miR-87-3p, cel-miR-87-5p, cel-miR-90-3p, cel-miR-90-5p, cfa4et-7a, cfa4et-7b, cfa-let-7c. cfa-let-7d, cfa4et-7e, cfa-let-7f, cfa4et-7g, cfa4et-7j, cfa-miR-1, cfa- miR-101, cfa-miR-103, cfa-miR-105a, cfa-miR-105b. cfa-miR-106a, cfa-miR-106b, cfa-miR- 107, cfa-miR-lOa, cfa-miR-lOb, cfa-miR-1185, cfa-miR-1199-3p, cfa-miR-1199-5p, cfa- miR-122, cfa-miR-124, cfa-miR-1249, cfa-miR-125a, cfa-miR-125b, cfa-miR-126, cfa-miR- 127, cfa-miR-1271, cfa-miR-128, cfa-miR-129, cfa-miR-1296, cfa-miR-1301, cfa-miR-1306, cfa-miR-1307, cfa-miR-130a, cfa-miR-130b, cfa-miR-132, cfa-miR-133a, cfa-miR-133b, cfa- miR-133c, cfa-miR-134, cfa-miR-1343, cfa-miR-135a-3p, cfa-miR-135a-5p, cfa-miR-135b, cfa-miR-136, cfa-miR-137, cfa-miR-138a, cfa-miR-138b, cfa-miR-139, cfa-miR-140, cfa- miR-141, cfa-miR-142, cfa-miR-143, cfa-miR-144, cfa-miR-145, cfa-miR-1468, cfa-miR- 146a. cfa-miR-146b, cfa-miR-147, cfa-miR-148a, cfa-miR-148b, cfa-miR-149. cfa-miR-150, cfa-miR-151. cfa-miR-152, cfa-miR-153, cfa-miR-155, cfa-miR-15a. cfa-miR-15b, cfa-miR- 16, cfa-miR-17, cfa-miR-181a, cfa-miR-181b, cfa-miR-181c, cfa-miR- 181 d, cfa-miR-182, cfa-miR-183, cfa-miR-1835, cfa-miR-1836, cfa-miR-1837, cfa-miR-1838, cfa-miR-1839, cfa-miR-184, cfa-miR-1840, cfa-miR-1841, cfa-miR-1842, cfa-miR-1843, cfa-miR-1844, cfa-miR-185. cfa-miR-186, cfa-miR-187, cfa-miR-188, cfa-miR-18a. cfa-miR-18b, cfa-miR- 190a, cfa-miR- 190b, cfa-miR- 191, cfa-miR- 192, cfa-miR- 193a, cfa-miR- 193b, cfa-miR- 194,cfa-miR-195. cfa-miR-196a, cfa-miR-196b, cfa-miR-197, cfa-miR-199, cfa-miR-19a, cfa- miR-19b, cfa-miR-200a. cfa-miR-200b, cfa-miR-200c, cfa-miR-202, cfa-miR-203. cfa-miR- 204, cfa-miR-205, cfa-miR-206, cfa-miR-207, cfa-miR-208a, cfa-miR-208b, cfa-miR-20a, cfa-miR-20b, cfa-miR-21, cfa-miR-210, cfa-miR-211, cfa-miR-2114, cfa-miR-212, cfa-miR- 214, cfa-miR-215, cfa-miR-216a, cfa-miR-216b, cfa-miR-217, cfa-miR-218, cfa-miR-219- 3p, cfa-miR-219-5p, cfa-miR-22, cfa-miR-221, cfa-miR-222, cfa-miR-223. cfa-miR-224, cfa- miR-2387, cfa-miR-23a. cfa-miR-23b, cfa-miR-24, cfa-miR-2483, cfa-miR-25, cfa-miR-26a, cfa-miR-26b, cfa-miR-27a, cfa-miR-27b, cfa-miR-28, cfa-miR-299, cfa-miR-29a, cfa-miR- 29b, cfa-miR-29c, cfa-miR-300, cfa-miR-301a, cfa-miR-301b, cfa-miR-302a, cfa-miR-302b, cfa-miR-302c, cfa-miR-302d, cfa-miR-30a, cfa-miR-30b, cfa-miR-30c. cfa-miR-30d, cfa- miR-30e. cfa-miR-31, cfa-miR-32, cfa-miR-320, cfa-miR-323, cfa-miR-324. cfa-miR-325, cfa-miR-326, cfa-miR-328, cfa-miR-329a, cfa-miR-329b, cfa-miR-330, cfa-miR-331, cfa- miR-335, cfa-miR-338, cfa-miR-339, cfa-miR-33a, cfa-miR-33b, cfa-miR-340, cfa-miR-342, cfa-miR-345, cfa-miR-346, cfa-miR-34a, cfa-miR-34b, cfa-miR-34c, cfa-miR-350, cfa-miR- 361, cfa-miR-362, cfa-miR-363, cfa-miR-365, cfa-miR-367, cfa-miR-369, cfa-miR-370, cfa- miR-371, cfa-miR-374a. cfa-miR-374b. cfa-miR-375. cfa-miR-376a. cfa-miR-376b, cfa-miR- 376c, cfa-miR-377, cfa-miR-378, cfa-miR-379, cfa-miR-380, cfa-miR-381, cfa-miR-382, cfa-miR-383, cfa-miR-384, cfa-miR-3958, cfa-miR-409, cfa-miR-410, cfa-miR-411, cfa- miR-421, cfa-miR-423a, cfa-miR-424, cfa-miR-425, cfa-miR-429, cfa-miR-432, cfa-miR- 433, cfa-miR-448, cfa-miR-449a, cfa-miR-449b, cfa-miR-450a, cfa-miR-450b. cfa-miR-451, cfa-miR-452, cfa-miR-454, cfa-miR-455, cfa-miR-483, cfa-miR-485, cfa-miR-486, cfa-miR- 486-3p, cfa-miR-487a, cfa-miR-487b, cfa-miR-488, cfa-miR-489, cfa-miR-490, cfa-miR- 491, cfa-miR-493, cfa-miR-494, cfa-miR-495, cfa-miR-496, cfa-miR-497, cfa-miR-499, cfa- miR-500, cfa-miR-502, cfa-miR-503, cfa-miR-504, cfa-miR-505. cfa-miR-506, cfa-miR- 507a, cfa-miR-507b, cfa-miR-508a, cfa-miR-508b, cfa-miR-514, cfa-miR-532, cfa-miR-539, cfa-miR-542, cfa-miR-543, cfa-miR-544, cfa-miR-545, cfa-miR-551a, cfa-miR-551b, cfa- miR-568, cfa-miR-574, cfa-miR-578, cfa-miR-582, cfa-miR-589, cfa-miR-590, cfa-miR-592, cfa-miR-599. cfa-miR-615, cfa-miR-628, cfa-miR-631, cfa-miR-632. cfa-miR-6516, cfa- miR-652, cfa-miR-6529. cfa-miR-653, cfa-miR-660, cfa-miR-664, cfa-miR-665. cfa-miR- 671, cfa-miR-676, cfa-miR-7, cfa-miR-708, cfa-miR-718, cfa-miR-7180, cfa-miR-758, cfa- miR-759, cfa-miR-761, cfa-miR-764, cfa-miR-769, cfa-miR-802, cfa-miR-872, cfa-miR-874, cfa-miR-875, cfa-miR-876, cfa-miR-8789, cfa-miR-8790, cfa-miR-8791a, cfa-miR-8791b, cfa-miR-8792, cfa-miR-8793, cfa-miR-8794, cfa-miR-8795, cfa-miR-8796, cfa-miR-8797, cfa-miR-8798, cfa-miR-8799a, cfa-miR-8799b, cfa-miR-8799c, cfa-miR-8799d, cfa-miR-8799e, cfa-miR-8799f, cfa-miR-8799g, cfa-miR-8800, cfa-miR-8801, cfa-miR-8802. cfa- miR-8803, cfa-miR-8804, cfa-miR-8805, cfa-miR-8806, cfa-miR-8807, cfa-miR-8808, cfa- miR-8809, cfa-miR-8810, cfa-miR-8811, cfa-miR-8812, cfa-miR-8813, cfa-miR-8814, cfa- miR-8815, cfa-miR-8816, cfa-miR-8817, cfa-miR-8818, cfa-miR-8819, cfa-miR-8820, cfa- miR-8821, cfa-miR-8822, cfa-miR-8823, cfa-miR-8824, cfa-miR-8825, cfa-miR-8826, cfa- miR-8827, cfa-miR-8828, cfa-miR-8829, cfa-miR-8830, cfa-miR-8831, cfa-miR-8832, cfa- miR-8833, cfa-miR-8834a, cfa-miR-8834b, cfa-miR-8835, cfa-miR-8836, cfa-miR-8837, cfa- miR-8838, cfa-miR-8839, cfa-miR-8840, cfa-miR-8841, cfa-miR-8842, cfa-miR-8843, cfa- miR-8844, cfa-miR-8845, cfa-miR-8846, cfa-miR-8847, cfa-miR-8848, cfa-miR-8849, cfa- miR-885, cfa-miR-8850, cfa-miR-8851, cfa-miR-8852, cfa-miR-8853, cfa-miR-8854, cfa- miR-8855, cfa-miR-8856, cfa-miR-8857, cfa-miR-8858, cfa-miR-8859a, cfa-miR-8859b, cfa- miR-8860, cfa-miR-8861, cfa-miR-8862, cfa-miR-8863, cfa-miR-8864, cfa-miR-8865, cfa- miR-8866, cfa-miR-8867, cfa-miR-8868, cfa-miR-8869, cfa-miR-8870, cfa-miR-8871, cfa- miR-8872, cfa-miR-8873a, cfa-miR-8873b, cfa-miR-8874, cfa-miR-8875, cfa-miR-8876, cfa- miR-8877, cfa-miR-8878, cfa-miR-8879, cfa-miR-8880, cfa-miR-8881, cfa-miR-8882, cfa- miR-8883. cfa-miR-8884, cfa-miR-8885, cfa-miR-8886, cfa-miR-8887, cfa-miR-8888, cfa- miR-8889, cfa-miR-889, cfa-miR-8890, cfa-miR-8891, cfa-miR-8892, cfa-miR-8893, cfa- miR-8894, cfa-miR-8895, cfa-miR-8896, cfa-miR-8897, cfa-miR-8898, cfa-miR-8899, cfa- miR-8900, cfa-miR-8901, cfa-miR-8902, cfa-miR-8903, cfa-miR-8904a, cfa-miR-8904b, cfa- miR-8905, cfa-miR-8906, cfa-miR-8907, cfa-miR-8908a-3p, cfa-miR-8908a-5p, cfa-miR- 8908b, cfa-miR-8908c, cfa-miR-8908d, cfa-miR-8908e, cfa-miR-8908f, cfa-miR-9, cfa-miR- 92a, cfa-miR-92b, cfa-miR-93, cfa-miR-95, cfa-miR-96, cfa-miR-98, cfa-miR-99a, cfa-miR- 99b, cgr-let-7a. cgr-let-7a-2, cgr-let-7b, cgr-let-7c, cgr-let-7c-2, cgr-let-7d-3p, cgr-let-7d-5p, cgr-let-7e, cgr-let-7f. cgr-let-7g-3p, cgr-let-7g-5p, cgr-let-7i, cgr-miR-1, cgr-miR-100-3p, cgr-miR-100-5p, cgr-miR-lOla, cgr-miR-101b-3p, cgr-miR-101b-5p, cgr-miR-103-3p, cgr- miR-103-5p, cgr-miR-106b-3p, cgr-miR-106b-5p, cgr-miR-107, cgr-miR-1 Oa-3p, cgr-miR- 10a-5p, cgr-miR-1 Ob-3p, cgr-miR-1 Ob-5p, cgr-miR-122, cgr-miR-1224, cgr-miR-124, cgr- miR-1249, cgr-miR-125a-3p, cgr-miR-125 a-5p, cgr-miR-125b, cgr-miR-125b-3p, cgr-miR- 125b-5p, cgr-miR-1260, cgr-miR-126a, cgr-miR-126b, cgr-miR-127. cgr-miR-1271. cgr- miR-128, cgr-miR-128-3p, cgr-miR-128-5p, cgr-miR-1285, cgr-miR-129, cgr-miR-1306-3p, cgr-miR-1306-5p, cgr-miR-13 Oa-3p, cgr-miR-130a-5p, cgr-miR-130b-3p, cgr-miR-13 Ob-5p, cgr-miR-132-3p, cgr-miR-132-5p, cgr-miR-134, cgr-miR-1343, cgr-miR-137-3p, cgr-miR- 137-5p, cgr-miR-138, cgr-miR-139-3p, cgr-miR-139-5p, cgr-miR-140-3p, cgr-miR-140-5p, cgr-miR-141, cgr-miR-142-3p, cgr-miR-142-5p, cgr-miR-143, cgr-miR-144, cgr-miR-146a,cgr-miR-146b-3p, cgr-miR-146b-5p, cgr-miR-147, cgr-miR-148a, cgr-miR-148b-3p, cgr- miR-148b-5p, cgr-miR-149-3p, cgr-miR-149-5p, cgr-miR-150, cgr-miR-151-3p, cgr-miR- 15 l-5p, cgr-miR-152-3p, cgr-miR-152-5p, cgr-miR-154-3p, cgr-miR- 154-5p, cgr-miR-155, cgr-miR-15a-3p, cgr-miR-15a-5p, cgr-miR-15b-3p, cgr-miR-15b-5p, cgr-miR-16, cgr-miR- 16-3p, cgr-miR-16-5p, cgr-miR-17-3p, cgr-miR-17-5p, cgr-miR-181a-3p, cgr-miR-181a-5p, cgr-miR-181b-3p, cgr-miR-181b-5p, cgr-miR-181c-3p, cgr-miR-181c-5p, cgr-miR-181d-3p. cgr-miR-181d-5p, cgr-miR-182. cgr-miR-183, cgr-miR-1839-3p. cgr-miR-1839-5p, cgr-miR- 184, cgr-miR-1843, cgr-miR-185-3p, cgr-miR-185-5p, cgr-miR-186-3p, cgr-miR-186-5p, cgr-miR-187, cgr-miR-188, cgr-miR-18a-3p, cgr-miR-18a-5p, cgr-miR-18b, cgr-miR-1903, cgr-miR-190a, cgr-miR- 190b, cgr-miR-191 -3 p, cgr-miR-191 -5 p, cgr-miR-192, cgr-miR- 193a. cgr-miR- 193b-3p, cgr-miR- 193b-5p, cgr-miR-194, cgr-miR- 194-2. cgr-miR-1949. cgr- miR-195, cgr-miR-1956, cgr-miR- 196a-3p, cgr-miR- 196a-5p, cgr-miR-196b, cgr-miR-196c, cgr-miR-1973, cgr-miR-199a, cgr-miR-199a-3p, cgr-miR-199a-5p, cgr-miR-199b, cgr-miR- 19a, cgr-miR- 19b-3p, cgr-miR-19b-5p, cgr-miR-lb, cgr-miR-200a, cgr-miR-200b, cgr-miR- 200c. cgr-miR-202, cgr-miR-204, cgr-miR-205, cgr-miR-206, cgr-miR-20a, cgr-miR-20b, cgr-miR-21-3p, cgr-miR-21-5p, cgr-miR-210-3p, cgr-miR-210-5p, cgr-miR-211. cgr-miR- 212, cgr-miR-214-3p, cgr-miR-214-5p, cgr-miR-21 -3p, cgr-miR-215 -5 p, cgr-miR-216b, cgr-miR-217, cgr-miR-218a, cgr-miR-219b, cgr-miR-22-3p, cgr-miR-22-5p, cgr-miR-221- 3p, cgr-miR-221-5p, cgr-miR-222-3p, cgr-miR-222-5p, cgr-miR-23a-3p, cgr-miR-23a-5p, cgr-miR-23b-3p. cgr-miR-23b-5p. cgr-miR-24, cgr-miR-24-3p. cgr-miR-24-5p, cgr-miR- 2424, cgr-miR-25-3p, cgr-miR-25-5p, cgr-miR-26a, cgr-miR-26a-2, cgr-miR-26b-3p, cgr- miR-26b-5p, cgr-miR-27a-3p, cgr-miR-27a-5p, cgr-miR-27b-3p, cgr-miR-27b-5p, cgr-miR- 28-3p, cgr-miR-28-5p, cgr-miR-296, cgr-miR-298-3p, cgr-miR-298-5p, cgr-miR-29a-3p, cgr- miR-29a-5p, cgr-miR-29b. cgr-miR-29b-3p. cgr-miR-29b-5p, cgr-miR-29c-3p. cgr-miR-29c- 5p, cgr-miR-300, cgr-miR-301a-3p, cgr-miR-301a-5p, cgr-miR-301b, cgr-miR-3068, cgr- miR-3072-3p, cgr-miR-3072-5p, cgr-miR-3074, cgr-miR-30a-3p, cgr-miR-30a-5p, cgr-miR- 30b-3p, cgr-miR-30b-5p, cgr-miR-30c, cgr-miR-30c-2, cgr-miR-30d, cgr-miR-30e-3p, cgr- miR-30e-5p, cgr-miR-31-3p, cgr-miR-31-5p, cgr-miR-3102, cgr-miR-3154, cgr-miR-32-3p, cgr-miR-32-5p, cgr-miR-320a, cgr-miR-322-3p, cgr-miR-322-5p, cgr-miR-324-3p, cgr-miR- 324-5p, cgr-miR-325-3p, cgr-miR-325-5p, cgr-miR-326, cgr-miR-328, cgr-miR-33, cgr-miR- 330, cgr-miR-33 l-3p, cgr-miR-33 l-5p, cgr-miR-338, cgr-miR-339, cgr-miR-340-3p, cgr- miR-340-5p, cgr-miR-342-3p, cgr-miR-342-5p, cgr-miR-344, cgr-miR-345, cgr-miR-34a, cgr-miR-34b-3p, cgr-miR-34b-5p, cgr-miR-34c-3p, cgr-miR-34c-5p, cgr-miR-350-3p, cgr- miR-350-5p, cgr-miR-3535, cgr-miR-361, cgr-miR-362, cgr-miR-365, cgr-miR-365 -3p, cgr-miR-365-5p, cgr-miR-369-3p, cgr-miR-369-5p, cgr-miR-374-3p, cgr-miR-374-5p, cgr-miR- 377-3p, cgr-miR-377-5p, cgr-miR-378-3p, cgr-miR-378-5p, cgr-miR-379, cgr-miR-381, cgr- miR-382, cgr-miR-384-3p, cgr-miR-384-5p, cgr-miR-409-3p, cgr-miR-409-5p, cgr-miR-410- 3p, cgr-miR-410-5p, cgr-miR-412-3p, cgr-miR-412-5p, cgr-miR-423-3p, cgr-miR-423-5p, cgr-miR-425-3p, cgr-miR-425-5p, cgr-miR-429, cgr-miR-449a, cgr-miR-450a, cgr-miR- 450b-3p, cgr-miR-450b-5p, cgr-miR-451 a, cgr-miR-455-3p, cgr-miR-455-5p, cgr-miR-484, cgr-miR-486-3p. cgr-miR-486-5p. cgr-miR-496, cgr-miR-497-3p, cgr-miR-497-5p, cgr-miR- 497b, cgr-miR-499-3p, cgr-miR-499-5p, cgr-miR-500, cgr-miR-501-3p, cgr-miR-501-5p, cgr-miR-503, cgr-miR-504, cgr-miR-505-3p, cgr-miR-505-5p, cgr-miR-532-3p, cgr-miR- 532-5p, cgr-miR-542-3p, cgr-miR-542-5p, cgr-miR-574, cgr-miR-582, cgr-miR-598. cgr- miR-6091, cgr-miR-6092, cgr-miR-615-3p, cgr-miR-615-5p, cgr-miR-628. cgr-miR-632, cgr-miR-652-3p, cgr-miR-652-5p, cgr-miR-653, cgr-miR-664-3p, cgr-miR-664-5p, cgr-miR- 671-3p, cgr-miR-671-5p, cgr-miR-672, cgr-miR-674, cgr-miR-702, cgr-miR-708, cgr-miR- 744-3p, cgr-miR-744-5p, cgr-miR-760, cgr-miR-7a, cgr-miR-7b, cgr-miR-802, cgr-miR-872- 3p, cgr-miR-872-5p, cgr-miR-874, cgr-miR-9, cgr-miR-92a-3p. cgr-miR-92a-5p. cgr-miR- 92b-3p, cgr-miR-92b-5p, cgr-miR-93-3p, cgr-miR-93-5p. cgr-miR-98, cgr-miR-99a-3p, cgr- miR-99a-5p, cgr-miR-99b, chi-let-7a-3p, chi-let-7a-5p, chi-let-7b-3p, chi4et-7b-5p, chi-let- 7c-3p, chi-let-7c-5p, chi-let-7d-3p, chi4et-7d-5p, chi4et-7e-3p, chi4et-7e-5p, chi-let-7f-3p, chi-let-7f-5p, chi-let-7g-3p, chi-let-7g-5p, chi4et-7i-3p, chi-let-7i-5p, chi-miR-1, chi-miR- 100-3p, chi-miR-100-5p. chi-miR-101-3p. chi-miR-101-5p. chi-miR-103-3p. chi-miR-103- 5p, chi-miR-105a, chi-miR-105b-3p, chi-miR-105 b-5p, chi-miR-106a-3p, chi-miR-106a-5p, chi-miR-106b-3p, chi-miR-106b-5p, chi-miR-107-3p, chi-miR-10a-3p, chi-miR-10a-5p, chi- miR-10b-3p, chi-miR-10b-5p, chi-miR-1185-3p, chi-miR-1185-5p, chi-miR-1197-3p, chi- miR-122, chi-miR-1224. chi-miR-1248-5p, chi-miR-1249, chi-miR-124a, chi-miR-125a-3p, chi-miR-125a-5p, chi-miR-125b-3p, chi-miR-125b-5p, chi-miR-126-3p, chi-miR-126-5p, chi-miR-127-3p, chi-miR-127-5p, chi-miR-1271-3p, chi-miR-1271-5p, chi-miR-128-3p, chi- miR-128-5p, chi-miR-129-3p, chi-miR-129-5p, chi-miR-1291, chi-miR-1296, chi-miR-1306- 3p, chi-miR-1306-5p, chi-miR-1307-3p. chi-miR-1307-5p, chi-miR-130a-3p, chi-miR-130a- 5p, chi-miR-130b-3p, chi-miR-130b-5p. chi-miR-133 a-3p, chi-miR-133a-5p. chi-miR-133b. chi-miR-134, chi-miR-1343, chi-miR-135a, chi-miR-135b-3p, chi-miR-135b-5p, chi-miR- 136-3p, chi-miR-136-5p, chi-miR-137, chi-miR-1388-3p, chi-miR-1388-5p, chi-miR-140-3p, chi-miR-140-5p, chi-miR-141, chi-miR-143 -3 p, chi-miR-143-5p, chi-miR-144-3p, chi-miR- 144-5p, chi-miR-145-3p, chi-miR-145-5p. chi-miR-1468-3p, chi-miR-1468-5p, chi-miR- 146a, chi-miR-146b-3p, chi-miR-146b-5p, chi-miR-147-3p, chi-miR-147-5p, chi-miR-148a-3p, chi-miR-148a-5p, chi-miR-148b-3p, chi-miR-148b-5p, chi-miR-150, chi-miR-151-3p, chi-miR-151-5p, chi-miR-153. chi-miR-154a-3p, chi-miR-154a-5p. chi-miR-154b-3p, chi- miR-154b-5p, chi-miR-155-3p, chi-miR-155-5p, chi-miR-15a-3p, chi-miR-15a-5p, chi-miR- 15b-3p, chi-miR-15b-5p, chi-miR-16a-3p, chi-miR-16a-5p, chi-miR-16b-3p, chi-miR-16b- 5p, chi-miR-17-3p, chi-miR-17-5p, chi-miR-1814, chi-miR-181b-3p, chi-miR-181b-5p, chi- miR-181c-3p, chi-miR-181c-5p, chi-miR-181d, chi-miR-182. chi-miR-183, chi-miR-1839, chi-miR-184, chi-miR-186-3p. chi-miR-186-5p. chi-miR-187, chi-miR-188-3p, chi-miR-188- 5p, chi-miR-18a-3p, chi-miR-18a-5p, chi-miR-18b-3p, chi-miR-18b-5p, chi-miR-190a-3p, chi-miR-190a-5p, chi-miR-190b, chi-miR-191-3p, chi-miR-191 -5p, chi-miR-192-3p, chi- miR-192-5p, chi-miR-193a, chi-miR-193b-3p, chi-miR-193b-5p, chi-miR-194. chi-miR-195- 3p, chi-miR-195-5p, chi-miR-196a, chi-miR-196b, chi-miR-197-3p, chi-miR-197-5p, chi- miR-199a-3p, chi-miR-199a-5p, chi-miR-199b-3p, chi-miR-199b-5p, chi-miR-199c-3p, chi- miR-199c-5p, chi-miR-19a, chi-miR-19b-3p, chi-miR-19b-5p, chi-miR-200a, chi-miR-200b, chi-miR-200c, chi-miR-202-3p, chi-miR-202-5p, chi-miR-204-3p, chi-miR-204-5p, chi-miR- 206, chi-miR-208b, chi-miR-20a-3p, chi-miR-20a-5p. chi-miR-20b, chi-miR-21-3p, chi-miR- 21-5p, chi-miR-211. chi-miR-214-3p, chi-miR-214-5p, chi-miR-215-5p, chi-miR-216b, chi- miR-217-3p, chi-miR-217-5p, chi-miR-218, chi-miR-219, chi-miR-22-3p, chi-miR-22-5p, chi-miR-221-3p, chi-miR-221-5p, chi-miR-222-3p, chi-miR-223-3p, chi-miR-223-5p, chi- miR-224-3p, chi-miR-224-5p, chi-miR-2284a, chi-miR-2284b, chi-miR-2284c, chi-miR- 2284d, chi-miR-2284e, chi-miR-2290. chi-miR-2318. chi-miR-2320, chi-miR-2331, chi-miR- 2332, chi-miR-2335, chi-miR-23a, chi-miR-23b-3p, chi-miR-23b-5p, chi-miR-24-3p, chi- miR-24-5p, chi-miR-2404, chi-miR-241 l-3p, chi-miR-2411-5p, chi-miR-2432, chi-miR- 2483-3p, chi-miR-2483-5p, chi-miR-25-3p, chi-miR-25-5p, chi-miR-26a-3p, chi-miR-26a- 5p, chi-miR-26b-3p, chi-miR-26b-5p, chi-miR-27a-3p, chi-miR-27a-5p, chi-miR-27b-3p, chi-miR-27b-5p, chi-miR-28-3p, chi-miR-28-5p, chi-miR-296-3p, chi-miR-29a-3p, chi-miR- 29a-5p, chi-miR-29b-3p, chi-miR-29b-5p, chi-miR-29c-3p, chi-miR-29c-5p, chi-miR-301a- 3p, chi-miR-301a-5p, chi-miR-301b, chi-miR-30a-3p, chi-miR-30a-5p, chi-miR-30b-3p, chi- miR-30b-5p, chi-miR-30c-3p, chi-miR-30c-5p, chi-miR-30d-3p, chi-miR-30e-3p, chi-miR- 30e-5p. chi-miR-30f-3p, chi-miR-30f-5p, chi-miR-320-3p, chi-miR-323a-3p. chi-miR-323b. chi-miR-324-3p, chi-miR-324-5p, chi-miR-326-3p, chi-miR-326-5p, chi-miR-328-3p, chi- miR-329a-3p, chi-miR-329a-5p, chi-miR-329b-3p, chi-miR-330-3p, chi-miR-330-5p, chi- miR-331-3p, chi-miR-331-5p, chi-miR-335-3p, chi-miR-335-5p, chi-miR-338-3p, chi-miR- 338-5p, chi-miR-33a-3p. chi-miR-33a-5p, chi-miR-33b-3p, chi-miR-33b-5p, chi-miR-340- 3p, chi-miR-340-5p, chi-miR-342-3p, chi-miR-342-5p, chi-miR-3431-3p, chi-miR-3431-5p,chi-miR-3432-3p, chi-miR-3432-5p, chi-miR-345-3p, chi-miR-345-5p, chi-miR-346-5p, chi- miR-34a. chi-miR-34b-3p. chi-miR-34b-5p. chi-miR-34c-3p, chi-miR-34c-5p, chi-miR-361- 3p, chi-miR-361-5p, chi-miR-362-3p, chi-miR-362-5p, chi-miR-363-3p, chi-miR-363-5p, chi-miR-365-3p, chi-miR-369-3p, chi-miR-369-5p, chi-miR-374a-3p, chi-miR-374a-5p, chi- miR-374b-3p, chi-miR-374b-5p, chi-miR-376a, chi-miR-376b-3p, chi-miR-376b-5p, chi- miR-376c-3p, chi-miR-376c-5p, chi-miR-376d, chi-miR-376e-3p, chi-miR-376e-5p, chi- miR-377, chi-miR-378-3p. chi-miR-378-5p. chi -miR-379-3 p. chi-miR-379-5p. chi-miR-380- 3p, chi -miR-380-5p, chi-miR-381, chi-miR-382-3p, chi-miR-382-5p, chi-miR-383, chi-miR- 3955-3p, chi-miR-3955-5p, chi-miR-3958-3p, chi-miR-3958-5p, chi-miR-3959-3p, chi-miR- 3959-5p, chi-miR-409-3p, chi-miR-409-5p, chi-miR-410-3p, chi-miR-410-5p, chi-miR-41 la- 3p, chi-miR-41 la-5p, chi-miR-41 lb-3p. chi-miR-41 lb-5p, chi-miR-412-3p, chi-miR-412-5p, chi-miR-421-3p, chi-miR-423-3p, chi-miR-423-5p, chi-miR-424-3p, chi-miR-424-5p, chi- miR-425-3p, chi-miR-425-5p, chi-miR-429, chi-miR-432-3p, chi-miR-432-5p, chi-miR-433, chi-miR-449a-3p, chi-miR-449a-5p, chi-miR-449b-3p, chi-miR-449b-5p. chi-miR-449c, chi- miR-450-3p, chi-miR-450-5p, chi-miR-451-3p, chi-miR-451-5p, chi-miR-454-3p, chi-miR- 454-5p, chi-miR-455-3p. chi-miR-455-5p. chi-miR-483, chi-miR-485-3p, chi-miR-485-5p, chi-miR-487a-3p, chi-miR-487a-5p, chi-miR-487b-3p, chi-miR-487b-5p, chi-miR-490, chi- miR-491-3p, chi-miR-491-5p, chi-miR-493-3p, chi-miR-493-5p, chi-miR-494, chi-miR-495- 3p, chi-miR-496-3p, chi-miR-496-5p, chi-miR-497-3p, chi-miR-497-5p, chi-miR-499-3p, chi-miR-499-5p, chi-miR-500-3p, chi-miR-500-5p, chi-miR-502a, chi-miR-502b-3p, chi- miR-502b-5p, chi-miR-504, chi-miR-505-3p, chi-miR-532-3p, chi-miR-532-5p, chi-miR- 542-3p, chi-miR-542-5p. chi-miR-543-3p, chi-miR-543-5p, chi-miR-544-5p, chi-miR-545- 3p, chi-miR-545-5p, chi-miR-582-5p, chi-miR-592, chi-miR-628-5p, chi-miR-655, chi-miR- 656, chi-miR-660, chi-miR-665, chi-miR-671-3p, chi-miR-671-5p, chi-miR-7-3p, chi-miR-7- 5p, chi-miR-708-3p, chi-miR-708-5p, chi-miR-758, chi-miR-767, chi-miR-873-3p, chi-miR- 873-5p, chi-miR-874-3p, chi-miR-874-5p, chi-miR-876-3p, chi-miR-876-5p, chi-miR-877- 3p, chi-miR-877-5p, chi-miR-9-3p, chi-miR-9-5p, chi-miR-92a-3p, chi-miR-92a-5p, chi- miR-92b, chi-miR-93-3p, chi-miR-93-5p, chi-miR-96, chi-miR-98-3p, chi-miR-98-5p, chi- miR-99a-3p, chi-miR-99a-5p, chi-miR-99b-3p, chi-miR-99b-5p, cin-let-7a-l-3p. cin-let-7a-2- 3p, cin-let-7a-5p, cin-let-7b-3p, cin-let-7b-5p, cin-let-7c, cin-let-7d-3p, cin-let-7d-5p, cin-let- 7e, cin-let-7f-3p, cin-let-7f-5p, cin-miR-l-3p, cin-miR-l-5p, cin-miR-101, cin-miR-124-l-5p, cin-miR-124-2-5p, cin-miR-124-3p, cin-miR-125-3p, cin-miR-125-5p, cin-miR-126-3p, cin- miR-126-5p, cin-miR-132-5p, cin-miR-133-3p, cin-miR-133-5p, cin-miR-135-3p, cin-miR- 135-5p, cin-miR-141-3p, cin-miR-141-5p, cin-miR-1473-3p, cin-miR-1473-5p, cin-miR-1497-3p, cin-miR-1497-5p, cin-miR-15-3p, cin-miR-15-5p, cin-miR-1502a-3p, cin-miR- 1502a-5p, cin-miR-1502b-3p, cin-miR-1502b-5p, cin-miR-1502c-3p. cin-miR-1502c-5p, cin- miR-1502d-3p, cin-miR-1502d-5p, cin-miR-153-3p, cin-miR-153-5p, cin-miR-155, cin-miR- 181, cin-miR-182-3p, cin-miR-182-5p, cin-miR-183-3p, cin-miR-183-5p, cin-miR-184, cin- miR-196-3p, cin-miR-196-5p, cin-miR-199-3p, cin-miR-200-3p, cin-miR-200-5p, cin-miR- 216, cin-miR-217, cin-miR-219-3p, cin-miR-219-5p, cin-miR-281-3p, cin-miR-281-5p, cin- miR-29-3p, cin-miR-29-5p, cin-miR-31. cin-miR-33, cin-miR-34-3p. cin-miR-34-5p, cin- miR-3575-3p, cin-miR-3575-5p, cin-miR-3598-3p, cin-miR-3598-5p, cin-miR-3599-3p, cin- miR-3599-5p, cin-miR-367-3p, cin-miR-367-5p, cin-miR-375-3p, cin-miR-375-5p, cin-miR- 4000a-2-3p, cin-miR-4000a-3p, cin-miR-4000a-5p, cin-miR-4000b-l-3p. cin-miR-4000b-2- 3p, cin-miR-4000b-5p. cin-miR-4000c-3p, cin-miR-4000c-5p, cin-miR-4000d-3p, cin-miR- 4000d-5p, cin-miR-4000e-3p, cin-miR-4000e-5p, cin-miR-4000f-3p, cin-miR-4000f-5p, cin- miR-4000g-3p, cin-miR-4000g-5p, cin-miR-4000h-3p, cin-miR-4000h-5p, cin-miR-4000i- 3p, cin-miR-4000i-5p, cin-miR-4001a-l-3p, cin-miR-4001a-2-3p, cin-miR-4001a-5p, cin- miR-4001b-l-3p, cin-miR-4001b-2-3p, cin-miR-4001b-5p, cin-miR-4001c-3p, cin-miR- 4001c-5p, cin-miR-4001d-3p, cin-miR-4001d-5p. cin-miR-4001e-3p. cin-miR-4001e-5p, cin- miR-4001f-3p, cin-miR-4001f-5p, cin-miR-4001g-3p, cin-miR-4001h-3p, cin-miR-4001h-5p, cin-miR-4001i-3p, cin-miR-4001i-5p, cin-miR-4002-3p, cin-miR-4002-5p, cin-miR-4003a- 3p, cin-miR-4003a-5p, cin-miR-4003b-3p, cin-miR-4003b-5p, cin-miR-4003c-3p, cin-miR- 4003c-5p, cin-miR-4003d-3p, cin-miR-4004-5p, cin-miR-4005a-3p, cin-miR-4005a-5p, cin- miR-4005b-3p, cin-miR-4005b-5p, cin-miR-4005c-5p, cin-miR-4006a-l-3p, cin-miR-4006a- 2-3p, cin-miR-4006a-3-3p, cin-miR-4006a-5p, cin-miR-4006b-3p, cin-miR-4006b-5p, cin- miR-4006c-3p, cin-miR-4006c-5p, cin-miR-4006d-3p, cin-miR-4006d-5p, cin-miR-4006e- 3p, cin-miR-4006e-5p. cin-miR-4006f-3p. cin-miR-4006f-5p. cin-miR-4006g-3p, cin-miR- 4006g-5p, cin-miR-4007-5p, cin-miR-4008a-3p, cin-miR-4008a-5p, cin-miR-4008b-3p, cin- miR-4008b-5p, cin-miR-4008c-3p, cin-miR-4008c-5p, cin-miR-4009a-3p, cin-miR-4009a- 5p, cin-miR-4009b-3p, cin-miR-4009b-5p, cin-miR-4009c-3p, cin-miR-4010-3p, cin-miR- 4010-5p, cin-miR-401 la-3p, cin-miR-401 la-5p, cin-miR-4011b-3p, cin-miR-401 lb-5p, cin- miR-4012-3p, cin-miR-4012-5p. cin-miR-4013a-3p, cin-miR-4013 a-5p, cin-miR-4013b-3p, cin-miR-4013b-5p, cin-miR-4014- l-5p, cin-miR-4014-2-5p, cin-miR-4014-3p, cin-miR- 4015-3p, cin-miR-4015-5p, cin-miR-4016, cin-miR-4017-3p, cin-miR-4017-5p, cin-miR- 4018a-3p, cin-miR-4018a-5p, cin-miR-4018b-3p, cin-miR-4018b-5p, cin-miR-4019-3p, cin- miR-4019-5p, cin-miR-4020a-5p, cin-miR-4020b-3p, cin-miR-4020b-5p, cin-miR-4021-3p, cin-miR-4021-5p, cin-miR-4022-3p, cin-miR-4023-3p, cin-miR-4024-3p, cin-miR-4024-5p,cin-miR-4025-5p, cin-miR-4026-3p. cin-miR-4026-5p, cin-miR-4027-3p, cin-miR-4027-5p, cin-miR-4028-3p, cin-miR-4029-3p. cin-miR-4029-5p, cin-miR-4030-3p, cin-miR-4030-5p, cin-miR-4031-3p, cin-miR-4031-5p, cin-miR-4032-3p, cin-miR-4032-5p, cin-miR-4033-3p, cin-miR-4033-5p, cin-miR-4034-3p, cin-miR-4034-5p, cin-miR-4035-3p, cin-miR-4035-5p, cin-miR-4036-3p, cin-miR-4036-5p, cin-miR-4037-3p, cin-miR-4037-5p, cin-miR-4038-3p, cin-miR-4038-5p, cin-miR-4039-3p. cin-miR-4039-5p, cin-miR-4040-3p, cin-miR-4040-5p, cin-miR-4041-3p, cin-miR-4041-5p. cin-miR-4042-3p, cin-miR-4042-5p, cin-miR-4043-3p. cin-miR-4043-5p, cin-miR-4044-3p, cin-miR-4044-5p, cin-miR-4045-3p, cin-miR-4045-5p, cin-miR-4046-3p, cin-miR-4046-5p, cin-miR-4047-3p, cin-miR-4047-5p, cin-miR-4048-3p, cin-miR-4048-5p, cin-miR-4049-3p. cin-miR-4049-5p, cin-miR-4050-3p, cin-miR-4050-5p, cin-miR-4051-3p, cin-miR-4051-5p. cin-miR-4052-3p, cin-miR-4052-5p, cin-miR-4053-3p, cin-miR-4053-5p, cin-miR-4054-3p, cin-miR-4054-5p, cin-miR-4055-3p, cin-miR-4055-5p, cin-miR-4056-3p, cin-miR-4056-5p, cin-miR-4057-3p, cin-miR-4057-5p, cin-miR-4058-5p, cin-miR-4059-3p, cin-miR-4059-5p, cin-miR-4060-3p, cin-miR-4060-5p, cin-miR-4061-3p, cin-miR-4061-5p, cin-miR-4062-3p. cin-miR-4062-5p, cin-miR-4063-3p, cin-miR-4063-5p, cin-miR-4064-3p, cin-miR-4064-5p. cin-miR-4065-3p, cin-miR-4065-5p, cin-miR-4066-3p. cin-miR-4066-5p, cin-miR-4067-3p, cin-miR-4067-5p, cin-miR-4068-3p, cin-miR-4068-5p, cin-miR-4069-3p, cin-miR-4069-5p, cin-miR-4070-3p, cin-miR-4070-5p, cin-miR-4071-3p, cin-miR-4071-5p, cin-miR-4072-3p. cin-miR-4072-5p, cin-miR-4073-3p, cin-miR-4073-5p, cin-miR-4074-3p, cin-miR-4074-5p. cin-miR-4075-3p, cin-miR-4075-5p, cin-miR-4076-3p, cin-miR-4076-5p, cin-miR-4077a-5p, cin-miR-4077b-5p, cin-miR-4077c-5p, cin-miR-4077d- 5p, cin-miR-4078-3p, cin-miR-4078-5p, cin-miR-4079-3p, cin-miR-4079-5p, cin-miR-4080- 3p, cin-miR-4080-5p, cin-miR-4081-3p, cin-miR-4081-5p, cin-miR-4082-3p, cin-miR-4082- 5p, cin-miR-4083-3p, cin-miR-4083-5p. cin-miR-4084-3p, cin-miR-4084-5p, cin-miR-4085- 3p, cin-miR-4085-5p, cin-miR-4086-3p, cin-miR-4087-3p, cin-miR-4087-5p, cin-miR-4088- 3p, cin-miR-4088-5p, cin-miR-4089-5p, cin-miR-4090-3p, cin-miR-4091-3p, cin-miR-4091- 5p, cin-miR-4092-3p, cin-miR-4092-5p, cin-miR-4093-3p, cin-miR-4093-5p, cin-miR-4094- 3p, cin-miR-4094-5p, cin-miR-4095-5p. cin-miR-4096-3p, cin-miR-4097-3p, cin-miR-4097- 5p, cin-miR-4098-3p, cin-miR-4098-5p. cin-miR-4099-3p, cin-miR-4099-5p, cin-miR-4100- 3p, cin-miR-4100-5p, cin-miR-4101-3p, cin-miR-4102-3p, cin-miR-4102-5p, cin-miR-4103- 3p, cin-miR-4104-5p, cin-miR-4105-5p, cin-miR-4106-3p, cin-miR-4107-5p, cin-miR-4108- 5p, cin-miR-4109-3p, cin-miR-4109-5p, cin-miR-4110-3p, cin-miR-4110-5p, cin-miR-4111- 3p, cin-miR-4112-3p, cin-miR-4112-5p. cin-miR-4113-5 p, cin-miR-4114-5 p, cin-miR-4115- 3p, cin-miR-4115-5 p, cin-miR-4116-5p, cin-miR-4117-5p, cin-miR-4118-3p, cin-miR-4119-3p, cin-miR-4119-5p, cin-miR-4120-5p, cin-miR-4121-3p, cin-miR-4122-3p, cin-miR-4123- 3p, cin-miR-4123-5p, cin-miR-4124-5p. cin-miR-4125-5p, cin-miR-4126-5p, cin-miR-4127- 3p, cin-miR-4127-5p, cin-miR-4128-3p, cin-miR-4129-3p, cin-miR-4130-3p, cin-miR-4131- 3p, cin-miR-4131-5p, cin-miR-4132-3p, cin-miR-4132-5p, cin-miR-4133-3p, cin-miR-4134- 5p, cin-miR-4135-3p, cin-miR-4136-3p, cin-miR-4137-3p, cin-miR-4138-5p, cin-miR-4139- 3p, cin-miR-4139-5p, cin-miR-4140-3p. cin-miR-4140-5p, cin-miR-4141-3p, cin-miR-4141- 5p. cin-miR-4142-3p, cin-miR-4142-5p. cin-miR-4143-3p, cin-miR-4143-5p, cin-miR-4144- 3p, cin-miR-4144-5p, cin-miR-4145-3p, cin-miR-4146-3p, cin-miR-4147-3p, cin-miR-4148- 5p, cin-miR-4149-5p, cin-miR-4150-5p, cin-miR-4151-3p, cin-miR-4151-5p, cin-miR-4152- 5p, cin-miR-4153-3p, cin-miR-4154-3p, cin-miR-4155-3p, cin-miR-4155-5p, cin-miR-4156- 3p, cin-miR-4156-5p, cin-miR-4157-5p. cin-miR-4158-5p, cin-miR-4159-3p, cin-miR-4160- 3p, cin-miR-4162-3p, cin-miR-4162-5p, cin-miR-4163-3p, cin-miR-4163-5p, cin-miR-4164- 3p, cin-miR-4165-3p, cin-miR-4166-5p, cin-miR-4167-5p, cin-miR-4168-3p, cin-miR-4169- 3p, cin-miR-4170-5p, cin-miR-4171-5p, cin-miR-4172-3p, cin-miR-4173-3p, cin-miR-4173- 5p, cin-miR-4174-3p, cin-miR-4175-3p. cin-miR-4176-5p, cin-miR-4177-3p, cin-miR-4177- 5p. cin-miR-4178a-5p. cin-miR-4178b-5p, cin-miR-4179a-3p, cin-miR-4179a-5p, cin-miR- 4179b-3p, cin-miR-4179b-5p, cin-miR-4180-3p, cin-miR-4180-5p, cin-miR-4181-3p, cin- miR-4181-5p, cin-miR-4182-3p, cin-miR-4182-5p, cin-miR-4183-3p, cin-miR-4183-5p, cin- miR-4184-3p, cin-miR-4185-3p. cin-miR-4185-5p, cin-miR-4186-5p, cin-miR-4187-5p, cin- miR-4188-5p, cin-miR-4189-5p. cin-miR-4190-5p, cin-miR-4191-5p, cin-miR-4192-3p, cin- miR-4193-5p, cin-miR-4194-3p, cin-miR-4194-5p, cin-miR-4195-3p, cin-miR-4196-5p, cin- miR-4197-5p, cin-miR-4198-5p, cin-miR-4199-3p, cin-miR-4200-3p, cin-miR-4200-5p, cin- miR-4201-5p, cin-miR-4202-5p, cin-miR-4203-3p, cin-miR-4204-3p, cin-miR-4204-5p, cin- miR-4205-5p, cin-miR-4206-3p. cin-miR-4207-3p, cin-miR-4208-3p, cin-miR-4209-5p, cin- miR-4210-5p, cin-miR-421 l-5p, cin-miR-4212-3p, cin-miR-4213-5p, cin-miR-4214-5p, cin- miR-4215-3p, cin-miR-4216-3p, cin-miR-4216-5p, cin-miR-4217-3p, cin-miR-4218-5p, cin- miR-4219-5p, cin-miR-4220-3p, cin-miR-4220-5p, cin-miR-5596a-3p, cin-miR-5596a-5p, cin-miR-5596b-3p. cin-miR-5596b-5p, cin-miR-5597-3p, cin-miR-5597-5p, cin-miR-5598- 3p, cin-miR-5598-5p, cin-miR-5599-3p. cin-miR-5599-5p, cin-miR-5600-3p, cin-miR-5600- 5p, cin-miR-5601-3p, cin-miR-5601-5p, cin-miR-5602-3p, cin-miR-5602-5p, cin-miR-5603- 3p, cin-miR-5603-5p, cin-miR-5604-3p, cin-miR-5604-5p, cin-miR-5605-3p, cin-miR-5605- 5p, cin-miR-5606-3p, cin-miR-5606-5p, cin-miR-5607-3p, cin-miR-5607-5p, cin-miR-5608- 3p, cin-miR-5608-5p, cin-miR-5609-3p. cin-miR-5609-5p, cin-miR-5610-3p, cin-miR-5610- 5p, cin-miR-5611-3p, cin-miR-5611-5p, cin-miR-5612-3p, cin-miR-5612-5p, cin-miR-672,cin-miR-7-3p, cin-miR-7-5p, cin-miR-78, cin-miR-9-5p, cin-miR-92a-3p, cin-miR-92a-5p, cin-miR-92b-3p, cin-miR-92b-5p, cin-miR-92c-3p, cin-miR-92c-5p, cin-miR-92d-3p, cin- miR-92d-5p, cin-miR-92e-3p, cin-miR-92e-5p, cin-miR-96-3p, cin-miR-96-5p, cja-let-7a, cja-let-7b, cja-let-7c, cja-let-7d, cja-let-7e, cja-let-7f, cja-let-7g, cja-let-7i, cja-miR-100, cja- miR-101, cja-miR-101-2, cja-miR-103a, cja-miR-103b, cja-miR-105, cja-miR-106b, cja- miR-lOa. cja-miR-lOb, cja-miR-1185. cja-miR-1193, cja-miR-122, cja-miR-124, cja-miR- 1240, cja-miR-1247. cja-miR-1249, cja-miR-125. cja-miR-1251, cja-miR-1253, cja-miR- 1258a, cja-miR-1258b, cja-miR-125a, cja-miR-125b, cja-miR-126, cja-miR-1264, cja-miR- 127, cja-miR-128, cja-miR-1282, cja-miR-129, cja-miR-1294, cja-miR-1296, cja-miR-1298, cja-miR-1301, cja-miR-1302, cja-miR-1305, cja-miR-1306. cja-miR-1307, cja-miR-130a, cja-miR-130b, cja-miR-132, cja-miR-1323, cja-miR-1327, cja-miR-133a, cja-miR-133b. cja- miR-134, cja-miR-135, cja-miR-137, cja-miR-138, cja-miR-139, cja-miR-140, cja-miR-141, cja-miR-142, cja-miR-143, cja-miR-144, cja-miR-145, cja-miR-1468, cja-miR-146a, cja- miR-146b, cja-miR-148a, cja-miR-148b, cja-miR-150, cja-miR-151, cja-miR-152, cja-miR- 153, cja-miR-154, cja-miR-155, cja-miR-15b, cja-miR-16, cja-miR-17, cja-miR-181a, cja- miR-181b. cja-miR-181c, cja-miR-181 d, cja-miR-182, cja-miR-183, cja-miR-184. cja-miR- 185, cja-miR-186, cja-miR-187, cja-miR-1895, cja-miR-1898, cja-miR-190a, cja-miR-190b, cja-miR-191, cja-miR-1911, cja-miR-193, cja-miR-194, cja-miR-196a, cja-miR-196b, cja- miR-197, cja-miR-199, cja-miR-19a, cja-miR-19b, cja-miR-la, cja-miR-lb-3p, cja-miR-lb- 5p, cja-miR-200c, cja-miR-202, cja-miR-203, cja-miR-204. cja-miR-205, cja-miR-2053. cja- miR-206, cja-miR-208a, cja-miR-208b, cja-miR-20a, cja-miR-20b, cja-miR-21, cja-miR-211, cja-miR-2114, cja-miR-214, cja-miR-215, cja-miR-216a, cja-miR-216b, cja-miR-217, cja- miR-218, cja-miR-219, cja-miR-22, cja-miR-222, cja-miR-223. cja-miR-224, cja-miR-2338. cja-miR-2355, cja-miR-23a, cja-miR-23b, cja-miR-24, cja-miR-25. cja-miR-26a. cja-miR- 26b, cja-miR-27a, cja-miR-27b, cja-miR-28, cja-miR-296, cja-miR-2968, cja-miR-299, cja- miR-29a, cja-miR-29b, cja-miR-29c, cja-miR-301a, cja-miR-302a-3p, cja-miR-302a-5p, cja- miR-302b, cja-miR-302c, cja-miR-302d-3p, cja-miR-302d-5p, cj a-miR-3065, cja-miR-3074, cja-miR-30a, cja-miR-30b, cja-miR-30c, cja-miR-30d, cja-miR-30e, cja-miR-31, cja-miR- 3118, cja-miR-3120. cja-miR-3135, cja-miR-3152, cja-miR-32. cja-miR-320, cja-miR-323, cja-miR-324, cja-miR-328, cja-miR-329, cja-miR-33, cja-miR-330, cja-miR-331, cja-miR- 335-3p, cja-miR-335-5p, cja-miR-337, cja-miR-338, cja-miR-339, cja-miR-340, cja-miR- 342, cja-miR-345, cja-miR-34a, cja-miR-34b, cja-miR-34c, cja-miR-3544, cja-miR-3546, cja-miR-3576, cja-miR-361, cja-miR-363. cja-miR-365, cja-miR-367, cja-miR-3688, cja- miR-369-3p, cja-miR-369-5p, cja-miR-371a, cja-miR-371b-3p, cja-miR-371b-5p, cja-miR-372, cja-miR-373, cja-miR-374a, cja-miR-374b, cja-miR-376a-3p, cja-miR-376a-5p, cja- miR-376b, cja-miR-377. cja-miR-378. cja-miR-379, cja-miR-381, cja-miR-382, cja-miR- 383a, cja-miR-383b, cja-miR-3940, cja-miR-409, cja-miR-410, cja-miR-411, cja-miR-412, cja-miR-421, cja-miR-423-3p, cja-miR-423-5p, cja-miR-424, cja-miR-429, cja-miR-432, cja- miR-4460, cja-miR-448, cja-miR-449a, cja-miR-449c, cja-miR-4503, cja-miR-450a, cja- miR-450b, cja-miR-450c, cja-miR-451, cja-miR-4512, cja-miR-452, cja-miR-455, cja-miR- 466a. cja-miR-466b. cja-miR-4679, cja-miR-4683, cja-miR-4745, cja-miR-4762. cja-miR- 4772, cja-miR-4780, cja-miR-4790, cja-miR-483, cja-miR-484, cja-miR-485, cja-miR-487a, cja-miR-487b, cja-miR-488, cja-miR-489, cja-miR-491, cja-miR-493, cja-miR-494, cja-miR- 495, cja-miR-497, cja-miR-498, cja-miR-499a, cja-miR-499b, cja-miR-502b. cja-miR-503, cja-miR-504. cja-miR-505, cja-miR-506, cja-miR-507, cja-miR-508, cja-miR-509, cja-miR- 510a, cja-miR-510b, cja-miR-513a-3p, cja-miR-513a-5p, cja-miR-513b-5p, cja-miR-513c- 5p, cja-miR-513d-5p, cja-miR-513e-3p, cja-miR-513f-3p, cja-miR-513f-5p, cja-miR-513g- 3p, cja-miR-513h-3p, cja-miR-514a, cja-miR-514b, cja-miR-518a, cja-miR-518b, cja-miR- 5191, cja-miR-519a, cja-miR-519b, cja-miR-519c, cja-miR-521, cja-miR-523, cja-miR-532, cja-miR-539. cja-miR-541, cja-miR-542-3p. cja-miR-542-5p. cja-miR-543. cja-miR-544, cja- miR-545, cja-miR-548a, cja-miR-548b, cja-miR-548c, cja-miR-548d, cja-miR-548e, cja- miR-548f, cja-miR-548g, cja-miR-548h, cja-miR-548i, cja-miR-548j, cja-miR-548k, cja- miR-5481, cja-miR-548m, cja-miR-548n, cja-miR-548o, cja-miR-548p. cja-miR-548q, cja- miR-548r, cja-miR-548s, cja-miR-5481, cja-miR-548u, cja-miR-548v, cja-miR-548w, cja- miR-548x, cja-miR-548y, cja-miR-551, cja-miR-556, cja-miR-557, cja-miR-559, cja-miR- 561, cja-miR-569, cja-miR-577, cja-miR-580, cja-miR-581, cja-miR-582, cja-miR-584, cja- miR-586, cja-miR-589, cja-miR-598, cja-miR-612, cja-miR-615, cja-miR-616, cja-miR-617, cja-miR-622. cja-miR-628, cja-miR-631, cja-miR-638, cja-miR-651, cja-miR-6529, cja-miR- 652a, cja-miR-652b, cja-miR-653, cja-miR-654, cja-miR-655, cja-miR-656, cja-miR-660, cja-miR-665, cja-miR-670, cja-miR-671, cja-miR-675, cja-miR-676, cja-miR-7, cja-miR- 708, cja-miR-759, cja-miR-761, cja-miR-763, cja-miR-767, cja-miR-769, cja-miR-770, cja- miR-873, cja-miR-875-3p, cja-miR-875-5p, cja-miR-876. cja-miR-885, cja-miR-887-3p. cja- miR-887-5p. cja-miR-889. cja-miR-891b, cja-miR-891c, cja-miR-891d, cja-miR-9, cja-miR- 92a, cja-miR-92b, cja-miR-93, cja-miR-934, cja-miR-942, cja-miR-95, cja-miR-96, cja-miR- 98, cja-miR-99, cja-miR-9904, cja-miR-9905, cj a-miR-9906, cja-miR-9907, cja-miR-9908, cja-miR-9909, cja-miR-9910, cja-miR-9911, cja-miR-9912. cja-miR-9913, cja-miR-9914, cja-miR-9915, cja-miR-9916, cja-miR-9917, cja-miR-9918, cja-miR-9919, cja-miR-9921, cja-miR-9922, cja-miR-9923, cja-miR-9924, cja-miR-9925, cja-miR-9926, cja-miR-9927,cja-miR-9928, cja-miR-9929, cja-miR-9930, cja-miR-9931. cja-miR-9932, cja-miR-9933, cja-miR-9934, cja-miR-9935, cja-miR-9936, cja-miR-9937, cja-miR-9938, cja-miR-9939, cja-miR-9940, cja-miR-9941, cja-miR-9942, cja-miR-9943, cja-miR-9944, cja-miR-9945, cja-miR-9946, cja-miR-9947, cja-miR-9948a, cja-miR-9948b, cja-miR-9949, cja-miR-9950, cja-miR-9951, cja-miR-9952a, cja-miR-9952b, cja-miR-9952c, cja-miR-9953, cja-miR-9954, cja-miR-9955, cja-miR-9956, cja-miR-9957, cja-miR-9958. cja-miR-9959, cja-miR-9960, cja-miR-9961, cja-miR-9962, cja-miR-9963, cja-miR-9964, cja-miR-9965. cja-miR-9966, cja-miR-9967, cja-miR-9968, cja-miR-9969, cja-miR-9970, cja-miR-9971 , cja-miR-9972, cja-miR-9973, cja-miR-9974, cja-miR-9975, cja-miR-9976, cja-miR-9977, cja-miR-9978, cja-miR-9979, cja-miR-9980, cja-miR-9981, cja-miR-9982. cja-miR-9983, cja-miR-9984, cla-miR-1992, cla-miR- 1994, cli-let-7a-2-3p, cli-let-7a-3p, cli-let-7a-4-3p, cli-let-7a-5p, cli- let-7b-3p, cli-let-7c-3p, cli-let-7c-5p, cli-let-7d-3p, cli-let-7d-5p, cli-let-7e-3p, cli-let-7e-5p, cli-let-7f-3p, cli-let-7f-5p, cli-let-7g-3p, cli-let-7g-5p, cli-let-7i-3p, cli-let-7i-5p, cli-miR-100- 3p, cli-miR-100-5p, cli-miR-101-2-5p, cli-miR-101-3p, cli-miR-101-5p, cli-miR-103-3p, cli- miR-103-5p, cli-miR-106-3p, cli-miR-106-5p, cli-miR-107-3p, cli-miR-107-5p, cli-miR-lOa- 3p. cli-miR-10a-5p, cli-miR-10b-3p. cli-miR-10b-5p. cli-miR-10c-3p, cli-miR-10c-5p. cli- miR-122-3p, cli-miR-122-5p, cli-miR-124-2-5p, cli-miR-124-3p, cli-miR-124-5p, cli-miR- 125-2-3p, cli-miR-125-3p, cli-miR-125-5p, cli-miR-126-3p, cli-miR-126-5p, cli-miR-128-3p, cli-miR-128-5p, cli-miR-129-3p, cli-miR-129-5p, cli-miR-1306-3p, cli-miR-13O6-5p, cli- miR-13Oa-3p, cli-miR-13Oa-5p, cli-miR-130c-3p, cli-miR-130c-5p. cli-miR-1329-3p, cli- miR-1329-5p, cli-miR-133a-3p, cli-miR-133a-5p, cli-miR-133b-3p, cli-miR-133b-5p, cli- miR-133c-3p, cli-miR-135-2-3p, cli-miR-135-3-3p, cli-miR-135-3p, cli-miR-135-5p, cli- miR-137a-3p, cli-miR-137a-5p, cli-miR-137b-3p, cli-miR-137b-5p, cli-miR-138-2-3p, cli- miR-138-3p, cli-miR-138-5p, cli-miR-1388-3p, cli-miR-1388-5p, cli-miR-139-3p, cli-miR- 139-5p, cli-miR-140-3p, cli-miR-140-5p, cli-miR-1416-3p, cli-miR-1416-5p, cli-miR-142- 3p, cli-miR-142-5p, cli-miR-143-3p, cli-miR-143-5p, cli-miR-145-3p, cli-miR-145-5p, cli- miR-1451-3p, cli-miR-1451-5p, cli-miR-1467-3p, cli-miR-1467-5p, cli-miR-146a-3p, cli- miR-146a-5p, cli-miR-146b-3p, cli-miR-146b-5p, cli-miR-146c-3p, cli-miR-146c-5p, cli- miR-147-3p. cli-miR-148a-3p. cli-miR-148a-5p, cli-miR-148b-3p, cli-miR-153a-3p. cli-miR- 153a-5p, cli-miR-153b-3p, cli-miR-153b-5p, cli-miR-155-5p, cli-miR-1550-5p, cli-miR- 1552-3p, cli-miR-1552-5p, cli-miR-1559-3p, cli-miR-1559-5p, cli-miR-15a-3p, cli-miR-15a- 5p, cli-miR-15b-3p, cli-miR-15b-5p, cli-miR-15c-3p, cli-miR-15c-5p, cli-miR-1641-5p, cli- miR-1655-3p, cli-miR-1662-3p, cli-miR-1662-5 p. cli-miR-1677-3p, cli-miR-1677-5p, cli- miR-16a-2-3p, cli-miR-16a-3p, cli-miR-16a-5p, cli-miR-16b-3p, cli-miR-16b-5p, cli-miR-17-3p, cli-miR-17-5p, cli-miR-1720-3p, cli-miR-1720-5p, cli-miR-1729-3p, cli-miR-1729- 5p, cli-miR-1756a-3p, cli-miR-1756b-3p, cli-miR-1756b-5p, cli-miR-1781-3p, cli-miR-1782- 3p, cli-miR-1784-5p, cli-miR-1788-3p, cli-miR-1788-5p, cli-miR-1791-3p, cli-miR-1803-3p, cli-miR-1803-5p, cli-miR-1805-3p, cli-miR-1805-5p, cli-miR-181a-2-3p. cli-miR-181a-3p, cli-miR-181a-5p, cli-miR-181b-2-3p, cli-miR-181b-3p, cli-miR-181b-5p, cli-miR-182-3p, cli-miR-182-5p, cli-miR-183-3p, cli-miR-183-5p, cli-miR-184-3p, cli-miR-184-5p, cli-miR- 187-3p, cli-miR-187-5p. cli-miR-18a-3p, cli-miR-18a-5p. cli-miR-18b-3p, cli-miR-18b-5p, cli-miR-190-3p, cli-miR-190-5p, cli-miR-193-3p, cli-miR-193-5p, cli-miR-194-3p, cli-miR- 194-5p, cli-miR-196-3-3p, cli-miR-196-3p, cli-miR-196-5p, cli-miR-199-3p, cli-miR-199-5p, cli-miR-19a-3p, cli-miR-19a-5p, cli-miR-19b-2-5p, cli-miR-19b-3p, cli-miR-19b-5p. cli- miR-la-2-5p, cli-miR-la-3p, cli-miR-la-5p. cli-miR-lb-3p cli-miR-lb-5p?cli-miR-200a-3p, cli-miR-200a-5p cli-miR-200b-3p, cli-miR-200b-5p, cli-miR-202-5p, cli-miR-204-2-3p cli- miR-204-3-3p, cli-miR-204-3p, cli-miR-204-5p, cli-miR-205a-3p, cli-miR-205a-5p, cli-miR- 205b-3p, cli-miR-205b-5p, cli-miR-206-3p, cli-miR-206-5p, cli-miR-20a-3p, cli-miR-20a-5p, cli-miR-20b-3p, cli-miR-20b-5p, cli-miR-21-3p, cli-miR-21-5p, cli-miR-210-3p, cli-miR- 210-5p, cli-miR-2131-3p, cli-miR-2131-5p. cli-miR-214-3p, cli-miR-214-5p. cli-miR-215- 3p, cli-miR-215-5p, cli-miR-216a-3p, cli-miR-216a-5p, cli-miR-216b-3p, cli-miR-216b-5p, cli-miR-217-3p, cli-miR-217-5p, cli-miR-218-3p, cli-miR-218-5p, cli-miR-2188-3p, cli-miR- 2188-5p, cli-miR-22-3p, cli-miR-22-5p, cli-miR-221-3p, cli-miR-221-5p, cli-miR-222a-3p, cli-miR-222a-5p?cli-miR-222b-3p, cli-miR-223-3p. cli-miR-223-5p, cli-miR-23b-3p, cli- miR-23b-5p, cli-miR-26-2-3p, cli-miR-26-3p, cli-miR-26-5p, cli-miR-27b-3p, cli-miR-27b- 5p, cli-miR-2954-3p. cli-miR-2954-5p, cli-miR-2970-3p, cli-miR-2970-5p, cli-miR-2984-5p, cli-miR-29a-3p, cli-miR-29a-5p, cli-miR-29b-3p, cli-miR-29b-5p, cli-miR-301a-3p, cli-miR- 301a-5p, cli-miR-301b-3p. cli-miR-301b-5p, cli-miR-302a-3p, cli-miR-302b-3p, cli-miR- 302c-3p, cli-miR-3064-3p, cli-miR-30a-3p, cli-miR-30a-5p, cli-miR-30c-2-3p, cli-miR-30c- 3p, cli-miR-30c-5p, cli-miR-30d-3p, cli-miR-30d-5p, cli-miR-30e-3p, cli-miR-30e-5p, cli- miR-31-3p, cli-miR-31-5p, cli-miR-32-3p, cli-miR-32-5p, cli-miR-33-2-3p, cli-miR-33-3p, cli-miR-33-5p, cli-miR-338a-3p. cli-miR-338a-5p, cli-miR-338b-3p, cli-miR-338b-5p, cli- miR-34a-3p, cli-miR-34a-5p, cli-miR-34b-3p. cli-miR-34b-5p, cli-miR-34c-3p, cli-miR-34c- 5p, cli-miR-3618-3p cli-miR-3618-5p, cli-miR-363-3p, cli-miR-363-5p, cli-miR-365-2-5p, cli-miR-365-3p, cli-miR-365-5p, cli-miR-367-3p, cli-miR-375-3p, cli-miR-375-5p, cli-miR- 383-3p, cli-miR-383-5p, cli-miR-425-3p, cli-miR-425-5p, cli-miR-429-3p, cli-miR-429-5p, cli-miR-449a-5p?cli-miR-449b-3p, cli-miR-449b-5p, cli-miR-449c-3p. cli-miR-449c-5p, cli- miR-449d-3p, cli-miR-449d-5p, cli-miR-451-5p, cli-miR-454-3p, cli-miR-454-5p, cli-miR-455-3p, cli-miR-455-5p, cli-miR-456-3p, cli-miR-458-3p, cli-miR-458-5p, cli-miR-459-5p, cli-miR-460a-3p?cli-miR-460a-5p, cli-miR-460b-3p, cli-miR-460b-5p. cli-miR-489-3p, cli- miR-489-5p, cli-miR-490-3p, cli-miR-490-5p, cli-miR-499-3p, cli-miR-499-5p, cli-miR- 551a-3p, cli-miR-551a-5p, cli-miR-551b-3p, cli-miR-551b-5p, cli-miR-599-3p, cli-miR-737- 5p, cli-miR-7a-2-3p, cli-miR-7a-3-3p, cli-miR-7a-3p, cli-miR-7a-5p, cli-miR-7b-5p, cli-miR- 875-3p, cli-miR-875-5p, cli-miR-8993-3p. cli-miR-8993-5p, cli-miR-9-3-3p, cli-miR-9-3p, cli-miR-9-5p, cli-miR-92-2-5p, cli-miR-92-3p, cli-miR-92-5p, cli-miR-96-3p, cli-miR-96-5p, cli-miR-9615-3p, cli-miR-9615-5p, cli-miR-9616-3p, cli-miR-9616-5p cli-miR-9617-3p, cli- miR-9617-5p, cli-miR-9618-3p, cli-miR-9618-5p, cli-miR-9619-3p, cli-miR-9619-5p, cli- miR-9620-3p, cli-miR-9620-5p, cli-miR-9621-3p. cli-miR-9621-5p, cli-miR-9622-3p, cli- miR-9622-5p, cli-miR-9623-3p, cli-miR-9623-5p. cli-miR-9624-3p, cli-miR-9624-5p, cli- miR-9625-3p, cli-miR-9625-5p, cli-miR-9626-3p, cli-miR-9626-5p, cli-miR-9627-3p, cli- miR-9627-5p, cli-miR-9628-3p, cli-miR-9628-5p, cli-miR-9629-3p, cli-miR-9629-5p, cli- miR-9630-3p, cli-miR-9630-5p, cli-miR-9631-3p, cli-miR-9631-5p, cli-miR-9632-3p, cli- miR-9632-5p, cli-miR-9633-3p, cli-miR-9633-5p. cli-miR-9634-3p, cli-miR-9634-5p, cli- miR-9635-3p, cli-miR-9635-5p. cli-miR-9636-3p. cli-miR-9636-5p, cli-miR-9637-3p, cli- miR-9637-5p, cli-miR-9638-3p, cli-miR-9638-5p, cli-miR-9639-3p, cli-miR-9639-5p, cli- miR-9640-3p, cli-miR-9640-5p, cli-miR-9641-3p, cli-miR-9641-5p, cli-miR-9642-3p, cli- miR-9642-5p, cli-miR-9643-3p, cli-miR-9643-5p. cli-miR-9644-3p, cli-miR-9644-5p, cli- miR-9645-3p, cli-miR-9645-5p, cli-miR-9646-3p. cli-miR-9646-5p, cli-miR-9647-3p, cli- miR-9647-5p, cli-miR-9648-3p, cli-miR-9648-5p, cli-miR-9649-3p, cli-miR-9649-5p, cli- miR-99-3p, cli-miR-99-5p, cln-miR162, cln-miR164, cln-miR166, cln-miR6725, cme- miR156a, cme-miR156b, cme-miR156c, cme-miR156d, cme-miR156e, cme-miR156f, cme- miR156g, cme-miR156h, cme-miR156i. cme-miR156j, cme-miR159a, cme-miR159b, cme- miR160a, cme-miR160b, cme-miR160c, cme-miR160d, cme-miR162, cme-miR164a, cme- miR164b, cme-miR164c, cme-miR164d, cme-miR166a, cme-miR166b, cme-miR166c, cme- miR166d, cme-miR166e, cme-miR166f, cme-miR166g, cme-miR166h, cme-miR166i, cme- miR167a, cme-miR167b, cme-miR167c, cme-miR167d, cme-miR167e, cme-miR167f, cme- miR168, cme-miR169a, cme-miR169b, cme-miR169c, cme-miR169d, cme-miR169e, cme- miR169f cme-miR169g cme-miR169h, cme-miR169i, cme-miR169j, cme-miR169k, cme- miR1691, cme-miR169m, cme-miR169n, cme-miR169o, cme-miR169p, cme-miR169q, cme- miR169r. cme-miR169s, cme-miR169t, cme-miR171a, cme-miR171b, cme-miR171c, cme- miR171d, cme-miR171e, cme-miR171f. cme-miR171g?cme-miR171h?cme-miR171i, cme- miR172a, cme-miR172b, cme-miR172c, cme-miR172d, cme-miR172e, cme-miR172f, cme-miR1863, cme-miR211 la, cme-miR2111b, cme-miR319a, cme-miR319b, cme-miR319c, cme-miR319d, cme-miR390a, cme-miR390b, cme-miR390c, cme-miR390d, cme-miR393a, cme-miR393b, cme-miR393c, cme-miR394a, cme-miR394b, cme-miR395a, cme-miR395b, cme-miR395c, cme-miR395d, cme-miR395e, cme-miR395f, cme-miR396a, cme-miR396b, cme-miR396c, cme-miR396d, cme-miR396e, cme-miR397, cme-miR398a, cme-miR398b, cme-miR399a, cme-miR399b, cme-miR399c, cme-miR399d, cme-miR399e, cme-miR399f, cme-miR399g. cme-miR408, cme-miR477a, cme-miR477b, cme-miR530a, cme-miR530b, cme-miR7129, cme-miR7130, cme-miR828, cme-miR845, cme-miR854, cme-miR858, cpa- miR156a, cpa-miR156b, cpa-miR156c, cpa-miR156d, cpa-miR156e, cpa-miR156f, cpa- miR159a, cpa-miR159b, cpa-miR160a, cpa-miR160b, cpa-miR160c-3p, cpa-miR160c-5p, cpa-miR160d, cpa-miR160e, cpa-miR160f-3p, cpa-miR160f-5p, cpa-miR162a. cpa-miR164a, cpa-miR164b, cpa-miR164c, cpa-miR164d, cpa-miR164e, cpa-miR166a, cpa-miR166b, cpa- miR166c, cpa-miR166d, cpa-miR166e, cpa-miR167a, cpa-miR167b, cpa-miR167c, cpa- miR167d, cpa-miR169, cpa-miR171a, cpa-miR171b, cpa-miR171c, cpa-miR171d, cpa- miR172a, cpa-miR172b, cpa-miR319, cpa-miR390a, cpa-miR390b, cpa-miR393, cpa- miR394a, cpa-miR394b. cpa-miR395a, cpa-miR395b, cpa-miR395c. cpa-miR395d, cpa- miR395e, cpa-miR396, cpa-miR398, cpa-miR408, cpa-miR477, cpa-miR5211, cpa-miR535, cpa-miR8134, cpa-miR8135, cpa-miR8136, cpa-miR8137, cpa-miR8138, cpa-miR8139a, cpa-miR8139b, cpa-miR8139c, cpa-miR8139d, cpa-miR8139e, cpa-miR8140, cpa-miR8141, cpa-miR8142, cpa-miR8143, cpa-miR8144. cpa-miR8145, cpa-miR8146, cpa-miR8147. cpa- miR8148, cpa-miR8149, cpa-miR8150, cpa-miR8151, cpa-miR8152, cpa-miR8153, cpa- miR8154, cpa-miR8155, cpi-let-7a-2-3p, cpi-let-7a-3p, cpi-let-7a-4-3p, cpi-let-7a-5p, cpi-let- 7b-5p, cpi-let-7c-2-3p, cpi4et-7c-3p, cpi-let-7c-5p, cpi-let-7d-3p, cpi-let-7d-5p, cpi-let-7e-3p, cpi-let-7e-5p, cpi-let-7f-3p, cpi-let-7f-5p, cpi-let-7g-3p, cpi-let-7g-5p, cpi-let-7i-3p, cpi-let- 7i-5p, cpi-miR-100-3p, cpi-miR-100-5p, cpi-miR-101-2-5p, cpi-miR-101-3p, cpi-miR-101- 5p, cpi-miR-103-3p, cpi-miR-103-5p, cpi-miR-106a-5p, cpi-miR-106b-5p, cpi-miR-107-3p, cpi-miR-10a-3p, cpi-miR-10a-5p, cpi-miR-10b-3p, cpi-miR-10b-5p, cpi-miR-10c-3p, cpi- miR-10c-5p, cpi-miR-122-3p, cpi-miR-122-5p, cpi-miR-124-3p, cpi-miR-124-5p, cpi-miR- 125a-3p, cpi-miR-125a-5p, cpi-miR-125b-2-3p. cpi-miR-125b-3p, cpi-miR-125b-5p, cpi- miR-126-3p, cpi-miR-126-5p, cpi-miR-128-2-5p, cpi-miR-128-3p, cpi-miR-128-5p, cpi-miR- 129-2-3p, cpi-miR-129-3p, cpi-miR-129-5p, cpi-miR-1306-3p, cpi-miR-1306-5p, cpi-miR- 130a-3p, cpi-miR-130a-5p, cpi-miR-130b-3p, cpi-miR-130b-5p, cpi-miR-130c-3p, cpi-miR- 130c-5p, cpi-miR-130d-3p, cpi-miR-132-3p, cpi-miR-132-5p, cpi-miR-1329-5p, cpi-miR- 133a-3p, cpi-miR-133a-5p, cpi-miR-133b-3p, cpi-miR-133c-3p, cpi-miR-135-2-3p, cpi-miR-135-3-3p, cpi-miR-135-3p, cpi-miR-135-5p, cpi-miR-137a-3p, cpi-miR-137b-3p, cpi-miR- 138-3p, cpi-miR-138-5p cpi-miR-1388-3p, cpi-miR-1388-5p, cpi-miR-139-3p, cpi-miR-139- 5p, cpi-miR- 1397 -5 p, cpi-miR-140-3p, cpi-miR-140-5p, cpi-miR-1416-5p, cpi-miR- 142-3p, cpi-miR-142-5p, cpi-miR-143-3p, cpi-miR-143-5p, cpi-miR-144-3p, cpi-miR-144-5p, cpi- miR-145-3p, cpi-miR-145-5p, cpi-miR-146a-3p, cpi-miR-146a-5p, cpi-miR-146b-3p, cpi- miR-146b-5p, cpi-miR- 146c-3p, cpi-miR-146c-5p, cpi-miR-147-3p, cpi-miR-147-5p, cpi- miR-148a-3p, cpi-miR-148a-5p. cpi-miR-148b-3p, cpi-miR-152-3p, cpi-miR-152-5p, cpi- miR-153-3p, cpi-miR-153-5p, cpi-miR-155a-5p, cpi-miR-155b-5p, cpi-miR-15a-5p, cpi- miR-15b-3p, cpi-miR-15b-5p, cpi-miR-15 c-3p, cpi-miR-15 c-5p, cpi-miR-164 l-5p, cpi-miR- 1662-3p, cpi-miR-1662-5p, cpi-miR-1677a-3p, cpi-miR-1677a-5p, cpi-miR-1677b-3p, cpi- miR-1677b-5p?cpi-miR-1677c-3p, cpi-miR-1677c-5p, cpi-miR-1677d-3p, cpi-miR-1677d- 5p, cpi-miR-1677e-3p, cpi-miR- 1677e-5p, cpi-miR-1677f-3p, cpi-miR-1677g-3p, cpi-miR- 1677h-3p, cpi-miR-1677h-5p, cpi-miR-16a-3p, cpi-miR-16a-5p, cpi-miR-16b-3p, cpi-miR- 16b-5p, cpi-miR- 16c-3p, cpi-miR-16c-5p, cpi-miR-17-3p, cpi-miR-17-5p, cpi-miR-1720-3p, cpi-miR-1729-3p, cpi-miR-1729-5p. cpi-miR-1784-3p, cpi-miR-1788-3p, cpi-miR-1788-5p, cpi-miR-179 l-5p, cpi-miR-1805-3p. cpi-miR- 1805-5p, cpi-miR-18 la-2-3p, cpi-miR-181 a-3- 3p, cpi-miR-181 a-3p, cpi-miR-181a-5p, cpi-miR-18 lb-l-3p, cpi-miR-181b-3p, cpi-miR- 181b-5p, cpi-miR-182-3p, cpi-miR-182-5p, cpi-miR-183-5p, cpi-miR-184-3p, cpi-miR-187- 3p, cpi-miR-187-5p, cpi-miR- 18a-3p, cpi-miR-18 a-5p, cpi-miR-18b-3p, cpi-miR-18b-5p, cpi-miR-190a-5p, cpi-miR- 190b-5p. cpi-miR-191-5p. cpi-miR- 192-3p. cpi-miR-192-5p. cpi- miR-193a-3p, cpi-miR-193a-5p, cpi-miR- 193b-3p, cpi-miR-194-2-3p, cpi-miR-194-3 p. cpi- miR- 194-5p, cpi-miR- 196-2-3p, cpi-miR- 196-3p, cpi-miR- 196-5p, cpi-miR- 199-3p, cpi-miR- 199-5p, cpi-miR- 19a-3p, cpi-miR- 19a-5p, cpi-miR- 19b-2-5p, cpi-miR- 19b-3p, cpi-miR-19b- 5p, cpi-miR- la-2-5p. cpi-miR- la-3p, cpi-miR-la-5p, cpi-miR- lb-3p, cpi-miR- lb-5p, cpi- miR-200a-3p, cpi-miR-200a-5p, cpi-miR-200b-3p, cpi-miR-200b-5p, cpi-miR-202-5p, cpi- miR-203-3p, cpi-miR-203-5p, cpi-miR-204-3-3p, cpi-miR-204-3p, cpi-miR-204-5p, cpi-miR- 205a-3p, cpi-miR-205a-5p, cpi-miR-205b-5p, cpi-miR-206-3p, cpi-miR-206-5p, cpi-miR- 208-5p, cpi-miR-20a-3p. cpi-miR-20a-5p, cpi-miR-20b-3p, cpi-miR-20b-5p, cpi-miR-21-3p, cpi-miR-21-5p, cpi-miR-210-3p?cpi-miR-210-5p. cpi-miR-212-5p. cpi-miR-214-3p. cpi- miR-214-5p, cpi-miR-215-3p, cpi-miR-215-5p, cpi-miR-216a-5p, cpi-miR-216b-5p, cpi- miR-217-5p, cpi-miR-218-3p, cpi-miR-218-5p, cpi-miR-2184-3p, cpi-miR-2184-5p, cpi- miR-2188-3p, cpi-miR-2188-5p, cpi-miR-219-3p, cpi-miR-219-5p, cpi-miR-22-3p, cpi-miR- 22-5p, cpi-miR-221-3p, cpi-miR-221-5p, cpi-miR-222a-3p. cpi-miR-222a-5p, cpi-miR-222b- 3p, cpi-miR-222b-5p, cpi-miR-223-3p, cpi-miR-223-5p, cpi-miR-23a-3p, cpi-miR-23b-3p,cpi-miR-24-2-5p, cpi-miR-24-3p, cpi-miR-24-5p, cpi-miR-26-2-3p, cpi-miR-26-3-3p, cpi- miR-26-3p, cpi-miR-26-5p, cpi-miR-27a-3p, cpi-miR-27a-5p, cpi-miR-27b-3p, cpi-miR-27b- 5p, cpi-miR-2970-3p, cpi-miR-2970-5p, cpi-miR-2984-3p, cpi-miR-29a-2-5p, cpi-miR-29a- 3p, cpi-miR-29a-5p, cpi-miR-29b-2-5p, cpi-miR-29b-3p, cpi-miR-29b-5p, cpi-miR-301a-3p, cpi-miR-301b-3p, cpi-miR-302a-3p, cpi-miR-302b-3p, cpi-miR-302c-3p, cpi-miR-302d-3p, cpi-miR-3064-3p, cpi-miR-30a-3p, cpi-miR-30a-5p, cpi-miR-30b-3p, cpi-miR-30b-5p. cpi- miR-30c-2-3p. cpi-miR-30c-3p, cpi-miR-30c-5p, cpi-miR-30d-3p, cpi-miR-30d-5p, cpi-miR- 30e-3p, cpi-miR-30e-5p, cpi-miR-31-3p, cpi-miR-31-5p, cpi-miR-32-3p, cpi-miR-32-5p, cpi- miR-33-2-3p, cpi-miR-33-3p, cpi-miR-33-5p, cpi-miR-338a-3p, cpi-miR-338a-5p, cpi-miR- 338b-3p, cpi-miR-338b-5p, cpi-miR-34a-3p, cpi-miR-34a-5p, cpi-miR-34b-3p, cpi-miR-34b- 5p, cpi-miR-34c-3p, cpi-miR-34c-5p, cpi-miR-3618-3p, cpi-miR-363-3p?cpi-miR-363-5p. cpi-miR-365-3p, cpi-miR-365-5p, cpi-miR-367-3p, cpi-miR-375-3p, cpi-miR-383-5p, cpi- miR-425-3p, cpi-miR-425-5p, cpi-miR-429-3p, cpi-miR-449a-3p, cpi-miR-449a-5p, cpi- miR-449b-5p, cpi-miR-449c-5p, cpi-miR-449d-5p, cpi-miR-451-3p, cpi-miR-451-5p, cpi- miR-454-3p, cpi-miR-454-5p, cpi-miR-455-3p, cpi-miR-455-5p, cpi-miR-456-3p, cpi-miR- 458-3p, cpi-miR-458-5p. cpi-miR-459-3p. cpi-miR-459-5p. cpi-miR-460a-3p, cpi-miR-460a- 5p, cpi-miR-460b-5p, cpi-miR-489-3p, cpi-miR-489-5p, cpi-miR-490-3p, cpi-miR-490-5p, cpi-miR-499-3p, cpi-miR-499-5p, cpi-miR-551-2-3p, cpi-miR-551-3p, cpi-miR-551-5p, cpi- miR-599-3p, cpi-miR-726-3p, cpi-miR-727-3p, cpi-miR-737-5p, cpi-miR-7a-2-3p, cpi-miR- 7a-3-3p, cpi-miR-7a-3p, cpi-miR-7a-5p. cpi-miR-7b-5p, cpi-miR-875-5p, cpi-miR-9-3p. cpi- miR-9-4-3p, cpi-miR-9-5p, cpi-miR-92a-2-5p, cpi-miR-92a-3p, cpi-miR-92a-5p, cpi-miR- 92b-3p, cpi-miR-92b-5p. cpi-miR-92c-3p, cpi-miR-92c-5p, cpi-miR-93-3p, cpi-miR-93-5p, cpi-miR-9578-3p, cpi-miR-9578-5p, cpi-miR-9579-3p, cpi-miR-9579-5p, cpi-miR-9580-3p, cpi-miR-9580-5p, cpi-miR-9581-3p. cpi-miR-9581-5p, cpi-miR-9582-3p, cpi-miR-9582-5p, cpi-miR-9583-3p, cpi-miR-9583-5p, cpi-miR-9584-3p, cpi-miR-9584-5p, cpi-miR-9585-3p, cpi-miR-9585-5p, cpi-miR-9586-3p, cpi-miR-9586-5p, cpi-miR-9587-3p, cpi-miR-9587-5p, cpi-miR-9588-3p, cpi-miR-9588-5p, cpi-miR-9589-3p, cpi-miR-9589-5p, cpi-miR-9590-3p, cpi-miR-9590-5p, cpi-miR-9591-3p. cpi-miR-9591-5p, cpi-miR-9592-3p, cpi-miR-9592-5p, cpi-miR-9593-3p, cpi-miR-9593-5p. cpi-miR-9594-3p, cpi-miR-9594-5p, cpi-miR-9595-3p. cpi-miR-9595-5p, cpi-miR-9596-3p, cpi-miR-9596-5p, cpi-miR-9597-3p, cpi-miR-9597-5p, cpi-miR-96-5p, cpi-miR-98-3p, cpi-miR-98-5p, cpi-miR-99a-3p, cpi-miR-99a-5p, cpi-miR- 99b-3p, cpi-miR-99b-5p. cpo-let-7a-2-3p, cpo-let-7a-3p, cpo4et-7a-5p, cpo-let-7b-3p, cpo- let-7b-5p, cpo-let-7c-3p, cpo-let-7c-5p, cpo4et-7d-3p. cpo-let-7d-5p, cpo-let-7e-3p, cpo-let- 7e-5p, cpo-let-7f-2-3p, cpo-let-7f-3p, cpo-let-7f-5p, cpo-let-7g-3p, cpo-let-7g-5p, cpo-let-7i-3p, cpo-let-7i-5p, cpo-miR-100-3p, cpo-miR-100-5p, cpo-miR-101-2-5p, cpo-miR-101-3p, cpo-miR-101-5p?cpo-miR-103-2-5p, cpo-miR-103-3p, cpo-miR-103-5p. cpo-miR-105-3p, cpo-miR-105-5p, cpo-miR-106a-3p, cpo-miR-106a-5p, cpo-miR-106b-3p, cpo-miR-106b-5p, cpo-miR-107-3p. cpo-miR-107-5p, cpo-miR-10a-3p, cpo-miR-10a-5p, cpo-miR-10b-3p, cpo- miR-10b-5p, cpo-miR-1185-3p, cpo-miR-1185-5p, cpo-miR-1193-3p, cpo-miR-1193-5p, cpo-miR-1197-3p, cpo-miR-1197-5p, cpo-miR-12072-3p, cpo-miR-12072-5p, cpo-miR- 12073-3p, cpo-miR-12073-5p. cpo-miR-12074-3p, cpo-miR-12074-5p. cpo-miR-12075-3p, cpo-miR-12075-5p, cpo-miR-12076-3p, cpo-miR-12076-5p, cpo-miR-12077-3p, cpo-miR- 12077-5p, cpo-miR-12078-3p, cpo-miR-12078-5p, cpo-miR-12079-3p, cpo-miR-12079-5p, cpo-miR-12080-3p, cpo-miR-12080-5p, cpo-miR-12081-3p, cpo-miR-12081-5p, cpo-miR- 12082-3p, cpo-miR-12082-5p. cpo-miR-12083-3p, cpo-miR-12083-5p. cpo-miR-12084-3p, cpo-miR-12084-5p, cpo-miR-122-3p, cpo-miR-122-5p, cpo-miR-124-3p cpo-miR-124-5p, cpo-miR-1247-3p, cpo-miR-1247-5p, cpo-miR-1251-3p, cpo-miR-1251-5p, cpo-miR-125a- 3p, cpo-miR-125a-5p, cpo-miR-125b-2-3p, cpo-miR-125b-3p, cpo-miR-125b-5p, cpo-miR-126-3p, cpo-miR-126-5p, cpo-miR-1264-3p, cpo-miR-1264-5 p, cpo-miR-127-3p, cpo-miR-127-5p, cpo-miR-1271-3p. cpo-miR-127 l-5p. cpo-miR-1277-3p. cpo-miR-1277-5p, cpo- miR-128-2-5p, cpo-miR-128-3p, cpo-miR-128-5p, cpo-miR-129-2-3p, cpo-miR-129-3p, cpo- miR-129-5p, cpo-miR-1296-3p, cpo-miR-1296-5p, cpo-miR-1298-3p, cpo-miR-1298-5p, cpo-miR-1301 -3p, cpo-miR-130 l-5p, cpo-miR-130a-3p, cpo-miR-130a-5p, cpo-miR-130b- 3p, cpo-miR-130b-5p, cpo-miR-132-3p. cpo-miR-132-5p, cpo-miR-133a-3p. cpo-miR-133a- 5p, cpo-miR-133b-3p, cpo-miR-133b-5p, cpo-miR-134-3p, cpo-miR-134-5p, cpo-miR-1343- 3p, cpo-miR-1343-5p, cpo-miR-135a-2-3p, cpo-miR-135a-3p, cpo-miR-135a-5p, cpo-miR- 135b-3p, cpo-miR-135b-5p, cpo-miR-136-3p, cpo-miR-136-5p, cpo-miR-1379-3p, cpo-miR- 1379-5p, cpo-miR-138-2-3 p cpo-miR-138-3p, cpo-miR-138-5p, cpo-miR-1388-3p, cpo- miR-1388-5p, cpo-miR-139-3p, cpo-miR-139-5p, cpo-miR-140-3p, cpo-miR-140-5p, cpo- miR-141-3p, cpo-miR-141-5p, cpo-miR-142-3p, cpo-miR-142-5p, cpo-miR-143-3p, cpo- miR-143-5p, cpo-miR-144-3p, cpo-miR-144-5p, cpo-miR-145-3p, cpo-miR-145-5p, cpo- miR-146a-3p, cpo-miR-146a-5p, cpo-miR-146b-3p. cpo-miR-146b-5p, cpo-miR-147-3p, cpo-miR-147-5p cpo-miR-148a-3p. cpo-miR-148a-5p, cpo-miR-148b-3p, cpo-miR-148b-5p, cpo-miR-149-3p cpo-miR-149-5p, cpo-miR-150-3p, cpo-miR-150-5p, cpo-miR-15 l-3p, cpo- miR-151-5p, cpo-miR-152-3p, cpo-miR-152-5p, cpo-miR-153-3p, cpo-miR-1 3-5p, cpo- miR-154-3p, cpo-miR-154-5p, cpo-miR-155-3p, cpo-miR-155-5p, cpo-miR-1 a-3p, cpo- miR-15a-5p, cpo-miR-15b-3p. cpo-miR-15b-5p, cpo-miR-16a-3p, cpo-miR-16a-5p, cpo- miR-16b-3p, cpo-miR-16b-5p, cpo-miR-17-3p, cpo-miR-17-5p, cpo-miR-18 la-2-3p, cpo-miR-181a-3p, cpo-miR-181a-5p, cpo-miR-181b-2-3p, cpo-miR-181b-3p, cpo-miR-181b-5p, cpo-miR-181c-3p, cpo-miR-181c-5p, cpo-miR-182-3p, cpo-miR-182-5p. cpo-miR-183-3p, cpo-miR-183-5p, cpo-miR-184-3p, cpo-miR-184-5p, cpo-miR-1842-3p, cpo-miR-1842-5p, cpo-miR-185-3p. cpo-miR-185-5p, cpo-miR-186-3p, cpo-miR-186-5p, cpo-miR-187-3p, cpo- miR-187-5p, cpo-miR-188-3p, cpo-miR-188-5p, cpo-miR-18a-3p, cpo-miR-18a-5p, cpo- miR-18b-3p, cpo-miR-18b-5p. cpo-miR-190a-3p, cpo-miR-190a-5p, cpo-miR-190b-3p, cpo- miR-190b-5p, cpo-miR-191-3p, cpo-miR-191-5p. cpo-miR-192-3p, cpo-miR-192-5p, cpo- miR-193a-3p, cpo-miR-193 a-5p, cpo-miR-193b-3p, cpo-miR-193b-5p, cpo-miR-194-3p, cpo-miR-194-5p. cpo-miR-195-3p, cpo-miR-195 -5p, cpo-miR-196a-3p, cpo-miR-196a-5p, cpo-miR-196b-3p, cpo-miR-196b-5p, cpo-miR-196c-3p, cpo-miR-196c-5p, cpo-miR-197-3p, cpo-miR-197-5p cpo-miR-199-3-5p, cpo-miR-199-3p, cpo-miR-199-5p. cpo-miR-19a-3p. cpo-miR-19a-5p, cpo-miR-19b-2-5p, cpo-miR-19b-3p, cpo-miR-19b-5p, cpo-miR-1 a-3p, cpo-miR-1 a-5p, cpo-miR-lb-3p, cpo-miR-1 b-5p, cpo-miR-200a-3p, cpo-miR-200a-5p, cpo- miR-200b-3p, cpo-miR-200b-5p, cpo-miR-200c-3p, cpo-miR-200c-5p, cpo-miR-202-3p, cpo-miR-202-5p?cpo-miR-203-3p, cpo-miR-203-5p, cpo-miR-204-3p, cpo-miR-204-5p. cpo- miR-205-3p. cpo-miR-205-5p. cpo-miR-206-3p, cpo-miR-206-5p, cpo-miR-208a-3p, cpo- miR-208a-5p, cpo-miR-208b-3p, cpo-miR-208b-5p, cpo-miR-20a-3p, cpo-miR-20a-5p, cpo- miR-20b-3p, cpo-miR-20b-5p, cpo-miR-21-3p, cpo-miR-21-5p, cpo-miR-210-3p, cpo-miR- 210-5p, cpo-miR-21 l-3p, cpo-miR-211-5p, cpo-miR-212-3p, cpo-miR-212-5p, cpo-miR- 214-3p, cpo-miR-214-5p, cpo-miR-215-3p, cpo-miR-215-5p. cpo-miR-216a-3p, cpo-miR- 216a-5p, cpo-miR-216b-3p, cpo-miR-216b-5p, cpo-miR-217-3p, cpo-miR-217-5p, cpo-miR- 218-2-3p, cpo-miR-218-3p, cpo-miR-218-5p, cpo-miR-219b-3p, cpo-miR-219b-5p, cpo- miR-22-3p, cpo-miR-22-5p, cpo-miR-221-3p, cpo-miR-221-5p, cpo-miR-222-3p, cpo-miR- 222-5p, cpo-miR-223-3p, cpo-miR-223-5p, cpo-miR-224-3p, cpo-miR-224-5p, cpo-miR- 2355-3p, cpo-miR-2355-5p, cpo-miR-2387-3p, cpo-miR-2387-5p, cpo-miR-23a-3p, cpo- miR-23a-5p, cpo-miR-23b-3p, cpo-miR-23b-5p, cpo-miR-24-2-5p, cpo-miR-24-3p, cpo- miR-24-5p, cpo-miR-25-3p, cpo-miR-25-5p, cpo-miR-26a-2-3p, cpo-miR-26a-3p, cpo-miR- 26a-5p. cpo-miR-26b-3p, cpo-miR-26b-5p, cpo-miR-27a-3p, cpo-miR-27a-5p, cpo-miR-27b- 3p, cpo-miR-27b-5p. cpo-miR-28-3p, cpo-miR-28-5p, cpo-miR-290-3p, cpo-miR-290-5p, cpo-miR-296-3p cpo-miR-296-5p, cpo-miR-299-3p, cpo-miR-299-5p, cpo-miR-29a-3p, cpo- miR-29a-5p, cpo-miR-29b-2-5p, cpo-miR-29b-3p, cpo-miR-29b-5p, cpo-miR-29c-3p, cpo- miR-29c-5p, cpo-miR-301a-3p, cpo-miR-301a-5p, cpo-miR-301b-3p, cpo-miR-301b-5p, cpo-miR-302a-3p, cpo-miR-302a-5p, cpo-miR-302b-3p, cpo-miR-302b-5p, cpo-miR-302c- 3p, cpo-miR-302c-5p, cpo-miR-302d-3p, cpo-miR-302d-5p, cpo-miR-3059-3p, cpo-miR-3059-5p, cpo-miR-3085-3p, cpo-miR-3085-5p, cpo-miR-30a-3p, cpo-miR-30a-5p, cpo-miR- 30b-3p, cpo-miR-30b-5p, cpo-miR-30c-2-3p, cpo-miR-30c-3p, cpo-miR-30c-5p. cpo-miR- 30d-3p, cpo-miR-30d-5p, cpo-miR-30e-3p, cpo-miR-30e-5p, cpo-miR-31-3p, cpo-miR-31- 5p, cpo-miR-32-3p, cpo-miR-32-5p, cpo-miR-323a-3p, cpo-miR-323a-5p, cpo-miR-323b-3p, cpo-miR-323b-5p, cpo-miR-324-3p, cpo-miR-324-5p, cpo-miR-326-3p, cpo-miR-326-5p, cpo-miR-328-3p. cpo-miR-328-5p, cpo-miR-329-3p, cpo-miR-329-5p, cpo-miR-330-3p. cpo- miR-330-5p. cpo-miR-331-3p. cpo-miR-331-5p, cpo-miR-335-3p, cpo-miR-335-5p, cpo- miR-337-3p, cpo-miR-337-5p, cpo-miR-338-3p, cpo-miR-338-5p, cpo-miR-339-3p, cpo- miR-339-5p, cpo-miR-33a-3p, cpo-miR-33a-5p, cpo-miR-33b-3p, cpo-miR-33b-5p, cpo- miR-340-3p, cpo-miR-340-5p. cpo-miR-342-3p, cpo-miR-342-5p, cpo-miR-345-3p, cpo- miR-345-5p, cpo-miR-346-3p. cpo-miR-346-5p, cpo-miR-34a-3p, cpo-miR-34a-5p, cpo- miR-34b-3p, cpo-miR-34b-5p, cpo-miR-34c-3p, cpo-miR-34c-5p, cpo-miR-350-3p, cpo- miR-350-5p, cpo-miR-361-3p, cpo-miR-361-5p, cpo-miR-3613-3p, cpo-miR-3613-5p, cpo- miR-362-3p, cpo-miR-362-5p, cpo-miR-363-3p, cpo-miR-363-5p, cpo-miR-365-2-5p, cpo- miR-365-3p, cpo-miR-365-5p. cpo-miR-367-3p, cpo-miR-367-5p, cpo-miR-369-3p, cpo- miR-369-5p. cpo-miR-370-3p. cpo-miR-370-5p, cpo-miR-374-3p, cpo-miR-374-5p. cpo- miR-375-3p, cpo-miR-375-5p, cpo-miR-376a-3p, cpo-miR-376a-5p, cpo-miR-376b-3p, cpo- miR-376b-5p, cpo-miR-376c-3p, cpo-miR-376c-5p, cpo-miR-376d-3p, cpo-miR-376d-5p, cpo-miR-377-3p. cpo-miR-377-5p, cpo-miR-378-3p, cpo-miR-378-5p, cpo-miR-379-3p. cpo- miR-379-5p, cpo-miR-380-3p. cpo-miR-380-5p, cpo-miR-381-3p, cpo-miR-381-5p, cpo- miR-382-3p, cpo-miR-382-5p, cpo-miR-383-3p, cpo-miR-383-5p, cpo-miR-3959-3p, cpo- miR-3959-5p, cpo-miR-409-3p, cpo-miR-409-5p, cpo-miR-410-3p, cpo-miR-410-5p, cpo- miR-411-3p, cpo-miR-41 l-5p, cpo-miR-412-3p, cpo-miR-412-5p, cpo-miR-423-3p, cpo- miR-423-5p, cpo-miR-424-3p. cpo-miR-424-5p, cpo-miR-425-3p, cpo-miR-425-5p, cpo- miR-429-3p, cpo-miR-429-5p, cpo-miR-431-3p, cpo-miR-431-5p, cpo-miR-432-3p, cpo- miR-432-5p, cpo-miR-433-3p, cpo-miR-433-5p, cpo-miR-448-3p, cpo-miR-448-5p, cpo- miR-449a-3p, cpo-miR-449a-5p, cpo-miR-449c-3p, cpo-miR-449c-5p, cpo-miR-450a-2-3p, cpo-miR-450a-3p, cpo-miR-450a-5p, cpo-miR-450b-3p, cpo-miR-450b-5p, cpo-miR-451-5p, cpo-miR-452-3p?cpo-miR-452-5p, cpo-miR-454-3p, cpo-miR-454-5p. cpo-miR-455-3p. cpo- miR-455-5p, cpo-miR-483-3p, cpo-miR-483-5p, cpo-miR-485-3p, cpo-miR-485-5p, cpo- miR-486-3p, cpo-miR-486-5p, cpo-miR-487a-3p, cpo-miR-487a-5p, cpo-miR-487b-3p, cpo- miR-487b-5p, cpo-miR-490-3p, cpo-miR-490-5p, cpo-miR-491-3p, cpo-miR-491-5p, cpo- miR-493-3p, cpo-miR-493-5p. cpo-miR-494-3p, cpo-miR-494-5p, cpo-miR-495-3p, cpo- miR-495-5p, cpo-miR-496-3p, cpo-miR-496-5p, cpo-miR-497-3p, cpo-miR-497-5p, cpo-miR-499-3p, cpo-miR-499-5p. cpo-miR-500a-3p, cpo-miR-500a-5p, cpo-miR-500b-3p, cpo- miR-500b-5p, cpo-miR-501-3p, cpo-miR-501-5p. cpo-miR-502a-3p, cpo-miR-502a-5p, cpo- miR-503-3p, cpo-miR-503-5p, cpo-miR-504-3p, cpo-miR-504-5p, cpo-miR-505-3p, cpo- miR-505-5p, cpo-miR-506-3p, cpo-miR-506-5p, cpo-miR-507a-3p, cpo-miR-507a-5p, cpo- miR-507b-3p, cpo-miR-507b-5p, cpo-miR-507c-3p, cpo-miR-507c-5p, cpo-miR-509a-3p, cpo-miR-509a-5p, cpo-miR-509b-3p, cpo-miR-509b-5p, cpo-miR-509c-3p, cpo-miR-509c- 5p. cpo-miR-509d-3p, cpo-miR-509d-5p, cpo-miR-509e-3p, cpo-miR-509e-5p, cpo-miR- 509f-3p, cpo-miR-509f-5p, cpo-miR-51 1 -3p, cpo-miR-51 1 -5p, cpo-miR-513-3p, cpo-miR- 513-5p, cpo-miR-526-3p, cpo-miR-526-5p, cpo-miR-532-3p, cpo-miR-532-5p, cpo-miR- 539-3p, cpo-miR-539-5p, cpo-miR-541-3p, cpo-miR-541-5p, cpo-miR-542-3p, cpo-miR- 542-5p, cpo-miR-543-3p, cpo-miR-543-5p, cpo-miR-545-3p. cpo-miR-545-5p, cpo-miR- 55 l-3p, cpo-miR-551-5p, cpo-miR-574-3p, cpo-miR-574-5p, cpo-miR-582-3p, cpo-miR- 582-5p, cpo-miR-615-3p, cpo-miR-615-5p, cpo-miR-652-3p, cpo-miR-652-5p, cpo-miR- 6529-3p, cpo-miR-6529-5p, cpo-miR-653-3p, cpo-miR-653-5p, cpo-miR-654-3p, cpo-miR- 654-5p, cpo-miR-655-3p, cpo-miR-655-5p, cpo-miR-656-3p, cpo-miR-656-5p, cpo-miR- 660-3p, cpo-miR-660-5p, cpo-miR-670-3p, cpo-miR-670-5p. cpo-miR-671-3p, cpo-miR- 671-5p, cpo-miR-672-3p, cpo-miR-672-5p, cpo-miR-675-3p, cpo-miR-675-5p, cpo-miR- 676-3p, cpo-miR-676-5p, cpo-miR-7-2-3p, cpo-miR-7-3-3p, cpo-miR-7-3p, cpo-miR-7-5p, cpo-miR-708-3p. cpo-miR-708-5p, cpo-miR-744-3p, cpo-miR-744-5p, cpo-miR-758-3p. cpo- miR-758-5p, cpo-miR-760-3p. cpo-miR-760-5p, cpo-miR-769-3p, cpo-miR-769-5p, cpo- miR-802-3p, cpo-miR-802-5p, cpo-miR-872-3p, cpo-miR-872-5p, cpo-miR-873-3p, cpo- miR-873-5p, cpo-miR-874-3p, cpo-miR-874-5p, cpo-miR-885-3p, cpo-miR-885-5p, cpo- miR-889-3p, cpo-miR-889-5p, cpo-miR-892-3p, cpo-miR-892-5p, cpo-miR-9-3p, cpo-miR- 9-5p, cpo-miR-92a-2-5p, cpo-miR-92a-3p, cpo-miR-92a-5p, cpo-miR-92b-3p, cpo-miR-92b- 5p, cpo-miR-93-3p, cpo-miR-93-5p, cpo-miR-95-3p, cpo-miR-95-5p, cpo-miR-96-3p, cpo- miR-96-5p, cpo-miR-98-3p, cpo-miR-98-5p, cpo-miR-99a-3p, cpo-miR-99a-5p, cpo-miR- 99b-3p, cpo-miR-99b-5p, cqu-bantam-3p, cqu-bantam-5p, cqu4et-7-3p, cqu4et-7-5p, cqu- miR-1, cqu-miR-10-3p, cqu-miR-10-5p. cqu-miR-100-3p, cqu-miR-100-5p, cqu-miR-1000, cqu-miR-11 -3p, cqu-miR-11 -5p. cqu-miR-1174, cqu-miR-1175-3p, cqu-miR-1175-5p. cqu- miR-12-3p, cqu-miR-12-5p, cqu-miR-124, cqu-miR-125-3p, cqu-miR-125-5p, cqu-miR-13, cqu-miR-133, cqu-miR-137, cqu-miR-14, cqu-miR-184, cqu-miR-1889-3p, cqu-miR-1889- 5p, cqu-miR-1890, cqu-miR-1891, cqu-miR-190, cqu-miR-2, cqu-miR-210-3p, cqu-miR- 210-5p, cqu-miR-252-3p, cqu-miR-252-5p, cqu-miR-263, cqu-miR-275, cqu-miR-276-3p, cqu-miR-276-5p, cqu-miR-277, cqu-miR-278, cqu-miR-279-3p, cqu-miR-279-5p, cqu-miR-281-3p, cqu-miR-281-5p, cqu-miR-283, cqu-miR-285-3p, cqu-miR-285-5p, cqu-miR-2941- l-5p, cqu-miR-2941-2-5p, cqu-miR-2941-3p, cqu-miR-2951-3p, cqu-miR-2951-5p, cqu- miR-2952, cqu-miR-305-3p, cqu-miR-305-5p, cqu-miR-306, cqu-miR-308, cqu-miR-309, cqu-miR-31-3p, cqu-miR-31-5p, cqu-miR-315, cqu-miR-316, cqu-miR-317-3p, cqu-miR- 317-5p, cqu-miR-33, cqu-miR-375, cqu-miR-7, cqu-miR-71-3p, cqu-miR-71-5p, cqu-miR- 79, cqu-miR-8-3p, cqu-miR-8-5p, cqu-miR-87, cqu-miR-9-3p, cqu-miR-9-5p, cqu-miR-92, cqu-miR-932-3p, cqu-miR-932-5p, cqu-miR-957. cqu-miR-965, cqu-miR-970. cqu-miR-980, cqu-miR-981, cqu-miR-988-3p, cqu-miR-988-5p, cqu-miR-989, cqu-miR-993-3p, cqu-miR- 993-5p, cqu-miR-996, cqu-miR-998, cqu-miR-999, cqu-miR-iab-4, cre-miR1142, cre- miR1143-3p, cre-miR1143-5p, cre-miR 1144a.1, cre-miRl 144a.2, cre-miRl 144b, cre- miRl 145.1, cre-miRl 145.2, cre-miR1146, cre-miRl 147.1, cre-miRl 147.2. cre-miR 1148.1, cre-miRl 148.2, cre-miR 1149.1, cre-miR 1149.2, cre-miRl 150.1, cre-miR 1150.2, cre- miR1150.3, cre-miR1151a-3p, cre-miRl 151a-5p, cre-miRl 151b-3p, cre-miR1151b-5p, cre- miR1152, cre-miR1153-3p.l, cre-miRl 153-3p.2, cre-miRl 153-5p.1, cre-miR1153-5p.2, cre- miR1154-3p. cre-miR 1154-5 p, cre-miR1155, cre-miRl 156.1. cre-miRl 156.2, cre-miR1157- 3p. cre-miRl 157-5p. cre-miR1158, cre-miR 1159.1. cre-miRl 159.2, cre-miR 1160.1, cre- miR1160.2, cre-miRl 160.3, cre-miRl 161a, cre-miRl 161b, cre-miRl 162-3p, cre-miR1162- 5p, cre-miRl 163.1, cre-miRl 163.2, cre-miR1164, cre-miR1165-3p, cre-miR1165-5p, cre- miR1166.1, cre-miRl 166.2, cre-miR1167, cre-miRl 168.1, cre-miRl 168.2, cre-miR1169-3p, cre-miRl 169-5p. cre-miRl 170.1, cre-miRl 170.2. cre-miR1171, cre-miRl 172.1, cre- miRl 172.2, cre-miR1173, cre-miR905-3p, cre-miR905-5p, cre-miR906-3p, cre-miR906-5p, cre-miR907, cre-miR908.1, cre-miR908.2, cre-miR908.3, cre-miR909.1, cre-miR909.2, cre- miR909.3, cre-miR910, cre-miR911, cre-miR912, cre-miR913-3p, cre-miR913-5p. cre- miR914, cre-miR915, cre-miR917, cre-miR918. cre-miR919.1, cre-miR919.2, cre-miR9897- 3p, cre-miR9897-5p, crm-let-7, crm-lin-4-3p, crm-lin-4-5p, crm-miR-l-3p, crm-miR-l-5p, crm-miR-124a, crm-miR-124b, crm-miR-1817b, crm-miR-1822, crm-miR-1824, crm-miR-2- 3p, crm-miR-2-5p, crm-miR-2225, crm-miR-2227, crm-miR-2228, crm-miR-2229, crm-miR- 2229a, crm-miR-2229b, crm-miR-2230-3p, crm-miR-2230-5p, crm-miR-2231-3p, crm-miR- 2231-5p, crm-miR-2254, crm-miR-228, crm-miR-230-3p, crm-miR-230-5p, crm-miR-231, crm-miR-232, crm-miR-233, crm-miR-234, crm-miR-235-3p, crm-miR-235-5p, crm-miR- 236, crm-miR-237-3p, crm-miR-237-5p, crm-miR-238, crm-miR-239a-3p, crm-miR-239a- 5p, crm-miR-239b. crm-miR-240, crm-miR-241, crm-miR-242. crm-miR-244-3p, crm-miR- 244-5p, crm-miR-245, crm-miR-246-3p, crm-miR-246-5p, crm-miR-247, crm-miR-248. crm- miR-249, crm-miR-250-3p, crm-miR-250-5p, crm-miR-251, crm-miR-252, crm-miR-253,crm-miR-254, crm-miR-255, crm-miR-259, crm-miR-34, crm-miR-355, crm-miR-356, crm- miR-357, crm-miR-358, crm-miR-359, crm-miR-35a. crm-miR-35b, crm-miR-35c-3p. crm- miR-35c-5p, crm-miR-35d, crm-miR-35e, crm-miR-35f, crm-miR-35g, crm-miR-35h, crm- miR-35i, crm-miR-36, crm-miR-360, crm-miR-38, crm-miR-39, crm-miR-392, crm-miR-40, crm-miR-41, crm-miR-42, crm-miR-43, crm-miR-44-3p, crm-miR-44-5p, crm-miR-45-3p, crm-miR-45-5p, crm-miR-46-3p, crm-miR-46-5p. crm-miR-47. crm-miR-48-3p, crm-miR- 48-5p, crm-miR-49, crm-miR-50-3p, crm-miR-50-5p. crm-miR-51. crm-miR-52-3p, crm- miR-52-5p, crm-miR-54, crm-miR-55-3p, crm-miR-55-5p, crm-miR-56, crm-miR-57, crm- miR-58a, crm-miR-58b-3p, crm-miR-58b-5p, crm-miR-58c, crm-miR-58d, crm-miR-59, crm-miR-60-3p, crm-miR-60-5p, crm-miR-61, crm-miR-62, crm-miR-63-3p. crm-miR-63- 5p, crm-miR-64a-3p, crm-miR-64a-5p, crm-miR-64b-3p, crm-miR-64b-5p, crm-miR-64c-3p, crm-miR-64c-5p, crm-miR-64d-3p, crm-miR-64d-5p, crm-miR-64e, crm-miR-66-3p, crm- miR-66-5p, crm-miR-67-3p, crm-miR-67-5p, crm-miR-70, crm-miR-71-3p, crm-miR-71-5p, crm-miR-72-3p, crm-miR-72-5p, crm-miR-73, crm-miR-74a, crm-miR-74b, crm-miR-75, crm-miR-7579, crm-miR-7582, crm-miR-7594, crm-miR-7597. crm-miR-7598, crm-miR- 7599. crm-miR-76. crm-miR-7600, crm-miR-7601, crm-miR-7602. crm-miR-7603, crm- miR-7604, crm-miR-7605, crm-miR-7606, crm-miR-7607, crm-miR-7608, crm-miR-7609, crm-miR-7610, crm-miR-7611, crm-miR-7612, crm-miR-7613, crm-miR-77, crm-miR-784- 3p, crm-miR-784-5p, crm-miR-785, crm-miR-786, crm-miR-787, crm-miR-788, crm-miR- 79-3p, crm-miR-79-5p, crm-miR-790. crm-miR-80-3p, crm-miR-80-5p, crm-miR-81-3p, crm-miR-81-5p, crm-miR-82, crm-miR-83, crm-miR-84-3p, crm-miR-84-5p, crm-miR-85, crm-miR-86-3p, crm-miR-86-5p, crm-miR-87-3p, crm-miR-87-5p, crm-miR-90, crt- miR166a, crt-miR166b, crt-miR168, crt-miR171, csa-let-7a, csa-let-7b, csa-let-7c, csa-let-7d, csa-miR-124, csa-miR-126, csa-miR-133, csa-miR-141, csa-miR-1473. csa-miR-1497. csa- miR-153, csa-miR-155, csa-miR-183, csa-miR-200, csa-miR-216a, csa-miR-216b, csa-miR- 217, csa-miR-219, csa-miR-281, csa-miR-31, csa-miR-34, csa-miR-7, csa-miR-92a, csa-miR- 92b, csa-miR-92c, csi-miR12105-3p, csi-miR12105-5p, csi-miR12106-3p, csi-miR12106-5p, csi-miR12107-3p, csi-miR12107-5p, csi-miR12108-3p, csi-miR12108-5p, csi-miR12109-3p, csi-miR12109-5p, csi-miR12110-3p, csi-miR12110-5p. csi-miR1211 l-3p, csi-miR1211 l-5p, csi-miR1515a, csi-miR1515b-3p, csi-miR1 15b-5p, csi-miR156a-3p, csi-miR156a-5p, csi- miR156b-3p, csi-miR156b-5p, csi-miR156c-3p, csi-miR156c-5p, csi-miR156d-5p, csi- miR156e-3p, csi-miR156e-5p, csi-miR156f-3p, csi-miR156f-5p, csi-miR156g-3p, csi- miR156g-5p. csi-miR156h-5p. csi-miR156i-5p, csi-miR156j-3p, csi-miR156j-5p, csi- miR159a-3p, csi-miR159a-5p, csi-miR159b-5p, csi-miR159c-3p, csi-miR159c-5p, csi-miR159d, csi-miR160a-3p, csi-miR160a-5p, csi-miR160b-3p, csi-miR160b-5p, csi-miR160c- 3p, csi-miR160c-5p, csi-miR162-3p, csi-miR162-5p, csi-miR164a-3p, csi-miR164a-5p, csi- miR164b-3p, csi-miR164b-5p, csi-miR164c-3p, csi-miR164c-5p, csi-miR164d-3p, csi- miR164d-5p, csi-miR166a-3p, csi-miR166a-5p, csi-miR166b-3p, csi-miR166b-5p, csi- miR166c-3p, csi-miR166c-5p, csi-miR166d-3p, csi-miR166d-5p, csi-miR166e-3p, csi- miR166e-5p, csi-miR166f-3p, csi-miR166f-5p, csi-miR166g-3p, csi-miR166g-5p, csi- miR166h-3p. csi-miR166i-3p, csi-miR166j-3p, csi-miR166k-3p, csi-miR167a-3p, csi- miR167a-5p, csi-miR167b-3p, csi-miR167b-5p, csi-miR167c-3p, csi-miR167c-5p, csi- miR167d-3p, csi-miR167d-5p, csi-miR167e-3p, csi-miR167e-5p, csi-miR168-3p, csi- miR168-5p, csi-miR169a, csi-miR169b-5p, csi-miR169c-3p, csi-miR169c-5p, csi-miR169d- 3p, csi-miR169d-5p, csi-miR169e-3p, csi-miR169e-5p, csi-miR169f-5p, csi-miR169g-5p, csi-miR169h-5p, csi-miR169i-5p, csi-miR169j-5p, csi-miR169k-5p, csi-miR1691-3p, csi- miR1691-5p, csi-miR169m-5p, csi-miR169n-3p, csi-miR169n-5p, csi-miR169o-5p, csi- miR169p-5p, csi-miR169q-5p, csi-miR169r-5p, csi-miR171a, csi-miR171b-3p, csi-miR171b- 5p, csi-miR171c-3p, csi-miR171c-5p, csi-miR171d-3p, csi-miR171e-3p, csi-miR171f-3p, csi- miR171f-5p. csi-miR171g-3p. csi-miR171h-3p. csi-miR171i-3p, csi-miR172a-3p, csi- miR172a-5p, csi-miR172b-3p, csi-miR172b-5p, csi-miR172c-3p, csi-miR172c-5p, csi- miR172d-5p, csi-miR2111-5p, csi-miR2275a-3p, csi-miR2275a-5p, csi-miR2275b-3p, csi- miR2275b-5p, csi-miR3627a-5p, csi-miR3627b-3p, csi-miR3627c-5p, csi-miR390a-3p, csi- miR390a-5p. csi-miR390b-5p. csi-miR391-3p, csi-miR391-5p, csi-miR393a. csi-miR393b- 3p, csi-miR393b-5p, csi-miR393c-3p, csi-miR393c-5p, csi-miR3946, csi-miR3947-5p, csi- miR3948, csi-miR3949, csi-miR394a, csi-miR394b-5p, csi-miR3950, csi-miR3951a-3p, csi- miR3951a-5p, csi-miR3951b-3p, csi-miR3951b-5p, csi-miR3952-3p, csi-miR3952-5p, csi- miR3952b-3p, csi-miR3952b-5p, csi-miR3953, csi-miR3954. csi-miR3954b-3p, csi- miR3954b-5p, csi-miR395a, csi-miR395b-3p, csi-miR395b-5p, csi-miR395c-3p, csi- miR396a-3p, csi-miR396a-5p, csi-miR396b-3p, csi-miR396b-5p, csi-miR396c, csi-miR396d- 3p, csi-miR396e-3p, csi-miR396e-5p, csi-miR396f-3p, csi-miR396f-5p, csi-miR397-3p, csi- miR397-5p, csi-miR398a-3p, csi-miR398a-5p, csi-miR398b-3p, csi-miR399a-3p, csi- miR399a-5p. csi-miR399b-3p. csi-miR399b-5p. csi-miR399c-3p. csi-miR399c-5p. csi- miR399d-3p, csi-miR399d-5p, csi-miR399e-3p, csi-miR399e-5p, csi-miR399f-3p, csi- miR399f-5p, csi-miR403a-3p, csi-miR403a-5p, csi-miR403b-3p, csi-miR403b-5p, csi- miR408-3p, csi-miR408-5p, csi-miR477a-3p, csi-miR477a-5p, csi-miR477b-3p, csi- miR477b-5p. csi-miR477c-3p. csi-miR477c-5p, csi-miR477d-3p. csi-miR477d-5p. csi- miR477e-3p, csi-miR477e-5p, csi-miR482a-3p, csi-miR482a-5p, csi-miR482b-3p, csi-miR482b-5p, csi-miR482c-3p, csi-miR482c-5p, csi-miR482d-3p, csi-miR482d-5p, csi- miR482e-3p. csi-miR482e-5p. csi-miR482f-3p, csi-miR482f-5p, csi-miR482g-3p, csi- miR482g-5p, csi-miR530a-3p, csi-miR530a-5p, csi-miR530b-3p, csi-miR530b-5p, csi- miR535a, csi-miR535b-3p, csi-miR535b-5p, csi-miR535c-3p, csi-miR535c-5p, csi-miR535d- 3p, csi-miR535d-5p, csi-miR535e-5p, csi-miR535f-5p, csi-miR536-3p, csi-miR536-5p, csi- miR827, csi-miR857, csi-miR858-3p, csi-miR9560-3p, csi-miR9560-5p, cst-miR11331, cst- miR11332. cst-miRl 1333. cst-miRl 1334. cst-miR11335. cte-bantam, cte-let-7, cte-miR-1. cte-miR-100, cte-miR-l Oa, cte-miR-lOb, cte-miR-l Oc, cte-miR-l Od, cte-miR-1175-3p, cte- miR-1175-5p, cte-miR-12, cte-miR-124, cte-miR-125, cte-miR-133, cte-miR-137, cte-miR- 153, cte-miR-184a, cte-miR-184b, cte-miR-190, cte-miR-193, cte-miR-1987, cte-miR-1989, cte-miR-1990a, cte-miR-1990b, cte-miR-1990c-3p, cte-miR-1991, cte-miR-1992, cte-miR- 1993, cte-miR-1994, cte-miR-1995, cte-miR-1996a, cte-miR-1996b, cte-miR-1997, cte-miR- 1998, cte-miR-1999, cte-miR-2000, cte-miR-2001, cte-miR-210a, cte-miR-210b, cte-miR- 216a, cte-miR-216b, cte-miR-216c, cte-miR-219, cte-miR-242, cte-miR-252a, cte-miR-252b, cte-miR-263. cte-miR-2685-3p, cte-miR-2685-5p. cte-miR-2686a-3p, cte-miR-2686a-5p, cte- miR-2686b, cte-miR-2686c. cte-miR-2687, cte-miR-2688-3p. cte-miR-2688-5p, cte-miR- 2689, cte-miR-2690, cte-miR-2691-3p, cte-miR-2691-5p, cte-miR-2692, cte-miR-2693, cte- miR-2694, cte-miR-2695, cte-miR-2696, cte-miR-2697, cte-miR-2698, cte-miR-2699-3p, cte-miR-2699-5p, cte-miR-2700, cte-miR-2701, cte-miR-2702-3p, cte-miR-2702-5p. cte- miR-2703-3p, cte-miR-2703-5p. cte-miR-2704, cte-miR-2705, cte-miR-2706, cte-miR-2707, cte-miR-2708, cte-miR-2709, cte-miR-2710, cte-miR-2711, cte-miR-2712, cte-miR-2713, cte-miR-2714, cte-miR-2715, cte-miR-2716, cte-miR-2717, cte-miR-2718, cte-miR-2719, cte-miR-2720-3p, cte-miR-2720-5p, cte-miR-2721, cte-miR-277a, cte-miR-277b, cte-miR- 278, cte-miR-279, cte-miR-281, cte-miR-29a, cte-miR-29b. cte-miR-2a, cte-miR-2b. cte- miR-2c, cte-miR-2d, cte-miR-2e, cte-miR-2f, cte-miR-2g, cte-miR-31, cte-miR-315, cte- miR-317, cte-miR-33, cte-miR-34, cte-miR-36, cte-miR-365, cte-miR-375, cte-miR-67, cte- miR-7, cte-miR-71, cte-miR-745a, cte-miR-745b, cte-miR-750, cte-miR-8, cte-miR-87a, cte- miR-87b, cte-miR-9-3p, cte-miR-9-5p, cte-miR-92a, cte-miR-92b, cte-miR-92c, cte-miR-96, cte-miR-981. cte-miR-993, cte-miR-996, ctr-miR156. ctr-miR164, ctr-miR166, ctr-miR167, ctr-miR171, ctr-miR319, dan-bantam, dan-let-7, dan-miR-1, dan-miR-10, dan-miR-100, dan- miR-11, dan-miR-12, dan-miR-124, dan-miR-125, dan-miR-133, dan-miR-13a, dan-miR- 13b, dan-miR-14, dan-miR-184-3p, dan-miR-184-5p, dan-miR-210, dan-miR-219, dan-miR- 263a. dan-miR-263b, dan-miR-274, dan-miR-275, dan-miR-276a, dan-miR-276b, dan-miR- 277, dan-miR-278, dan-miR-279, dan-miR-280, dan-miR-281-l-5p, dan-miR-281-2-5p, dan-miR-281-3p, dan-miR-282, dan-miR-283, dan-miR-284, dan-miR-285, dan-miR-286, dan- miR-287, dan-miR-288, dan-miR-289, dan-miR-2a. dan-miR-2b, dan-miR-2c, dan-miR-3, dan-miR-304, dan-miR-305, dan-miR-306, dan-miR-307, dan-miR-308, dan-miR-309, dan- miR-310, dan-miR-31 la, dan-miR-311b, dan-miR-312, dan-miR-314, dan-miR-315, dan- miR-316, dan-miR-317, dan-miR-318, dan-miR-3 la, dan-miR-3 lb, dan-miR-33, dan-miR- 34, dan-miR-4. dan-miR-5, dan-miR-6, dan-miR-7, dan-miR-79, dan-miR-8, dan-miR-87, dan-miR-92a, dan-miR-92b. dan-miR-9a, dan-miR-9b, dan-miR-9c, dan-miR-iab-4-3p, dan- miR-iab-4-5p, ddi-miR-1 176, ddi-miR-1 177, ddi-miR-7095-3p, ddi-miR-7095-5p, ddi-miR- 7096, ddi-miR-7097, ddi-miR-7098, ddi-miR-7099, ddi-miR-7100, ddi-miR-7101, ddi-miR- 7102, ddi-miR-7103, ddi-miR-7104, ddi-miR-7105, ddi-miR-7131a-3p, ddi-miR-7131a-5p, ddi-miR-7131b, ddi-miR-713 lc-3p, ddi-miR-713 lc-5p. ddi-miR-713 Id, der-bantam. der-let- 7, der-miR-1, der-miR-10, der-miR-100, der-miR-1 1, der-miR-12, der-miR-124, der-miR- 125, der-miR-133, der-miR-13a, der-miR-13b, der-miR-14, der-miR-184-3p, der-miR-184- 5p, der-miR-210, der-miR-219, der-miR-2498a-3p, der-miR-2498a-5p, der-miR-2498b-3p, der-miR-2498b-5p, der-miR-2499, der-miR-263a. der-miR-263b. der-miR-274, der-miR-275, der-miR-276a, der-miR-276b, der-miR-277. der-miR-278, der-miR-279, der-miR-280. der- miR-281-l-5p, der-miR-281-2-5p, der-miR-281-3p, der-miR-282, der-miR-283, der-miR- 284, der-miR-285, der-miR-286, der-miR-287, der-miR-288, der-miR-289, der-miR-2a, der- miR-2b, der-miR-2c, der-miR-3. der-miR-304, der-miR-305, der-miR-306-3p, der-miR-306- 5p, der-miR-307, der-miR-308, der-miR-309, der-miR-310a-3p, der-miR-310a-5p. der-miR- 310b-3p, der-miR-310b-5p, der-miR-311 a-3p, der-miR-3 l la-5p, der-miR-31 lb-3p, der-miR- 31 lb-5p, der-miR-31 lc-3p, der-miR-31 lc-5p, der-miR-312-3p, der-miR-312-5p, der-miR- 314, der-miR-315, der-miR-316, der-miR-317, der-miR-318, der-miR-31a, der-miR-31b, der- miR-33, der-miR-34, der-miR-4, der-miR-5, der-miR-6, der-miR-7, der-miR-79, der-miR-8, der-miR-87, der-miR-92a, der-miR-92b, der-miR-9680-3p, der-miR-9680-5p, der-miR-9681- 3p, der-miR-9681-5p, der-miR-9682-3p, der-miR-9682-5p, der-miR-9683-3p, der-miR-9683- 5p, der-miR-9691-3p, der-miR-9691-5p, der-miR-973-3p, der-miR-973-5p, der-miR-974-3p, der-miR-974-5p, der-miR-975-3p, der-miR-975-5p, der-miR-976-3p, der-miR-976-5p, der- miR-977-3p. der-miR-977-5p. der-miR-978-3p. der-miR-978-5p. der-miR-983a-3p, der-miR- 983a-5p, der-miR-983b-3p, der-miR-983b-5p, der-miR-991-3p, der-miR-991-5p, der-miR- 992-??, der-miR-992-2-5p, der-miR-992-5p, der-miR-9a, der-miR-9b, der-miR-9c, der-miR- iab-4-3p, der-miR-iab-4-5p, dev-miR-Dl-3p, dev-miR-Dl-5p, dev-miR-D10-3p, dev-miR- Dl l-3p, dev-miR-D12-3p. dev-miR-D12-5p, dev-miR-D13-5p. dev-miR-D14-3p, dev-miR- D15-3p, dev-miR-D16-3p, dev-miR-D17-3p, dev-miR-D17-5p, dev-miR-D18-3p, dev-miR-D18-5p, dev-miR-D19-5p, dev-miR-D2-3p, dev-miR-D20-5p, dev-miR-D21-3p, dev-miR- D21-5p, dev-miR-D22-3p. dev-miR-D22-5p, dev-miR-D23-3p. dev-miR-D24-3p, dev-miR- D3-3p, dev-miR-D4-3p, dev-miR-D5-5p, dev-miR-D6-3p, dev-miR-D6-5p, dev-miR-D7-5p, dev-miR-D8-3p, dev-miR-D8-5p, dev-miR-D9-3p, dev-miR-D9-5p, dgr-bantam, dgr-let-7, dgr-miR-1, dgr-miR-10, dgr-miR-100, dgr-miR-11, dgr-miR-12, dgr-miR-124, dgr-miR-125, dgr-miR-133, dgr-miR-13a, dgr-miR-13b, dgr-miR-14, dgr-miR-184-3p, dgr-miR-184-5p, dgr-miR-210, dgr-miR-219, dgr-miR-263a, dgr-miR-263b, dgr-miR-274. dgr-miR-275, dgr- miR-276a-3p, dgr-miR-276a-5p, dgr-miR-276b-3p, dgr-miR-276b-5p, dgr-miR-277, dgr- miR-278, dgr-miR-279, dgr-miR-280, dgr-miR-281-l-5p, dgr-miR-281-2-5p, dgr-miR-281- 3p, dgr-miR-282, dgr-miR-283, dgr-miR-284, dgr-miR-285, dgr-miR-286, dgr-miR-287. dgr- miR-288, dgr-miR-2a, dgr-miR-2b, dgr-miR-2c, dgr-miR-3, dgr-miR-304, dgr-miR-305. dgr- miR-306, dgr-miR-307, dgr-miR-308, dgr-miR-309, dgr-miR-314, dgr-miR-315, dgr-miR- 316, dgr-miR-317, dgr-miR-318, dgr-miR-31a, dgr-miR-31b, dgr-miR-33, dgr-miR-34, dgr- miR-4, dgr-miR-5, dgr-miR-6, dgr-miR-7, dgr-miR-79, dgr-miR-8, dgr-miR-87, dgr-miR- 92a, dgr-miR-92b, dgr-miR-9a, dgr-miR-9b, dgr-miR-9c, dgr-miR-iab-4-3p, dgr-miR-iab-4- 5p. dma-let-7a. dma-let-7b, dma-let-7c, dma-let-7f, dma-let-7g. dma-miR-10, dma-miR-100. dma-miR-101, dma-miR-103a, dma-miR-103b, dma-miR-106b, dma-miR-107, dma-miR- 10a, dma-miR-125a, dma-miR-125b, dma-miR-127, dma-miR-1307, dma-miR-130a, dma- miR-1388, dma-miR-140, dma-miR-143, dma-miR-145, dma-miR-148b, dma-miR-151, dma-miR-16, dma-miR-181a, dma-miR-181b. dma-miR-181c, dma-miR-186, dma-miR-191, dma-miR-193, dma-miR-196, dma-miR-199, dma-miR-19b, dma-miR-21, dma-miR-214, dma-miR-22, dma-miR-221, dma-miR-222, dma-miR-23b, dma-miR-24, dma-miR-25, dma- miR-26a, dma-miR-26b, dma-miR-27b, dma-miR-28, dma-miR-296, dma-miR-29a, dma- miR-30a. dma-miR-30c, dma-miR-30e, dma-miR-31, dma-miR-339, dma-miR-340, dma- miR-381, dma-miR-409, dma-miR-423, dma-miR-432, dma-miR-502b, dma-miR-532, dma- miR-6529, dma-miR-660, dma-miR-708, dma-miR-877, dma-miR-92a, dma-miR-93, dma- miR-98, dme-bantam-3p, dme-bantam-5p, dme-let-7-3p, dme-let-7-5p, dme-miR-l-3p, dme- miR-l-5p, dme-miR-10-3p, dme-miR-10-5p, dme-miR-100-3p. dme-miR-100-5p, dme-miR- 1000-3p, dme-miR-1000-5p. dme-miR-1001-3p, dme-miR-1001-5p, dme-miR-1002-3p, dme-miR-1002-5p, dme-miR-1003-3p, dme-miR-1003-5p, dme-miR-1004-3p, dme-miR- 1004-5p, dme-miR-1005-3p, dme-miR-1006-3p, dme-miR-1006-5p, dme-miR-1007-3p, dme-miR-1007-5p. dme-miR-1008-3p, dme-miR-1008-5p, dme-miR-1009-3p, dme-miR- 1010-3p, dme-miR-1010-5p. dme-miR-101 l-3p, dme-miR-1012-3p, dme-miR-1012-5p, dme-miR-1013-3p, dme-miR-1014-3p, dme-miR-1014-5p, dme-miR-1015-3p, dme-miR-1016-3p, dme-miR-1016-5p, dme-miR-1017-3p, dme-miR-10404-3p, dme-miR-10404-5p. dme-miR-l l-3p, dme-miR-1 l-5p, dme-miR-11182. dme-miR-12-3p, dme-miR-12-5p, dme- miR-124-3p, dme-miR-124-5p, dme-miR-125-3p, dme-miR-125 -5 p, dme-miR-133-3p, dme- miR-133-5p, dme-miR-137-3p, dme-miR-137-5p, dme-miR-13 a-3p, dme-miR-13a-5p, dme- miR-13b-l-5p, dme-miR-13b-2-5p, dme-miR-13b-3p, dme-miR-14-3p, dme-miR-14-5p, dme-miR-184-3p, dme-miR-184-5 p. dme-miR-190-3p, dme-miR-190-5p, dme-miR-193 -3 p, dme-miR-193-5p, dme-miR-210-3p. dme-miR-210-5p, dme-miR-219-3p, dme-miR-219-5p. dme-miR-2279-3p, dme-miR-2279-5p, dme-miR-2280-3p, dme-miR-2280-5p, dme-miR- 2281-3p, dme-miR-2281-5p, dme-miR-2282-3p, dme-miR-2283-3p, dme-miR-2283-5p, dme-miR-2489-3p. dme-miR-2489-5p, dme-miR-2490-3p, dme-miR-2490-5p, dme-miR- 2491-3p, dme-miR-2491-5p. dme-miR-2492-3p, dme-miR-2492-5p, dme-miR-2493-3p, dme-miR-2493-5p, dme-miR-2494-3p, dme-miR-2494-5p, dme-miR-2495-3p, dme-miR- 2495-5p, dme-miR-2496-3p, dme-miR-2496-5p, dme-miR-2497-3p, dme-miR-2497-5p, dme-miR-2498-3p, dme-miR-2498-5p, dme-miR-2499-3p, dme-miR-2499-5p, dme-miR- 2500-3p, dme-miR-2500-5p. dme-miR-2501-3p, dme-miR-2501-5p, dme-miR-252-3p, dme- miR-252-5p. dme-miR-2535b-3p. dme-miR-263a-3p. dme-miR-263a-5p. dme-miR-263b-3p, dme-miR-263b-5p, dme-miR-274-3p, dme-miR-274-5p, dme-miR-275-3p, dme-miR-275-5p, dme-miR-276a-3p, dme-miR-276a-5p, dme-miR-276b-3p, dme-miR-276b-5p, dme-miR-277- 3p, dme-miR-277-5p, dme-miR-278-3p, dme-miR-278-5p, dme-miR-279-3p, dme-miR-279- 5p, dme-miR-280-5p, dme-miR-281-l-5p. dme-miR-281-2-5p, dme-miR-281 -3p, dme-miR- 282-3p, dme-miR-282-5p, dme-miR-283-3p, dme-miR-283-5p, dme-miR-284-3p, dme-miR- 284-5p, dme-miR-285-3p, dme-miR-285-5p, dme-miR-286-3p, dme-miR-286-5p, dme-miR- 287-3p, dme-miR-288-3p, dme-miR-289-5p, dme-miR-2a-l-5p, dme-miR-2a-2-5p, dme- miR-2a-3p. dme-miR-2b-l-5p?dme-miR-2b-2-5p, dme-miR-2b-3p. dme-miR-2c-3p. dme- miR-2c-5p, dme-miR-3-3p, dme-miR-3-5p, dme-miR-303-3p, dme-miR-303-5p, dme-miR- 304-3p, dme-miR-304-5p, dme-miR-305-3p, dme-miR-305-5p, dme-miR-306-3p, dme-miR- 306-5p, dme-miR-307a-3p, dme-miR-307a-5p, dme-miR-307b-3p, dme-miR-307b-5p, dme- miR-308-3p, dme-miR-308-5p, dme-miR-309-3p, dme-miR-309-5p, dme-miR-310-3p, dme- miR-310-5p. dme-miR-311-3p, dme-miR-31 l-5p. dme-miR-312-3p, dme-miR-312-5p, dme- miR-313-3p, dme-miR-313-5p, dme-miR-314-3p, dme-miR-314-5p, dme-miR-315-3p, dme- miR-315-5p, dme-miR-316-3p, dme-miR-316-5p, dme-miR-317 -3 p, dme-miR-317-5p, dme- miR-318-3p, dme-miR-318-5p, dme-miR-3 la-3 p, dme-miR-3 la-5 p, dme-miR-3 lb-3p. dme- miR-3 lb-5p, dme-miR-33-3p, dme-miR-33-5p, dme-miR-34-3p, dme-miR-34-5p, dme-miR- 3641-3p, dme-miR-3641-5p, dme-miR-3642-3 p, dme-miR-3642-5p, dme-miR-3643-3p,dme-miR-3643-5p. dme-miR-3644-3p, dme-miR-3644-5p, dme-miR-3645-3p, dme-miR- 3645-5p, dme-miR-375-3p, dme-miR-375-5p. dme-miR-4-3p, dme-miR-4-5p, dme-miR- 4908-3p, dme-miR-4909-3p, dme-miR-4910-5p, dme-miR-491 l-3p, dme-miR-4912-5p, dme-miR-4913-3p, dme-miR-4914-5p, dme-miR-4915 -5 p, dme-miR-4916-3p, dme-miR- 4917-3p, dme-miR-4918-5p, dme-miR-4919-3p, dme-miR-4919-5p, dme-miR-4939-3p, dme-miR-4940-3p. dme-miR-4940-5p, dme-miR-4941-3p, dme-miR-4941-5p, dme-miR- 4942-3p. dme-miR-4943-3p. dme-miR-4943-5p, dme-miR-4944-3p, dme-miR-4944-5p. dme-miR-4945-5p, dme-miR-4946-5p, dme-miR-4947-5p, dme-miR-4948-3p, dme-miR- 4948-5p, dme-miR-4949-3p, dme-miR-4949-5p, dme-miR-4950-3p, dme-miR-4950-5p, dme-miR-4951-3p. dme-miR-4951-5p, dme-miR-4952-3p, dme-miR-4952-5p, dme-miR- 4953-3p, dme-miR-4954-3p. dme-miR-4954-5p, dme-miR-4955-3p, dme-miR-4955-5p, dme-miR-4956-3p, dme-miR-4956-5p, dme-miR-4957-3p, dme-miR-4957-5p, dme-miR- 4958-3p, dme-miR-4958-5p, dme-miR-4959-5p, dme-miR-4960-3p, dme-miR-4961-3p, dme-miR-4961-5p, dme-miR-4962-3p, dme-miR-4962-5p, dme-miR-4963-3p, dme-miR- 4963-5p, dme-miR-4964-3p. dme-miR-4965-3p, dme-miR-4965-5p, dme-miR-4966-3p, dme-miR-4966-5p. dme-miR-4967-3p, dme-miR-4967-5p, dme-miR-4968-3p. dme-miR- 4968-5p, dme-miR-4969-3p, dme-miR-4969-5p, dme-miR-4970-5p, dme-miR-4971-5p, dme-miR-4972-3p, dme-miR-4972-5p, dme-miR-4973-3p, dme-miR-4973-5p, dme-miR- 4974-3p, dme-miR-4974-5p. dme-miR-4975-5p, dme-miR-4976-3p, dme-miR-4976-5p, dme-miR-4977-3p. dme-miR-4977-5p, dme-miR-4978-5p, dme-miR-4979-3p, dme-miR- 4979-5p, dme-miR-4980-3p, dme-miR-4981-3p, dme-miR-4982-3p, dme-miR-4982-5p, dme-miR-4983-3p, dme-miR-4983-5p, dme-miR-4984-3p, dme-miR-4984-5p, dme-miR- 4985-3p, dme-miR-4985-5p, dme-miR-4986-3p, dme-miR-4986-5p, dme-miR-4987-3p, dme-miR-4987-5p. dme-miR-5-3p, dme-miR-5-5p, dme-miR-6-l-5p?dme-miR-6-2-5p, dme- miR-6-3-5p, dme-miR-6-3p, dme-miR-7-3p, dme-miR-7-5p, dme-miR-79-3p, dme-miR-79- 5p, dme-miR-8-3p, dme-miR-8-5p, dme-miR-87-3p, dme-miR-87-5p, dme-miR-927-3p, dme-miR-927-5p, dme-miR-929-3p, dme-miR-929-5p, dme-miR-92a-3p, dme-miR-92a-5p, dme-miR-92b-3p, dme-miR-92b-5p. dme-miR-932-3p, dme-miR-932-5p, dme-miR-9369-3p, dme-miR-9369-5p. dme-miR-9370-3p, dme-miR-9370-5p, dme-miR-9371-3p. dme-miR- 9371 -5p, dme-miR-9372-3p, dme-miR-9372-5p, dme-miR-9373-3p, dme-miR-9373-5p, dme-miR-9374-3p, dme-miR-9374-5p, dme-miR-9375-3p, dme-miR-9375-5p, dme-miR- 9376-3p, dme-miR-9376-5p, dme-miR-9377-3p, dme-miR-9377-5p, dme-miR-9378-3p, dme-miR-9378-5p. dme-miR-9379-3p, dme-miR-9379-5p, dme-miR-9380-3p, dme-miR- 9380-5p, dme-miR-9381-3p, dme-miR-9381-5p, dme-miR-9382-3p, dme-miR-9382-5p,dme-miR-9383-3p. dme-miR-9383-5p, dme-miR-9384-3p, dme-miR-9384-5p, dme-miR- 9385-3p, dme-miR-9385-5p. dme-miR-9388-3p, dme-miR-9388-5p, dme-miR-954-3p, dme- miR-954-5p, dme-miR-955-3p, dme-miR-955-5p, dme-miR-956-3p, dme-miR-956-5p, dme- miR-957-3p, dme-miR-957-5p, dme-miR-958-3p, dme-miR-958-5p, dme-miR-959-3p, dme- miR-959-5p, dme-miR-960-3p, dme-miR-960-5p, dme-miR-961-3p, dme-miR-961-5p, dme- miR-962-3p, dme-miR-962-5p, dme-miR-963-3p. dme-miR-963-5p, dme-miR-964-3p, dme- miR-964-5p. dme-miR-965-3p, dme-miR-965-5p. dme-miR-966-3p, dme-miR-966-5p, dme- miR-967-3p, dme-miR-967-5p, dme-miR-968-3p, dme-miR-968-5p, dme-miR-969-3p, dme- miR-969-5p, dme-miR-970-3p, dme-miR-970-5p, dme-miR-971-3p, dme-miR-971-5p, dme- miR-972-3p, dme-miR-972-5p, dme-miR-973-3p, dme-miR-973-5p, dme-miR-974-3p, dme- miR-974-5p, dme-miR-975-3p, dme-miR-975-5p. dme-miR-976-3p, dme-miR-976-5p, dme- miR-977-3p, dme-miR-977-5p, dme-miR-978-3p, dme-miR-978-5p, dme-miR-979-3p, dme- miR-979-5p, dme-miR-980-3p, dme-miR-980-5p, dme-miR-981-3p, dme-miR-981-5p, dme- miR-982-3p, dme-miR-982-5p, dme-miR-983-3p, dme-miR-983-5p, dme-miR-984-3p, dme- miR-984-5p, dme-miR-985-3p, dme-miR-985-5p. dme-miR-986-3p, dme-miR-986-5p, dme- miR-987-3p. dme-miR-987-5p, dme-miR-988-3p. dme-miR-988-5p, dme-miR-989-3p, dme- miR-989-5p, dme-miR-990-3p, dme-miR-990-5p, dme-miR-991-3p, dme-miR-991-5p, dme- miR-992-3p, dme-miR-992-5p, dme-miR-993-3p, dme-miR-993-5p, dme-miR-994-3p, dme- miR-994-5p, dme-miR-995-3p, dme-miR-995-5p, dme-miR-996-3p, dme-miR-996-5p, dme- miR-997-3p, dme-miR-997-5p, dme-miR-998-3p. dme-miR-998-5p, dme-miR-999-3p, dme- miR-999-5p, dme-miR-9a-3p, dme-miR-9a-5p, dme-miR-9b-3p, dme-miR-9b-5p, dme-miR- 9c-3p, dme-miR-9c-5p, dme-miR-iab-4-3p, dme-miR-iab-4-5p, dme-miR-iab-8-3p, dme- miR-iab-8-5p, dmo-bantam, dmo-let-7, dmo-miR-1, dmo-miR-10, dmo-miR-100, dmo-miR- 11, dmo-miR-12, dmo-miR-124. dmo-miR-125. dmo-miR-133. dmo-miR-13a, dmo-miR- 13b, dmo-miR-14, dmo-miR-184-3p, dmo-miR-184-5p, dmo-miR-210, dmo-miR-219, dmo- miR-263a, dmo-miR-274, dmo-miR-275, dmo-miR-276a, dmo-miR-276b, dmo-miR-277, dmo-miR-278, dmo-miR-279, dmo-miR-280, dmo-miR-281-l-5p, dmo-miR-281-2-5p, dmo- miR-281-3p, dmo-miR-282, dmo-miR-283, dmo-miR-284, dmo-miR-285, dmo-miR-286, dmo-miR-287, dmo-miR-288, dmo-miR-2a. dmo-miR-2b, dmo-miR-2c, dmo-miR-3, dmo- miR-304, dmo-miR-305, dmo-miR-306-3p, dmo-miR-306-5p, dmo-miR-307, dmo-miR-308, dmo-miR-309, dmo-miR-313, dmo-miR-314, dmo-miR-315, dmo-miR-316, dmo-miR-317, dmo-miR-318, dmo-miR-31a, dmo-miR-31b, dmo-miR-33, dmo-miR-34, dmo-miR-4, dmo- miR-5, dmo-miR-6, dmo-miR-7, dmo-miR-79, dmo-miR-8, dmo-miR-87, dmo-miR-92a, dmo-miR-92b, dmo-miR-9a, dmo-miR-9b, dmo-miR-9c, dmo-miR-iab-4-3p, dmo-miR-iab-4-5p, dno-let-7a-3p, dno-let-7a-5p, dno-let-7b-3p, dno-let-7b-5p, dno-let-7c-2-3p, dno-let-7c- 3p, dno-let-7c-5p, dno-let-7d-3p, dno-let-7d-5p. dno-let-7f-2-3p, dno-let-7f-3p. dno-let-7f-5p, dno-let-7g-5p, dno-let-7i-3p, dno-let-7i-5p, dno-miR-1 -2 -5p, dno-miR-l-3p, dno-miR-l-5p, dno-miR-100-3p, dno-miR-100-5p, dno-miR-101-2-5p, dno-miR-101-3p, dno-miR-101-5p, dno-miR-103a-2-5p, dno-miR-103a-3p, dno-miR-103a-5p, dno-miR-106a-3p, dno-miR- 106a-5p, dno-miR-106b-3p, dno-miR-106b-5p, dno-miR-107-3p, dno-miR-107-5p, dno-miR- 10a-3p. dno-miR-10a-5p, dno-miR-10b-3p, dno-miR-10b-5p. dno-miR-1185-2-3p. dno-miR- 1 185-3p, dno-miR-1185-5p, dno-miR-1193-3p, dno-miR-1193-5p, dno-miR-1197-3p, dno- miR-1197-5p, dno-miR-12085-3p, dno-miR-12085-5p, dno-miR-12086-3p, dno-miR-12086- 5p, dno-miR-12087-3p, dno-miR-12087-5p, dno-miR-122-3p, dno-miR-122-5p, dno-miR- 124-3p, dno-miR-124-5p, dno-miR-1249-3p, dno-miR-1249-5p, dno-miR-1251-3p, dno- miR-1251-5p, dno-miR-125b-2-3p, dno-miR-125b-3p, dno-miR-125b-5p, dno-miR-126-3p, dno-miR-126-5p, dno-miR-127-3p, dno-miR-127-5p, dno-miR-127 l-3p, dno-miR-1271-5p, dno-miR-1277-3p, dno-miR-1277-5p, dno-miR-128-2-5p, dno-miR-128-3p, dno-miR-128- 5p, dno-miR-129-2-3 p, dno-miR-129-3p, dno-miR-129-5p, dno-miR-1296-3p, dno-miR- 1296-5p. dno-miR-1298-3p. dno-miR-1298-5p, dno-miR-1301 -3 p, dno-miR-1301-5p, dno- miR-1307-3p, dno-miR-1307-5p, dno-miR-130a-3p, dno-miR-130a-5p, dno-miR-130b-3p, dno-miR-130b-5p, dno-miR-132-3p, dno-miR-132-5p, dno-miR-133a-3p, dno-miR-133a-5p, dno-miR-133b-3p, dno-miR-133b-5p, dno-miR-134-3p. dno-miR-134-5p, dno-miR-1343-3p, dno-miR-1343-5p, dno-miR-135a-2-3p, dno-miR-135a-3p, dno-miR-135a-5p, dno-miR- 135b-3p, dno-miR-135b-5p, dno-miR-136-3p, dno-miR-136-5p, dno-miR-137-3p, dno-miR- 137-5p, dno-miR-138-2-3p, dno-miR-138-3p, dno-miR-138-5p, dno-miR-1388-3p, dno-miR- 1388-5p, dno-miR-139-3p, dno-miR-139-5p, dno-miR-140-3p, dno-miR-140-5p. dno-miR- 141-3p, dno-miR-141-5p, dno-miR-142-3p, dno-miR-142-5p, dno-miR-143-3p, dno-miR- 143-5p, dno-miR-144-3p, dno-miR-144-5p, dno-miR-146a-3p, dno-miR-146a-5p, dno-miR- 146b-3p, dno-miR-146b-5p, dno-miR-147-3p, dno-miR-147-5p, dno-miR-148a-3p, dno-miR- 148a-5p, dno-miR-148b-3p, dno-miR-148b-5p, dno-miR-149-3p, dno-miR-149-5p, dno-miR- 150-3p, dno-miR-150-5p, dno-miR-151-3p, dno-miR-151-5p, dno-miR-153a-3p, dno-miR- 153a-5p, dno-miR-153b-3p, dno-miR-153b-5p, dno-miR-154a-3p, dno-miR-154a-5p, dno- miR-154b-3p, dno-miR-154b-5p, dno-miR-155-3p, dno-miR-155-5p, dno-miR-15a-3p, dno- miR-15a-5p, dno-miR-15b-3p, dno-miR-15b-5p, dno-miR-16a-3p, dno-miR-16a-5p, dno- miR-16b-3p, dno-miR-16b-5p, dno-miR-17-3p, dno-miR-17-5p, dno-miR-181a-2-3p, dno- miR-181a-3p, dno-miR-181a-5p, dno-miR-18 lb-2-3p, dno-miR-18 lb-3p, dno-miR-181b-5p, dno-miR-18 lc-3p, dno-miR-181 c-5p, dno-miR-181 d-3p, dno-miR-181d-5p, dno-miR-182-3p, dno-miR-182-5p. dno-miR-183-3p, dno-miR-183-5p, dno-miR-184-3p, dno-miR-184-5p, dno-miR-1842-3p, dno-miR-1842-5p, dno-miR-185-3p dno-miR-185-5p, dno-miR-186-3p, dno-miR-186-5p, dno-miR-187-3p, dno-miR-187-5p, dno-miR-188-3p, dno-miR-188-5p, dno-miR-18a-3p. dno-miR-18a-5p, dno-miR-18b-3p, dno-miR-18b-5p, dno-miR-190a-3p, dno-miR-190a-5p, dno-miR-190b-3p, dno-miR-190b-5p, dno-miR-191-3p, dno-miR-191-5p, dno-miR-192-3p, dno-miR-192-5p, dno-miR-193a-3p, dno-miR-193 a-5p, dno-miR-193b-3p, dno-miR-193b-5p. dno-miR-194-3p, dno-miR-194-5p, dno-miR-195-3p, dno-miR-195-5p. dno-miR-196a-3p, dno-miR-196a-5p, dno-miR-196b-3p, dno-miR-196b-5p, dno-miR-196c- 3p, dno-miR-196c-5p, dno-miR-197-3p, dno-miR-197-5p, dno-miR-199-2-5p, dno-miR-199- 3p, dno-miR-199-5p. dno-miR-19a-3p, dno-miR-19a-5p, dno-miR-19b-2-5p, dno-miR-19b- 3p, dno-miR-19b-5p dno-miR-200b-3p. dno-miR-200b-5p. dno-miR-202-3p, dno-miR-202- 5p, dno-miR-204-3p dno-miR-204-5p, dno-miR-205-3p, dno-miR-205-5p, dno-miR-206-3p, dno-miR-206-5p, dno-miR-208a-3p, dno-miR-208a-5p, dno-miR-208b-3p, dno-miR-208b- 5p, dno-miR-20a-3p, dno-miR-20a-5p, dno-miR-20b-3p, dno-miR-20b-5p, dno-miR-21-3p, dno-miR-21-5p, dno-miR-210-3p, dno-miR-210-5p, dno-miR-211-3p, dno-miR-211-5p, dno- miR-2114-3p, dno-miR-2114-5p, dno-miR-214-3p. dno-miR-214-5p. dno-miR-215-3p, dno- miR-215-5p, dno-miR-216a-3p, dno-miR-216a-5p, dno-miR-216b-3p, dno-miR-216b-5p, dno-miR-217-3p, dno-miR-217-5p, dno-miR-218-2-3p, dno-miR-218-3p, dno-miR-218-5p, dno-miR-219a-3p, dno-miR-219a-5p, dno-miR-219b-3p, dno-miR-219b-5p, dno-miR-22-3p, dno-miR-22-5p, dno-miR-221-3p, dno-miR-221-5p, dno-miR-222-3p, dno-miR-222-5p, dno- miR-223-3p, dno-miR-223-5p, dno-miR-224-3p, dno-miR-224-5p, dno-miR-2355-3p, dno- miR-2355-5p, dno-miR-23a-3p, dno-miR-23a-5p, dno-miR-23b-3p, dno-miR-23b-5p, dno- miR-2483-3p, dno-miR-2483-5p, dno-miR-24a-3p, dno-miR-24a-5p, dno-miR-24b-3p, dno- miR-24b-5p, dno-miR-25-3p, dno-miR-25-5p, dno-miR-26a-2-3p, dno-miR-26a-3p, dno- miR-26a-5p, dno-miR-26b-3p, dno-miR-26b-5p, dno-miR-27a-3p, dno-miR-27a-5p, dno- miR-27b-3p, dno-miR-27b-5p, dno-miR-28-3p, dno-miR-28-5p, dno-miR-296-3p, dno-miR- 296-5p, dno-miR-299-3p, dno-miR-299-5p, dno-miR-29a-3p, dno-miR-29a-5p, dno-miR- 29b-2-5p, dno-miR-29b-3p, dno-miR-29b-5p, dno-miR-29c-3p. dno-miR-29c-5p, dno-miR- 301a-3p, dno-miR-301a-5p, dno-miR-301b-3p, dno-miR-301b-5p, dno-miR-302a-3p, dno- miR-302a-5p, dno-miR-302b-3p, dno-miR-302b-5p, dno-miR-302c-3p, dno-miR-302c-5p, dno-miR-302d-3p, dno-miR-302d-5p, dno-miR-3059-3p, dno-miR-3059-5p, dno-miR-3085- 3p, dno-miR-3085-5p, dno-miR-30a-3p, dno-miR-30a-5p, dno-miR-30b-3p, dno-miR-30b- 5p, dno-miR-30c-2-3p?dno-miR-30c-3p, dno-miR-30c-5p, dno-miR-30d-3p, dno-miR-30d- 5p, dno-miR-30e-3p, dno-miR-30e-5p, dno-miR-31-3p, dno-miR-31-5p, dno-miR-32-3p,dno-miR-32-5p, dno-miR-323a-3p, dno-miR-323a-5p, dno-miR-323b-3p, dno-miR-323b-5p, dno-miR-324-3p, dno-miR-324-5p, dno-miR-326-3p, dno-miR-326-5p?dno-miR-328-3p, dno-miR-328-5p, dno-miR-329-3p, dno-miR-329-5p, dno-miR-330-3p, dno-miR-330-5p, dno-miR-331-3p, dno-miR-331-5p, dno-miR-335-3p, dno-miR-335-5p. dno-miR-337-3p, dno-miR-337-5p, dno-miR-338-3p, dno-miR-338-5p, dno-miR-339-3p, dno-miR-339-5p, dno-miR-33a-3p. dno-miR-33a-5p, dno-miR-33b-3p, dno-miR-33b-5p, dno-miR-340-3p, dno-miR-340-5p, dno-miR-342-3p, dno-miR-342-5p. dno-miR-345-3p?dno-miR-345-5p, dno-miR-34a-3p dno-miR-34a-5p, dno-miR-34b-3p, dno-miR-34b-5p, dno-miR-34c-3p, dno-miR-34c-5p. dno-miR-361-3p, dno-miR-361-5p, dno-miR-3613-3p, dno-miR-3613-5p, dno-miR-362-3p, dno-miR-362-5p, dno-miR-363-3p, dno-miR-363-5p. dno-miR-365-2-5p, dno-miR-365-3p, dno-miR-365-5p, dno-miR-367-3p, dno-miR-367-5p?dno-miR-369-3p, dno-miR-369-5p, dno-miR-371-3p, dno-miR-371-5p, dno-miR-372-3p dno-miR-372-5p, dno-miR-374a-3p, dno-miR-374a-5p, dno-miR-375-3p, dno-miR-375-5p, dno-miR-376a-3p, dno-miR-376a-5p, dno-miR-376b-3p, dno-miR-376b-5p, dno-miR-376d-3p, dno-miR-376d- 5p, dno-miR-377-3p?dno-miR-377-5p, dno-miR-378-3p, dno-miR-378-5p. dno-miR-379-3p, dno-miR-379-5p, dno-miR-380-3p, dno-miR-380-5p. dno-miR-381-3p. dno-miR-381-5p, dno-miR-382-3p, dno-miR-382-5p, dno-miR-383-3p, dno-miR-383-5p dno-miR-3959-3p, dno-miR-3959-5p, dno-miR-409-3p, dno-miR-409-5p, dno-miR-410-3p, dno-miR-410-5p, dno-miR-41 l-3p, dno-miR-41 l-5p, dno-miR-412-3p, dno-miR-412-5p. dno-miR-421-3p, dno-miR-421-5p, dno-miR-423-3p, dno-miR-423-5p, dno-miR-424-3p?dno-miR-424-5p, dno-miR-425-3p, dno-miR-425-5p, dno-miR-429-3p, dno-miR-429-5p dno-miR-432-3p, dno-miR-432-5p, dno-miR-433-3p, dno-miR-433-5p, dno-miR-449a-3p, dno-miR-449a-5p, dno-miR-449b-3p, dno-miR-449c-3p, dno-miR-449c-5p, dno-miR-450a-3p, dno-miR-450a- 5p, dno-miR-450b-3p, dno-miR-450b-5p, dno-miR-450c-3p, dno-miR-450c-5p, dno-miR- 451-5p, dno-miR-454-3p, dno-miR-454-5p, dno-miR-455-3p, dno-miR-455-5p, dno-miR- 483-3p, dno-miR-483-5p, dno-miR-485-3p, dno-miR-485-5p, dno-miR-486-3p, dno-miR- 486-5p, dno-miR-487a-3p, dno-miR-487a-5p, dno-miR-487b-3p, dno-miR-487b-5p, dno- miR-488-3p, dno-miR-488-5p, dno-miR-489-3p, dno-miR-489-5p, dno-miR-490-3p. dno- miR-490-5p. dno-miR-491-3p, dno-miR-491-5p, dno-miR-493-3p, dno-miR-493-5p. dno- miR-494-3p, dno-miR-494-5p, dno-miR-495-3p, dno-miR-495-5p, dno-miR-496-3p, dno- miR-496-5p, dno-miR-497-3p, dno-miR-497-5p, dno-miR-499-3p, dno-miR-499-5p, dno- miR-500a-3p, dno-miR-500a-5p, dno-miR-500b-3p, dno-miR-500b-5p, dno-miR-502-3p, dno-miR-502-5p, dno-miR-503-3p, dno-miR-503-5p, dno-miR-504-3p?dno-miR-504-5p, dno-miR-505-3p, dno-miR-505-5p, dno-miR-506-3p, dno-miR-506-5p, dno-miR-507-3p,dno-miR-507-5p, dno-miR-508-3p, dno-miR-508-5p, dno-miR-509a-2-5p, dno-miR-509a-3p, dno-miR-509a-5p, dno-miR-509b-3p, dno-miR-509b-5p, dno-miR-512-3p. dno-miR-512-5p, dno-miR-532-3p, dno-miR-532-5p, dno-miR-539-3p, dno-miR-539-5p, dno-miR-541-3p, dno-miR-541-5p, dno-miR-542-3p, dno-miR-542-5p, dno-miR-543-3p. dno-miR-543-5p, dno-miR-545-3p, dno-miR-545-5p, dno-miR-551a-3p, dno-miR-551b-3p, dno-miR-551b-5p, dno-miR-574-3p, dno-miR-574-5p, dno-miR-582-3p, dno-miR-582-5p, dno-miR-590-3p, dno-miR-590-5p, dno-miR-628-3p, dno-miR-628-5p. dno-miR-652-3p, dno-miR-652-5p, dno-miR-6529-3p, dno-miR-6529-5p, dno-miR-653-3p, dno-miR-653-5p, dno-miR-654-3p, dno-miR-654-5p, dno-miR-656-3p, dno-miR-656-5p, dno-miR-660-3p. dno-miR-660-5p, dno-miR-670-3p, dno-miR-670-5p, dno-miR-671-3p, dno-miR-671-5p, dno-miR-672-3p, dno-miR-672-5p, dno-miR-675-3p, dno-miR-675-5p, dno-miR-676-3p, dno-miR-676-5p, dno-miR-7-2-3p, dno-miR-7-3-3p, dno-miR-7-3p, dno-miR-7-5p, dno-miR-708-3p, dno- miR-708-5p, dno-miR-744-3p, dno-miR-744-5p, dno-miR-758-3p, dno-miR-758-5p, dno- miR-760-3p, dno-miR-760-5p, dno-miR-802-3p, dno-miR-802-5p, dno-miR-873-3p, dno- miR-873-5p, dno-miR-874-3p, dno-miR-874-5p, dno-miR-885-3p, dno-miR-885-5p. dno- miR-889-3p. dno-miR-889-5p, dno-miR-9-3p, dno-miR-9-5p, dno-miR-92a-2-5p, dno-miR- 92a-3p, dno-miR-92a-5p, dno-miR-92b-3p, dno-miR-92b-5p, dno-miR-93-3p, dno-miR-93- 5p, dno-miR-95-3p, dno-miR-95-5p, dno-miR-96-3p, dno-miR-96-5p, dno-miR-98-3p, dno- miR-98-5p, dno-miR-99a-3p, dno-miR-99a-5p, dpe-bantam, dpe-let-7, dpe-miR-1, dpe-miR- 10, dpe-miR-100, dpe-miR-11, dpe-miR-12. dpe-miR-124, dpe-miR-125, dpe-miR-133, dpe- miR-13a, dpe-miR-13b, dpe-miR-14, dpe-miR-184-3p, dpe-miR-184-5p, dpe-miR-210, dpe- miR-219, dpe-miR-263a, dpe-miR-263b, dpe-miR-274, dpe-miR-275, dpe-miR-276a, dpe- miR-276b, dpe-miR-277, dpe-miR-278, dpe-miR-279, dpe-miR-280, dpe-miR-281-l-5p, dpe-miR-281-2-5p, dpe-miR-281-3p, dpe-miR-282, dpe-miR-283, dpe-miR-284. dpe-miR- 286, dpe-miR-287, dpe-miR-288, dpe-miR-289, dpe-miR-2a, dpe-miR-2b, dpe-miR-2c, dpe- miR-3, dpe-miR-305, dpe-miR-306, dpe-miR-307, dpe-miR-308, dpe-miR-309, dpe-miR- 314, dpe-miR-315, dpe-miR-316, dpe-miR-317, dpe-miR-318, dpe-miR-31a, dpe-miR-31b, dpe-miR-33, dpe-miR-34, dpe-miR-4, dpe-miR-5. dpe-miR-6, dpe-miR-7, dpe-miR-79, dpe- miR-8, dpe-miR-87, dpe-miR-92a, dpe-miR-92b, dpe-miR-9a, dpe-miR-9b, dpe-miR-9c, dpe-miR-iab-4-3p, dpe-miR-iab-4-5p, dpr-miR156a, dpr-miR156b, dpr-miR160, dpr- miR166a, dpr-miR166b, dpr-miR167a, dpr-miR167b, dpr-miR167c, dpr-miR172a, dpr- miR172b, dpr-miR396, dpr-miR397, dpr-miR408, dps-bantam, dps-let-7, dps-miR-1, dps- miR-10, dps-miR-100, dps-miR-1000-3p, dps-miR-1000-5p, dps-miR-1002-3p, dps-miR- 1002-5p, dps-miR-1006-3p, dps-miR-1006-5p, dps-miR-1010-3p, dps-miR-1010-5p, dps-miR-11, dps-miR-12, dps-miR-124, dps-miR-125, dps-miR-133, dps-miR-137-3p, dps-miR- 137-5p, dps-miR-13a, dps-miR-13b. dps-miR-14, dps-miR-184, dps-miR-190-3p, dps-miR- 190-5p, dps-miR-193-3p, dps-miR-193-5p, dps-miR-210a, dps-miR-210b, dps-miR-219, dps- miR-2502, dps-miR-2503, dps-miR-2504, dps-miR-2505, dps-miR-2506, dps-miR-2507a, dps-miR-2507b-3p, dps-miR-2507b-5p, dps-miR-2508, dps-miR-2509, dps-miR-2510, dps- miR-2511, dps-miR-2512, dps-miR-2513a, dps-miR-2513b, dps-miR-2514, dps-miR-2515, dps-miR-2516. dps-miR-2517-3p, dps-miR-2517-5p, dps-miR-2518, dps-miR-2519. dps- miR-252-3p, dps-miR-252-5p, dps-miR-2520, dps-miR-2521 , dps-miR-2522a, dps-miR- 2522b-3p, dps-miR-2522b-5p, dps-miR-2523, dps-miR-2524. dps-miR-2525, dps-miR-2526- 3p, dps-miR-2527, dps-miR-2528, dps-miR-2529. dps-miR-2530, dps-miR-2531, dps-miR- 2532 dps-miR-2533, dps-miR-2534, dps-miR-2535-3p. dps-miR-2535-5p. dps-miR-2536- 3p, dps-miR-2536-5p, dps-miR-2537-3p, dps-miR-2537-5p, dps-miR-2538-3p, dps-miR- 2538-5p, dps-miR-2539-3p, dps-miR-2539-5p, dps-miR-2540-3p, dps-miR-2540-5p, dps- miR-2541-3p, dps-miR-2541-5p, dps-miR-2542-3p, dps-miR-2542-5p, dps-miR-2543a-3p, dps-miR-2543a-5p, dps-miR-2543b-3p, dps-miR-2543b-5p, dps-miR-2544-3p. dps-miR- 2544-5p. dps-miR-2545a-3p, dps-miR-2545a-5p, dps-miR-2545b, dps-miR-2546-3p. dps- miR-2546-5p, dps-miR-2547-3p, dps-miR-2547-5p, dps-miR-2548-3p, dps-miR-2548-5p, dps-miR-2549-3p, dps-miR-2549-5p, dps-miR-2550-3p, dps-miR-2550-5p, dps-miR-2551- 3p, dps-miR-2551-5p, dps-miR-2552-3p, dps-miR-2552-5p, dps-miR-2553-3p. dps-miR- 2553-5p, dps-miR-2554-3p, dps-miR-2554-5p, dps-miR-2555-3p, dps-miR-2555-5p. dps- miR-2556-3p, dps-miR-2556-5p, dps-miR-2557-3p, dps-miR-2557-5p, dps-miR-2558-3p, dps-miR-2558-5p, dps-miR-2559-3p, dps-miR-2559-5p, dps-miR-2560-3p, dps-miR-2560- 5p, dps-miR-2561-3p, dps-miR-2561-5p, dps-miR-2562-3p, dps-miR-2562-5p, dps-miR- 2563-3p, dps-miR-2563-5p, dps-miR-2564-3p, dps-miR-2564-5p, dps-miR-2565-3p. dps- miR-2565-5p, dps-miR-2566a-l-5p, dps-miR-2566a-2-5p, dps-miR-2566a-3p, dps-miR- 2566b-3p, dps-miR-2566b-5p, dps-miR-2567a-3p, dps-miR-2567a-5p, dps-miR-2567b-3p, dps-miR-2567b-5p, dps-miR-2567c-3p, dps-miR-2567c-5p, dps-miR-2568a-3p, dps-miR- 2568a-5p, dps-miR-2568b-3p, dps-miR-2568b-5p, dps-miR-2569-3p. dps-miR-2569-5p, dps- miR-2570-3p, dps-miR-2570-5p, dps-miR-2571-3p. dps-miR-2571-5p. dps-miR-2572-3p, dps-miR-2572-5p, dps-miR-2573-3p, dps-miR-2573-5p, dps-miR-2574a-3p, dps-miR-2574a- 5p, dps-miR-2574b, dps-miR-2575-3p, dps-miR-2575-5p, dps-miR-2576, dps-miR-263a, dps-miR-263b, dps-miR-274, dps-miR-275, dps-miR-276a, dps-miR-276b, dps-miR-276c, dps-miR-277, dps-miR-278, dps-miR-279, dps-miR-280, dps-miR-281, dps-miR-282, dps- miR-283, dps-miR-284, dps-miR-285, dps-miR-286, dps-miR-287, dps-miR-288, dps-miR-289, dps-miR-2a, dps-miR-2b, dps-miR-2c, dps-miR-3, dps-miR-304, dps-miR-305, dps- miR-306, dps-miR-307a, dps-miR-307b, dps-miR-308, dps-miR-309, dps-miR-31 l-3p, dps- miR-311-5p, dps-miR-314, dps-miR-315, dps-miR-316, dps-miR-317, dps-miR-318, dps- miR-31a, dps-miR-31b, dps-miR-33, dps-miR-34, dps-miR-375-3p, dps-miR-375-5p, dps- miR-3983, dps-miR-4, dps-miR-5, dps-miR-6, dps-miR-7, dps-miR-79, dps-miR-8, dps-miR- 87, dps-miR-927-3p, dps-miR-927-5p, dps-miR-929-3p, dps-miR-929-5p, dps-miR-92a, dps- miR-92b, dps-miR-92c-3p, dps-miR-92c-5p, dps-miR-932-3p, dps-miR-932-5p, dps-miR- 957-3p, dps-miR-957-5p, dps-miR-958-3p, dps-miR-958-5p, dps-miR-959-3p, dps-miR-959- 5p, dps-miR-964-3p, dps-miR-964-5p, dps-miR-965-3p, dps-miR-965-5p, dps-miR-968-3p, dps-miR-968-5p, dps-miR-969-3p, dps-miR-969-5p, dps-miR-970-3p, dps-miR-970-5p, dps- miR-971-3p, dps-miR-971-5p. dps-miR-980-3p, dps-miR-980-5p, dps-miR-981-3p, dps- miR-981-5p, dps-miR-986-3p, dps-miR-986-5p, dps-miR-987-3p, dps-miR-987-5p, dps- miR-988-3p, dps-miR-988-5p, dps-miR-989, dps-miR-993-3p, dps-miR-993-5p, dps-miR- 994-3p, dps-miR-994-5p, dps-miR-995-3p, dps-miR-995-5p, dps-miR-9a, dps-miR-9b, dps- miR-9c, dps-miR-iab-4-3p, dps-miR-iab-4-5p, dps-miR-iab-8-3p. dps-miR-iab-8-5p, dpu- bantam, dpu-miR-1, dpu-miR-10, dpu-miR-100, dpu-miR-12, dpu-miR-124, dpu-miR-133, dpu-miR-137, dpu-miR-153, dpu-miR-193, dpu-miR-2, dpu-miR-219, dpu-miR-252a, dpu- miR-252b, dpu-miR-263a, dpu-miR-263b, dpu-miR-275, dpu-miR-276, dpu-miR-278, dpu- miR-279a, dpu-miR-279b, dpu-miR-281, dpu-miR-283, dpu-miR-285, dpu-miR-305, dpu- miR-307, dpu-miR-31. dpu-miR-315, dpu-miR-317, dpu-miR-33, dpu-miR-34, dpu-miR- 375, dpu-miR-7, dpu-miR-71, dpu-miR-745, dpu-miR-8, dpu-miR-9-3p, dpu-miR-9-5p, dpu- miR-92, dpu-miR-96, dpu-miR-965, dpu-miR-981, dpu-miR-993, dpu-miR-iab-4-3p, dpu- miR-iab-4-5p, dqu-bantam-3p, dqu-bantam-5p, dqu-iab-4-3p, dqu-iab-4-5p, dqu-let-7-3p, dqu-let-7-5p, dqu-miR-10-3p, dqu-miR-10-5p, dqu-miR-100-3p, dqu-miR-100-5p, dqu-miR- 1000-3p, dqu-miR-1000-5p, dqu-miR-l l-3p, dqu-miR-l l-5p, dqu-miR-1165 l-3p, dqu-miR- 11651-5p, dqu-miR-11652-3p, dqu-miR-11652-5p, dqu-miR-11653-3p, dqu-miR-11653-5p, dqu-miR-11654-3p, dqu-miR-11654-5p, dqu-miR-11655-3p, dqu-miR-11655-5p, dqu-miR- 11656-3p, dqu-miR-11656-5p. dqu-miR-11657-3p, dqu-miR-11657-5 p, dqu-miR-11658-3p, dqu-miR-11658-5p, dqu-miR-11659-3p. dqu-miR-11659-5p, dqu-miR-11660-3p, dqu-miR- 11660-5p, dqu-miR-1166 l-3p, dqu-miR-1 1661-5p, dqu-miR-11662-3p, dqu-miR-11662-5p, dqu-miR-1175 -3 p, dqu-miR-1175-5p, dqu-miR-12-3p, dqu-miR-12-5p, dqu-miR-124-3p, dqu-miR-124-5p, dqu-miR-125-3p, dqu-miR-125 -5p, dqu-miR-133-3p, dqu-miR-133 -5p, dqu-miR-137-3p, dqu-miR-137-5p, dqu-miR-13a-3p, dqu-miR-13 a-5p. dqu-miR-13b-3p, dqu-miR-13b-5p, dqu-miR-14-3p, dqu-miR-14-5p, dqu-miR-184-3p, dqu-miR-184-5p, dqu-miR-190-3p, dqu-miR-190-5p, dqu-miR-193-3p, dqu-miR-193-5p, dqu-miR-la-3p, dqu-miR- la-5p, dqu-miR-lb-3p dqu-miR-lb-5p, dqu-miR-210-3p?dqu-miR-210-5p, dqu-miR-219- 3p, dqu-miR-219-5p, dqu-miR-252a-3p, dqu-miR-252a-5p, dqu-miR-252b-3p, dqu-miR- 252b-5p, dqu-miR-263a-3p, dqu-miR-263a-5p, dqu-miR-263b-3p, dqu-miR-263b-5p, dqu- miR-275-3p, dqu-miR-275-5p, dqu-miR-276-3p, dqu-miR-276-5p, dqu-miR-2765-3p, dqu- miR-2765-5p, dqu-miR-277-3p, dqu-miR-277-5p?dqu-miR-278-3p, dqu-miR-278-5p, dqu- miR-2788-3p, dqu-miR-2788-5p, dqu-miR-2796-3p, dqu-miR-2796-5p, dqu-miR-279a-3p, dqu-miR-279a-5p, dqu-miR-279b-3p, dqu-miR-279b-5p, dqu-miR-279c-3p, dqu-miR-279c- 5p, dqu-miR-281-3p, dqu-miR-281-5p, dqu-miR-282-3p, dqu-miR-282-5p, dqu-miR-283-3p, dqu-miR-283-5p, dqu-miR-29-3p, dqu-miR-29-5p, dqu-miR-2a-3p?dqu-miR-2a-5p, dqu- miR-2b-3p, dqu-miR-2b-5p, dqu-miR-305-3p, dqu-miR-305-5p, dqu-miR-306-3p, dqu-miR- 306-5p, dqu-miR-307-3p, dqu-miR-307-5p, dqu-miR-3 l-3p, dqu-miR-3 l-5p, dqu-miR-315- 3p, dqu-miR-315-5p, dqu-miR-316-3p, dqu-miR-316-5p, dqu-miR-317-3p, dqu-miR-317-5p, dqu-miR-33-3p, dqu-miR-33-5p, dqu-miR-34-3p, dqu-miR-34-5p, dqu-miR-3477-3p, dqu- miR-3477-5p, dqu-miR-3715-3p, dqu-miR-3715-5p, dqu-miR-375-3p, dqu-miR-375-5p. dqu-miR-3759-3p. dqu-miR-3770-3p. dqu-miR-3770-5p. dqu-miR-3782-5p, dqu-miR-3783- 3p, dqu-miR-3783-5p, dqu-miR-3785-3p, dqu-miR-3785-5p, dqu-miR-3786-3p, dqu-miR- 3786-5p, dqu-miR-6001-3p, dqu-miR-6001-5p, dqu-miR-6037-3p, dqu-miR-6037-5p, dqu- miR-6038-3p, dqu-miR-6038-5p, dqu-miR-6039-3p, dqu-miR-6039-5p, dqu-miR-6060-5p, dqu-miR-6065-3p, dqu-miR-6067-5p, dqu-miR-7-3p, dqu-miR-7-5p, dqu-miR-71-3p, dqu- miR-71-5p, dqu-miR-750-3p, dqu-miR-750-5p, dqu-miR-79-3p, dqu-miR-79-5p, dqu-miR-8- 3p, dqu-miR-8-5p, dqu-miR-87-3p, dqu-miR-87-5p, dqu-miR-9-3p, dqu-miR-9-5p, dqu-miR- 927a-3p, dqu-miR-927a-5p, dqu-miR-927b-3p, dqu-miR-927b-5p, dqu-miR-929-3p, dqu- miR-929-5p, dqu-miR-92a-3p. dqu-miR-92a-5p, dqu-miR-92b-3p, dqu-miR-92b-5p, dqu- miR-92c-3p, dqu-miR-92c-5p, dqu-miR-932-3p, dqu-miR-932-5p, dqu-miR-965-3p, dqu- miR-965-5p, dqu-miR-971-3p, dqu-miR-971-5p, dqu-miR-980-3p, dqu-miR-980-5p, dqu- miR-981-3p, dqu-miR-981-5p, dqu-miR-993-3p, dqu-miR-993-5p, dqu-miR-995-3p, dqu- miR-995-5p, dqu-miR-996-3p, dqu-miR-996-5p, dre-let-7a?dre-let-7b, dre-let-7c-3p, dre-let- 7c-5p, dre-let-7d-3p. dre-let-7d-5p, dre-let-7e. dre-let-7f, dre-let-7g, dre-let-7h. dre-let-7i, dre-let-7j, dre-miR-1, dre-miR-100-2-3p, dre-miR-100-3p, dre-miR-100-5p, dre-miR-lOla, dre-miR-lOlb, dre-miR-103, dre-miR-107a-3p, dre-miR-107 a-5p, dre-miR-107b, dre-miR- 10a-3p. dre-miR-10a-5p, dre-miR-10b-2-3p, dre-miR-1 Ob-3p, dre-miR-1 Ob-5p, dre-miR-lOc- 3p, dre-miR-10c-5p, dre-miR-10d-3p, dre-miR-10d-5p, dre-miR-122. dre-miR-124-3p, dre- miR-124-4-5p, dre-miR-124-5p, dre-miR-124-6-5p, dre-miR-125a, dre-miR-125b- l-3p, dre-miR-125b-2-3p, dre-miR-125b-3-3p, dre-miR-125b-5p, dre-miR-125c-3p, dre-miR-125c-5p, dre-miR-126a-3p, dre-miR-126a-5p. dre-miR-126b-3p, dre-miR-126b-5p, dre-miR-128-3-5p, dre-miR-128-3p, dre-miR-128-5p, dre-miR-129-l-3p, dre-miR-129-3-3p, dre-miR-129-3p, dre-miR-129-5p, dre-miR-1306, dre-miR-130a, dre-miR-130b, dre-miR-130c-3p, dre-miR- 130c-5p, dre-miR-132-3p, dre-miR-132-5p, dre-miR-133a-2-5p, dre-miR-133a-3p, dre-miR- 133a-5p, dre-miR-133b-3p, dre-miR-133b-5p. dre-miR-133c-3p, dre-miR-133c-5p, dre-miR- 135a. dre-miR-135b-3p, dre-miR-135b-5p, dre-miR-135c, dre-miR-137-3p, dre-miR-137-5p, dre-miR-138-2-3p, dre-miR-138-3p, dre-miR-138-5p, dre-miR-1388-3p, dre-miR-1388-5p, dre-miR-139-3p, dre-miR-139-5p, dre-miR-140-3p, dre-miR-140-5p, dre-miR-141-3p, dre- miR-141-5p, dre-miR-142a-3p, dre-miR-142a-5p, dre-miR-142b-5p, dre-miR-143, dre-miR- 144-3p, dre-miR-144-5p, dre-miR-145-3p, dre-miR-145-5p, dre-miR-146a, dre-miR-146b. dre-miR-148, dre-miR-150, dre-miR-152, dre-miR-153a-3p, dre-miR-153a-5p, dre-miR- 153b-3p, dre-miR-1 3b-5p, dre-miR-153c-3p, dre-miR-153c-5p, dre-miR-155, dre-miR-15a- 3p, dre-miR-15a-5p, dre-miR-15b-3p, dre-miR-1 b-5p, dre-miR-15c, dre-miR-16a, dre-miR- 16b, dre-miR-16c-3p, dre-miR-16c-5p, dre-miR-1788-3p. dre-miR-1788-5p, dre-miR-17a-2- 3p. dre-miR-17a-3p, dre-miR-17a-5p, dre-miR-181a-2-3p, dre-miR-181a-3-3p. dre-miR- 181a-3p, dre-miR-181a-4-3p, dre-miR-181a-5-3p, dre-miR-181a-5p, dre-miR-181b-3-3p, dre-miR-181b-3p, dre-miR-181b-5p, dre-miR-181c-3p, dre-miR-181c-5p, dre-miR-181d-3p, dre-miR-181d-5p, dre-miR-182-3p, dre-miR-182-5p, dre-miR-183-3p, dre-miR-183-5p, dre- miR-184, dre-miR-187, dre-miR-18a, dre-miR-18b-3p, dre-miR-18b-5p, dre-miR-18c. dre- miR-190a, dre-miR-190b, dre-miR-192, dre-miR-193a-3p, dre-miR-193a-5p, dre-miR-193b- 3p, dre-miR-193b-5p, dre-miR-194a, dre-miR-194b, dre-miR-196a-3p, dre-miR-196a-5p, dre-miR-196b, dre-miR-196c, dre-miR-196d, dre-miR-199-3-3p, dre-miR-199-3p, dre-miR- 199-5p, dre-miR-19a-3p, dre-miR-19a-5p. dre-miR-19b-3p. dre-miR-19b-5p, dre-miR-19c- 3p, dre-miR-19c-5p, dre-miR-19d-3p, dre-miR-19d-5p, dre-miR-200a-3p, dre-miR-200a-5p, dre-miR-200b-3p, dre-miR-200b-5p, dre-miR-200c-3p, dre-miR-200c-5p, dre-miR-202-3p, dre-miR-202-5p, dre-miR-203a-3p, dre-miR-203a-5p, dre-miR-203b-3p, dre-miR-203b-5p, dre-miR-204-2-3p, dre-miR-204-3-3p. dre-miR-204-3p. dre-miR-204-5p, dre-miR-205-3p, dre-miR-205-5p. dre-miR-206-3p. dre-miR-206-5p. dre-miR-20a-3p. dre-miR-20a-5p. dre- miR-20b-3p, dre-miR-20b-5p, dre-miR-21, dre-miR-210-3p, dre-miR-210-5p, dre-miR-212, dre-miR-212-3p, dre-miR-212-5p, dre-miR-214, dre-miR-216a, dre-miR-216b, dre-miR-217, dre-miR-2184, dre-miR-2185-3p, dre-miR-218 -5p, dre-miR-2186. dre-miR-2187-3p, dre- miR-2187-5p, dre-miR-2188-3p, dre-miR-2188-5p, dre-miR-2189, dre-miR-218a, dre-miR- 218b, dre-miR-219-3p, dre-miR-219-5p, dre-miR-2191, dre-miR-2192, dre-miR-2193, dre-miR-2194, dre-miR-2195, dre-miR-2196, dre-miR-2197, dre-miR-2198, dre-miR-221-3p, dre-miR-221-5p, dre-miR-222a-3p, dre-miR-222a-5p. dre-miR-222b. dre-miR-223, dre-miR- 22a-3p, dre-miR-22a-5p, dre-miR-22b-3p, dre-miR-22b-5p, dre-miR-23a-3-5p, dre-miR-23a- 3p, dre-miR-23a-5p, dre-miR-23b, dre-miR-23b-3p, dre-miR-23b-5p, dre-miR-24, dre-miR- 24b-3p, dre-miR-24b-5p, dre-miR-25-3p, dre-miR-25-5p, dre-miR-26a-2-3p, dre-miR-26a- 3p, dre-miR-26a-5p, dre-miR-26b. dre-miR-27a-3p. dre-miR-27a-5p, dre-miR-27b-3p. dre- miR-27b-5p. dre-miR-27c-3p, dre-miR-27c-5p, dre-miR-27d. dre-miR-27e, dre-miR-29a, dre-miR-29b, dre-miR-29b3-3p, dre-miR-29b3-5p, dre-miR-301a, dre-miR-301b-3p, dre- miR-301b-5p, dre-miR-301c-3p, dre-miR-301c-5p, dre-miR-30a-3p, dre-miR-30a-5p, dre- miR-30b, dre-miR-30c-3p, dre-miR-30c-5p, dre-miR-30d, dre-miR-30e-3p, dre-miR-30e-5p, dre-miR-31, dre-miR-338, dre-miR-338-3p, dre-miR-338-5p. dre-miR-34a, dre-miR-34b, dre-miR-34c-3p, dre-miR-34c-5p, dre-miR-363-3p, dre-miR-363-5p, dre-miR-365, dre-miR- 375, dre-miR-3906, dre-miR-429a, dre-miR-429b, dre-miR-430a-l l-5p, dre-miR-430a-12- 5p, dre-miR-430a-13-5p, dre-miR-430a-14-5p, dre-miR-430a-15-5p, dre-miR-430a-16-5p, dre-miR-430a-17- p, dre-miR-430a-3p, dre-miR-430a-4-5p, dre-miR-430a-5p. dre-miR- 430b-3p. dre-miR-430b-5p, dre-miR-430c-3p. dre-miR-430c-5p, dre-miR-430i-3p. dre-miR- 430i-5p, dre-miR-451, dre-miR-454a, dre-miR-454b, dre-miR-455-2-5p, dre-miR-455-3p, dre-miR-455-5p, dre-miR-456, dre-miR-457a, dre-miR-457b-3p, dre-miR-457b-5p, dre-miR- 458-3p, dre-miR-458-5p, dre-miR-459-3p, dre-miR-459-5p, dre-miR-460-3p, dre-miR-460- 5p, dre-miR-461, dre-miR-462, dre-miR-489, dre-miR-499-3p, dre-miR-499-5p, dre-miR- 7132-3p, dre-miR-7132-5p, dre-miR-7133-3p, dre-miR-7133-5p, dre-miR-7145, dre-miR- 7146-3p, dre-miR-7146-5p, dre-miR-7147, dre-miR-7148-3p, dre-miR-7148-5p, dre-miR- 7149-3p, dre-miR-7149-5p, dre-miR-722, dre-miR-723-3p, dre-miR-723-5p, dre-miR-724, dre-miR-725-3p, dre-miR-725-5p, dre-miR-726, dre-miR-727-3p, dre-miR-727-5p, dre-miR- 728, dre-miR-729, dre-miR-730, dre-miR-731, dre-miR-732, dre-miR-733, dre-miR-734, dre- miR-735-3p, dre-miR-735-5p, dre-miR-736, dre-miR-737-3p, dre-miR-737-5p, dre-miR-738, dre-miR-740, dre-miR-7a, dre-miR-7b, dre-miR-9-3p, dre-miR-9-4-3p, dre-miR-9-5p, dre- miR-9-7-3p, dre-miR-92a-2-5p, dre-miR-92a-3p, dre-miR-92a-5p, dre-miR-92b-3p, dre-miR- 92b-5p, dre-miR-93, dre-miR-96-3p, dre-miR-96-5p, dre-miR-99, dse-bantam. dse-let-7. dse- miR-1, dse-miR-10, dse-miR-100, dse-miR-11, dse-miR-12, dse-miR-124, dse-miR-125, dse- miR-133, dse-miR-13a, dse-miR-13b, dse-miR-14, dse-miR-184-3p, dse-miR-184-5p, dse- miR-210, dse-miR-219, dse-miR-2498a-3p, dse-miR-2498a-5p, dse-miR-2498b-3p, dse-miR- 2498b-5p, dse-miR-2499-3p, dse-miR-2499-5p. dse-miR-2582-3p, dse-miR-2582-5p, dse- miR-263a, dse-miR-263b, dse-miR-274, dse-miR-275, dse-miR-276a, dse-miR-276b, dse-miR-277, dse-miR-278, dse-miR-279, dse-miR-280, dse-miR-281-l-5p, dse-miR-281-2-5p, dse-miR-281-3p. dse-miR-282, dse-miR-283, dse-miR-284, dse-miR-285, dse-miR-286, dse- miR-287, dse-miR-288, dse-miR-289, dse-miR-2a, dse-miR-2b, dse-miR-2c, dse-miR-3, dse- miR-303-3p, dse-miR-303 -5p, dse-miR-304, dse-miR-305, dse-miR-306-3p, dse-miR-306- 5p, dse-miR-307, dse-miR-308, dse-miR-309, dse-miR-310-3p, dse-miR-310-5p, dse-miR- 31 l-3p, dse-miR-3 l l-5p, dse-miR-312-3p, dse-miR-312-5p, dse-miR-313 -3p, dse-miR-313- 5p. dse-miR-314, dse-miR-315, dse-miR-316. dse-miR-317, dse-miR-318, dse-miR-31a. dse- miR-3 l b, dse-miR-33, dse-miR-34, dse-miR-4, dse-miR-4966-2-3p, dse-miR-4966-3p, dse- miR-4966-5p, dse-miR-5, dse-miR-6, dse-miR-7, dse-miR-79, dse-miR-8, dse-miR-87, dse- miR-92a, dse-miR-92b, dse-miR-9369-3p, dse-miR-9369-5p, dse-miR-9680-3p, dse-miR- 9680-5p, dse-miR-9685-3p, dse-miR-9685-5p, dse-miR-973-3p, dse-miR-973-5p, dse-miR- 974-3p, dse-miR-974-5p, dse-miR-975-3p, dse-miR-975-5p, dse-miR-976, dse-miR-977-3p, dse-miR-977-5p, dse-miR-978a-3p, dse-miR-978a-5p, dse-miR-978b, dse-miR-982b, dse- miR-982c-3p, dse-miR-982c-5p, dse-miR-983-3p, dse-miR-983-5p, dse-miR-991-3p, dse- miR-991-5p, dse-miR-992-3p, dse-miR-992-5p. dse-miR-9a, dse-miR-9b, dse-miR-9c. dse- miR-iab-4-3p, dse-miR-iab-4-5p, dsi-bantam. dsi-let-7, dsi-miR-1, dsi-miR-10. dsi-miR-100, dsi-miR-1000-3p, dsi-miR-1000-5p, dsi-miR-1001-3p, dsi-miR-1001-5p, dsi-miR-1002-3p, dsi-miR-1002-5p, dsi-miR-1003-3p, dsi-miR-1003-5p, dsi-miR-1005-3p, dsi-miR-1005-5p, dsi-miR-1006-3p, dsi-miR-1006-5p, dsi-miR-1010-3p, dsi-miR-1010-5p, dsi-miR-1011, dsi- miR-1012-3p, dsi-miR-1012-5p. dsi-miR-1013, dsi-miR-11, dsi-miR-12. dsi-miR-124. dsi- miR-125, dsi-miR-133, dsi-miR-137-3p, dsi-miR-137-5p, dsi-miR-13a, dsi-miR-13b, dsi- miR-14, dsi-miR-184-3p, dsi-miR-184-5p, dsi-miR-190-3p, dsi-miR-190-5p, dsi-miR-193- 3p, dsi-miR-193-5p, dsi-miR-210, dsi-miR-219, dsi-miR-2489, dsi-miR-2494-3p, dsi-miR- 2494-5p, dsi-miR-2498a-3p, dsi-miR-2498a-5p. dsi-miR-2498b-3p, dsi-miR-2498b-5p, dsi- miR-2498c-3p, dsi-miR-2498c-5p, dsi-miR-2499-3p, dsi-miR-2499-5p, dsi-miR-252-3p, dsi- miR-252-5p, dsi-miR-2577, dsi-miR-2578, dsi-miR-2579, dsi-miR-2580, dsi-miR-2581, dsi- miR-2582a-3p, dsi-miR-2582a-5p, dsi-miR-2582b-3p, dsi-miR-2582b-5p, dsi-miR-2583-3p, dsi-miR-2583-5p, dsi-miR-2584-3p, dsi-miR-2584-5p, dsi-miR-263a, dsi-miR-263b, dsi- miR-275, dsi-miR-276a. dsi-miR-276b, dsi-miR-277. dsi-miR-278. dsi-miR-279, dsi-miR- 281-3p, dsi-miR-281-5p, dsi-miR-282, dsi-miR-283, dsi-miR-284, dsi-miR-285, dsi-miR- 286, dsi-miR-287, dsi-miR-288, dsi-miR-289, dsi-miR-2a, dsi-miR-2b, dsi-miR-2c, dsi-miR- 3, dsi-miR-303-3p, dsi-miR-303-5p, dsi-miR-304. dsi-miR-305, dsi-miR-307, dsi-miR-308, dsi-miR-309. dsi-miR-310-3p, dsi-miR-310-5p, dsi-miR-311-3p, dsi-miR-311-5p, dsi-miR- 312-3p, dsi-miR-312-5p, dsi-miR-313-3p, dsi-miR-313-5p, dsi-miR-314, dsi-miR-315, dsi-miR-316, dsi-miR-317, dsi-miR-318, dsi-miR-31a, dsi-miR-31b, dsi-miR-33, dsi-miR-34, dsi-miR-375-3p, dsi-miR-375-5p, dsi-miR-4, dsi-miR-4966-3-3p?dsi-miR-4966-3p, dsi-miR- 4966-5p, dsi-miR-5, dsi-miR-6-3p, dsi-miR-6-5p, dsi-miR-7, dsi-miR-8, dsi-miR-87, dsi- miR-927-3p, dsi-miR-927-5p, dsi-miR-929-3p, dsi-miR-929-5p, dsi-miR-92a, dsi-miR-92b, dsi-miR-932-3p, dsi-miR-932-5p, dsi-miR-9369-3p, dsi-miR-9369-5p, dsi-miR-955-3p, dsi- miR-955-5p, dsi-miR-957, dsi-miR-958-3p, dsi-miR-958-5p, dsi-miR-959, dsi-miR-960. dsi- miR-961-3p. dsi-miR-961-5p, dsi-miR-962. dsi-miR-963-3p, dsi-miR-963-5p, dsi-miR-964- 3p, dsi-miR-964-5p, dsi-miR-965-3p, dsi-miR-965-5p, dsi-miR-967-3p, dsi-miR-967-5p, dsi- miR-968-3p, dsi-miR-968-5p, dsi-miR-9680-3p, dsi-miR-9680-5p, dsi-miR-969-3p, dsi-miR- 969-5p, dsi-miR-970-3p, dsi-miR-970-5p, dsi-miR-972-3p, dsi-miR-972-5p, dsi-miR-973-3p, dsi-miR-973-5p, dsi-miR-974-3p, dsi-miR-974-5p, dsi-miR-975-3p, dsi-miR-975-5p, dsi- miR-976-3p, dsi-miR-976-5p, dsi-miR-977-3p, dsi-miR-977-5p, dsi-miR-978a-3p, dsi-miR- 978a-5p, dsi-miR-978b-3p, dsi-miR-978b-5p, dsi-miR-980-3p, dsi-miR-980-5p, dsi-miR- 981-3p, dsi-miR-981-5p, dsi-miR-982a-3p, dsi-miR-982a-5p, dsi-miR-982b-3p, dsi-miR- 982b-5p, dsi-miR-982c-3p, dsi-miR-982c-5p, dsi-miR-983a-3p, dsi-miR-983a-5p, dsi-miR- 983b-3p. dsi-miR-983b-5p, dsi-miR-986-3p, dsi-miR-986-5p. dsi-miR-987-3p. dsi-miR-987- 5p, dsi-miR-988-3p, dsi-miR-988-5p, dsi-miR-989, dsi-miR-991-3p, dsi-miR-991-5p, dsi- miR-992-3p, dsi-miR-992-5p, dsi-miR-993-3p, dsi-miR-993-5p, dsi-miR-995-3p, dsi-miR- 995-5p, dsi-miR-999-3p. dsi-miR-999-5p, dsi-miR-9a, dsi-miR-iab-4-3p, dsi-miR-iab-4-5p, dsi-miR-iab-8-3p, dsi-miR-iab-8-5p. dvi-bantam-3p, dvi-bantam-5p, dvi-let-7, dvi-miR-l-3p, dvi-miR-l-5p, dvi-miR-10-3p, dvi-miR-10-5p, dvi-miR-100-3p, dvi-miR-100-5p, dvi-miR- 1000-3p, dvi-miR-1000-5p, dvi-miR-1002-3p, dvi-miR-1002-5p, dvi-miR-1003-3p, dvi-miR- 1006-3p, dvi-miR-1006-5p, dvi-miR-1007-3p, dvi-miR-1010-3p, dvi-miR-1010-5p, dvi-miR- 1017-3p, dvi-miR-l l-3p, dvi-miR-l l-5p, dvi-miR-12-3p, dvi-miR-12-5p, dvi-miR-124-3p, dvi-miR-124-5p, dvi-miR-125-3p, dvi-miR-125-5p, dvi-miR-133-3p, dvi-miR-133-5p, dvi- miR-137-3p, dvi-miR-13a-3p, dvi-miR-13a-5p, dvi-miR-13b-2-5p, dvi-miR-13b-3p, dvi- miR-13b-5p, dvi-miR-14-3p, dvi-miR-14-5p, dvi-miR-184-3p, dvi-miR-184-5p, dvi-miR- 190-3p, dvi-miR-190-5p, dvi-miR-193-3p, dvi-miR-193-5p, dvi-miR-210-3p, dvi-miR-210- 5p, dvi-miR-219-3p. dvi-miR-219-5p. dvi-miR-252-3p. dvi-miR-252-5p. dvi-miR-263a-3p, dvi-miR-263a-5p, dvi-miR-263b-3p dvi-miR-263b-5p, dvi-miR-274 dvi-miR-275-3p, dvi- miR-275-5p, dvi-miR-276a-3p, dvi-miR-276a-5p, dvi-miR-276b-3p, dvi-miR-276b-5p, dvi- miR-277-3p, dvi-miR-277-5p, dvi-miR-278-3p, dvi-miR-278-5p, dvi-miR-279-3p, dvi-miR- 279-5p, dvi-miR-280, dvi-miR-281-l-5p, dvi-miR-281-2-5p, dvi-miR-281-3p, dvi-miR-282- 3p, dvi-miR-282-5p, dvi-miR-283-3p, dvi-miR-283-5p, dvi-miR-284-3p, dvi-miR-284-5p,dvi-miR-285-3p, dvi-miR-285-5p, dvi-miR-286-3p, dvi-miR-286-5p, dvi-miR-287, dvi-miR- 288, dvi-miR-2a-2-5p, dvi-miR-2a-3p, dvi-miR-2a-5p, dvi-miR-2b-3p, dvi-miR-2b-5p, dvi- miR-2c-3p, dvi-miR-2c-5p, dvi-miR-3-3p, dvi-miR-3-5p, dvi-miR-304-3p, dvi-miR-304-5p, dvi-miR-305-3p, dvi-miR-305-5p, dvi-miR-306-3p, dvi-miR-306-5p, dvi-miR-307, dvi-miR- 308-3p, dvi-miR-308-5p, dvi-miR-309-3p, dvi-miR-309-5p, dvi-miR-310-3p, dvi-miR-310- 5p, dvi-miR-31 l-3p, dvi-miR-31 l-5p, dvi-miR-313-3p, dvi-miR-313-5p, dvi-miR-314-3p, dvi-miR-314-5p. dvi-miR-315a, dvi-miR-315b, dvi-miR-316-3p, dvi-miR-316-5p, dvi-miR- 317-3p, dvi-miR-317-5p, dvi-miR-318, dvi-miR-31 a-3p, dvi-miR-31 a-5p, dvi-miR-31 b, dvi- miR-33-3p, dvi-miR-33-5p, dvi-miR-34-3p, dvi-miR-34-5p, dvi-miR-375-3p, dvi-miR-375- 5p, dvi-miR-4-3p, dvi-miR-4-5p, dvi-miR-5-3p, dvi-miR-5-5p, dvi-miR-6-l-5p, dvi-miR-6- 2-5p. dvi-miR-6-3-5p, dvi-miR-6-3p, dvi-miR-7-3p, dvi-miR-7-5p. dvi-miR-79-3p, dvi-miR- 79-5p, dvi-miR-8-3p, dvi-miR-8-5p, dvi-miR-87-3p, dvi-miR-87-5p, dvi-miR-927-3p, dvi- miR-927-5p, dvi-miR-929-5p, dvi-miR-92a-3p, dvi-miR-92a-5p, dvi-miR-92b-3p, dvi-miR- 92b-5p, dvi-miR-932-3p, dvi-miR-932-5p, dvi-miR-9538-3p, dvi-miR-9538-5p, dvi-miR- 9538b-3p, dvi-miR-9538b-5p, dvi-miR-9539-3p, dvi-miR-9539-5p, dvi-miR-9540-3p, dvi- miR-9540-5p, dvi-miR-9541a-3p, dvi-miR-9541a-5p. dvi-miR-9541b-3p, dvi-miR-9541b-5p, dvi-miR-9542a-3p, dvi-miR-9542a-5p, dvi-miR-9542b-3p, dvi-miR-9542b-5p, dvi-miR- 9542c-3p, dvi-miR-9542c-5p, dvi-miR-9542d-3p, dvi-miR-9542d-5p, dvi-miR-9542e-3p, dvi-miR-9542e-5p. dvi-miR-9543a-3p, dvi-miR-9543a-5p, dvi-miR-9544a-3p, dvi-miR- 9544a-5p, dvi-miR-9544b-3p, dvi-miR-9544b-5p. dvi-miR-9544c-3p, dvi-miR-9544c-5p, dvi-miR-9545-3p, dvi-miR-9545-5p, dvi-miR-9546-3p, dvi-miR-9546-5p, dvi-miR-9547-3p, dvi-miR-9547-5p, dvi-miR-9548-3p, dvi-miR-9548-5p, dvi-miR-9549-3p, dvi-miR-9549-5p, dvi-miR-955-3p, dvi-miR-9550-3p, dvi-miR-9550-5p, dvi-miR-956-3p, dvi-miR-956-5p, dvi-miR-957-3p, dvi-miR-958-3p, dvi-miR-958-5p, dvi-miR-962-5p. dvi-miR-963-5p. dvi- miR-964-5p, dvi-miR-965-3p, dvi-miR-965-5p, dvi-miR-968-3p, dvi-miR-968-5p, dvi-miR- 969-3p, dvi-miR-969-5p, dvi-miR-9692-3p, dvi-miR-9692-5p, dvi-miR-9693-3p, dvi-miR- 9693-5p, dvi-miR-9694-3p, dvi-miR-9694-5p, dvi-miR-9695-3p, dvi-miR-9695-5p, dvi-miR- 9696a-3p, dvi-miR-9696a-5p, dvi-miR-9696b-3p, dvi-miR-9696b-5p, dvi-miR-9697-3p, dvi- miR-9697-5p, dvi-miR-9698-3p, dvi-miR-9698-5p, dvi-miR-9699-3p, dvi-miR-9699-5p, dvi- miR-970-3p, dvi-miR-970-5p, dvi-miR-9700a-3p, dvi-miR-9700a-5p, dvi-miR-9700b-3p, dvi-miR-9700b-5p, dvi-miR-9701a-3p, dvi-miR-9701a-5p, dvi-miR-9701b-3p, dvi-miR- 9701b-5p, dvi-miR-9702-3p, dvi-miR-9702-5p, dvi-miR-9703-3p, dvi-miR-9703-5p, dvi- miR-9704-2-3p, dvi-miR-9704-3p, dvi-miR-9704-5p, dvi-miR-9705-3p, dvi-miR-9705-5p, dvi-miR-9706a-3p, dvi-miR-9706a-5p, dvi-miR-9706b-3p, dvi-miR-9706b-5p, dvi-miR-9707-3p, dvi-miR-9707-5p, dvi-miR-9708a-3p, dvi-miR-9708a-5p, dvi-miR-9708b-3p, dvi- miR-9708b-5p, dvi-miR-9708c-3p, dvi-miR-9708c-5p, dvi-miR-9708d-3p, dvi-miR-9708d- 5p, dvi-miR-9709-3p, dvi-miR-9709-5p, dvi-miR-971-3p, dvi-miR-9710-3p, dvi-miR-9710- 5p, dvi-miR-9711-3p, dvi-miR-971 l-5p, dvi-miR-9712-3p, dvi-miR-9712-5p, dvi-miR-9713- 3p, dvi-miR-9713-5p, dvi-miR-9714-3p, dvi-miR-9714-5p, dvi-miR-9716-3p, dvi-miR-9716- 5p, dvi-miR-9717-3p, dvi-miR-9717-5p, dvi-miR-9719-3p, dvi-miR-9719-5p, dvi-miR-9720- 3p. dvi-miR-9720-5p, dvi-miR-9721-3p, dvi-miR-9721-5p. dvi-miR-973-3p. dvi-miR-973- 5p, dvi-miR-974-l-3p, dvi-miR-974-l-5p, dvi-miR-974-2-5p, dvi-miR-974-3p, dvi-miR-975- 3p, dvi-miR-975-5p, dvi-miR-976-3p, dvi-miR-976-5p, dvi-miR-977-3p, dvi-miR-977-5p, dvi-miR-980-3p, dvi-miR-980-5p, dvi-miR-981-3p, dvi-miR-981-5p, dvi-miR-986-3p, dvi- miR-986-5p, dvi-miR-987-5p, dvi-miR-988-3p. dvi-miR-988-5p. dvi-miR-989-3p. dvi-miR- 989-5p, dvi-miR-993-3p, dvi-miR-993-5p, dvi-miR-994-3p, dvi-miR-994-5p, dvi-miR-995- 3p, dvi-miR-995-5p, dvi-miR-996-3p, dvi-miR-996-5p, dvi-miR-998-3p, dvi-miR-998-5p, dvi-miR-999-3p, dvi-miR-999-5p, dvi-miR-9a-3p, dvi-miR-9a-5p, dvi-miR-9b-3p, dvi-miR- 9b-5p, dvi-miR-9c-3p, dvi-miR-9c-5p, dvi-miR-iab-4-3p, dvi-miR-iab-4-5p, dvi-miR-iab-8- 3p. dvi-miR-iab-8-5p, dwi-bantam, dwi-let-7, dwi-miR-1. dwi-miR-10. dwi-miR-100, dwi- miR-11, dwi-miR-12, dwi-miR-124, dwi-miR-125, dwi-miR-133, dwi-miR-13a, dwi-miR- 13b, dwi-miR-14, dwi-miR-184-3p, dwi-miR-184-5p, dwi-miR-210, dwi-miR-219, dwi-miR- 263a, dwi-miR-263b, dwi-miR-274, dwi-miR-275, dwi-miR-276a-3p, dwi-miR-276a-5p, dwi-miR-276b-3p, dwi-miR-276b-5p, dwi-miR-277, dwi-miR-278. dwi-miR-279, dwi-miR- 280, dwi-miR-281-l-5p, dwi-miR-281-2-5p, dwi-miR-281-3p, dwi-miR-282, dwi-miR-283, dwi-miR-284, dwi-miR-285, dwi-miR-286, dwi-miR-287, dwi-miR-288, d\\i-miR-2a. dwi- miR-2b, dwi-miR-2c, dwi-miR-3, dwi-miR-304, dwi-miR-305, dwi-miR-306, dwi-miR-307, dwi-miR-308, dwi-miR-309. dwi-miR-314, dwi-miR-315, dwi-miR-316, dwi-miR-317, dwi- miR-318, dwi-miR-31a, dwi-miR-31b, dwi-miR-33, dwi-miR-34, dwi-miR-4, dwi-miR-5, dwi-miR-6, dwi-miR-7, dwi-miR-79, dwi-miR-8, dwi-miR-87, dwi-miR-92a, dwi-miR-92b, dwi-miR-9a, dwi-miR-9b, dwi-miR-9c, dwi-miR-iab-4-3p. dwi-miR-iab-4-5p, dya-bantam, dya-let-7, dya-miR-1, dya-miR-10, dya-miR-100, dya-miR-11, dya-miR-124, dya-miR-125, dya-miR-133, dya-miR-13a. dya-miR-13b, dya-miR-14, dya-miR-184-3p, dya-miR-184-5p, dya-miR-210, dya-miR-219, dya-miR-2498-3p, dya-miR-2498-5p, dya-miR-2499, dya-miR- 263a, dya-miR-263b, dya-miR-274, dya-miR-275, dya-miR-276a, dya-miR-276b, dya-miR- 277, dya-miR-278, dya-miR-279, dya-miR-280, dya-miR-281-l-5p, dya-miR-281-2-5p, dya- miR-281-3p, dya-miR-282, dya-miR-283, dya-miR-284, dya-miR-285, dya-miR-286, dya- miR-287, dya-miR-288, dya-miR-289, dya-miR-2a, dya-miR-2b, dya-miR-2c, dya-miR-3,dya-miR-303, dya-miR-304, dya-miR-305, dya-miR-306-3p, dya-miR-306-5p, dya-miR-307, dya-miR-308, dya-miR-309. dya-miR-310-3p, dya-miR-310-5p, dya-miR-311a-3p, dya-miR- 311a-5p, dya-miR-311b-3p, dya-miR-311b-5p, dya-miR-312-3p, dya-miR-312-5p, dya-miR- 314, dya-miR-315, dya-miR-316, dya-miR-317, dya-miR-318, dya-miR-31a, dya-miR-31b, dya-miR-33, dya-miR-34, dya-miR-4, dya-miR-5, dya-miR-6, dya-miR-7, dya-miR-79, dya- miR-8, dya-miR-87, dya-miR-92a, dya-miR-92b, dya-miR-9681-3p, dya-miR-9681-5p, dya- miR-9682-3p, dya-miR-9682-5p, dya-miR-9683-3p, dya-miR-9683-5p, dya-miR-9690-3p. dya-miR-9690-5p, dya-miR-975-3p, dya-miR-975-5p, dya-miR-976-3p, dya-miR-976-5p, dya-miR-977-3p, dya-miR-977-5p, dya-miR-978-3p, dya-miR-978-5p, dya-miR-991-3p, dya- miR-991-5p, dya-miR-992-3p, dya-miR-992-5p, dya-miR-9a. dya-miR-9b, dya-miR-9c, dya- miR-iab-4-3p, dya-miR-iab-4-5p, ebv-miR-BARTl-3p, ebv-miR-BARTl-5p, ebv-miR- BART10-3p, ebv-miR-BART10-5p, ebv-miR-BARTl l-3p, ebv-miR-BARTl l-5p, ebv-miR- BART12, ebv-miR-BART13-3p, ebv-miR-BART13-5p, ebv-miR-BART14-3p, ebv-miR- BART14-5p, ebv-miR-BART15, ebv-miR-BART16, ebv-miR-BART17-3p, ebv-miR- BART17-5p. ebv-miR-BART18-3p. ebv-miR-BART18-5p. ebv-miR-BART19-3p. ebv-miR- BART19-5p. ebv-miR-BART2-3p, ebv-miR-BART2-5p. ebv-miR-BART20-3p. ebv-miR- BART20-5p, ebv-miR-BART21-3p, ebv-miR-BART21-5p, ebv-miR-BART22, ebv-miR- BART3-3p, ebv-miR-BART3-5p, ebv-miR-BART4-3p, ebv-miR-BART4-5p, ebv-miR- BART5-3p, ebv-miR-BART5-5p, ebv-miR-BART6-3p. ebv-miR-BART6-5p, ebv-miR- BART7-3p, ebv-miR-BART7-5p, ebv-miR-BART8-3p. ebv-miR-BART8-5p, ebv-miR- BART9-3p, ebv-miR-BART9-5p, ebv-miR-BHRFl-1, ebv-miR-BHRFl-2-3p, ebv-miR- BHRFl-2-5p, ebv-miR-BHRFl-3, eca-let-7a, eca-let-7c, eca-let-7d, eca-let-7e, eca-let-7f, eca-let-7g, eca-miR-1, eca-miR-100. eca-miR-101, eca-miR-103, eca-miR-105, eca-miR- 106a. eca-miR-106b. eca-miR-107a. eca-miR-107b. eca-miR-lOa, eca-miR-1 Ob, eca-miR- 1179, eca-miR-1180, eca-miR-1185, eca-miR-1 193, eca-miR-1197, eca-miR-1204, eca-miR- 122, eca-miR-124, eca-miR-1244, eca-miR-1248, eca-miR-1249, eca-miR-1255b, eca-miR- 125a-3p, eca-miR-125a-5p, eca-miR-125b-5p, eca-miR-126-3p, eca-miR-126-5p, eca-miR- 1261, eca-miR-1264, eca-miR-127, eca-miR-127 la. eca-miR-127 lb, eca-miR-128, eca-miR- 1282, eca-miR-1289, eca-miR-129 la, eca-miR-129 lb, eca-miR-1296, eca-miR-1298, eca- miR-129a-3p, eca-miR-129a-5p, eca-miR-129b-3p, eca-miR-129b-5p, eca-miR-1301, eca- miR-1302, eca-miR-1302b, eca-miR-1302c, eca-miR-1302d, eca-miR-1302e, eca-miR-1307, eca-miR-130a, eca-miR-130b, eca-miR-132, eca-miR-133a, eca-miR-133b, eca-miR-134, eca-miR-135a, eca-miR-135b, eca-miR-136, eca-miR-137, eca-miR-1379, eca-miR-138. eca- miR-1388, eca-miR-139-3p, eca-miR-139-5p, eca-miR-140-3p, eca-miR-140-5p, eca-miR-141, eca-miR-142-3p, eca-miR-142-5p, eca-miR-143, eca-miR-144, eca-miR-145, eca-miR- 1461, eca-miR-1468, eca-miR-146a. eca-miR-146b-3p, eca-miR-146b-5p, eca-miR-147b, eca-miR-148a, eca-miR-148b-3p, eca-miR-148b-5p, eca-miR-149, eca-miR-150, eca-miR- 15 l-5p, eca-miR-153, eca-miR-1543, eca-miR-154a, eca-miR-154b, eca-miR-155, eca-miR- 1597, eca-miR-15a, eca-miR-15b, eca-miR-16, eca-miR-17, eca-miR-181a, eca-miR-181b, eca-miR-182, eca-miR-183, eca-miR-1839, eca-miR-184. eca-miR-1842. eca-miR-185, eca- miR-186, eca-miR-187, eca-miR-188-3p, eca-miR-188-5p, eca-miR- 1892, eca-miR-1898, eca-miR-18a, eca-miR-18b, eca-miR-1902, eca-miR- 1905a, eca-miR- 1905b, eca-miR- 1905c, eca-miR-190a, eca-miR-190b, eca-miR-1911, eca-miR-1912, eca-miR-191a, eca-miR-191b, eca-miR-192, eca-miR- 193 a-3p, eca-miR-193a-5p, eca-miR-193b, eca-miR-194, eca-miR- 195, eca-miR-196a, eca-miR-196b, eca-miR-197, eca-miR-199a-3p, eca-miR- 199a-5p, eca- miR-199b-3p, eca-miR- 199b-5p, eca-miR-19a, eca-miR-19b, eca-miR-200a, eca-miR-200b, eca-miR-200c, eca-miR-204b, eca-miR-205, eca-miR-206, eca-miR-208a, eca-miR-208b, eca-miR-20a, eca-miR-20b, eca-miR-21, eca-miR-211, eca-miR-2114, eca-miR-212, eca- miR-214, eca-miR-215, eca-miR-216a, eca-miR-216b, eca-miR-217, eca-miR-218, eca-miR- 219-5p, eca-miR-22. eca-miR-221, eca-miR-222, eca-miR-223. eca-miR- 224, eca-miR-23a, eca-miR-23b, eca-miR-24, eca-miR-2483, eca-miR-25, eca-miR-26a, eca-miR-27a, eca-miR- 27b, eca-miR-28-3p, eca-miR-28-5p, eca-miR-296, eca-miR-299, eca-miR-29a, eca-miR- 29b, eca-miR-29c, eca-miR-301a, eca-miR-301b-3p, eca-miR-301b-5p, eca-miR-302a, eca- miR-302b, eca-miR-302c, eca-miR-302d, eca-miR-3065, eca-miR-30b, eca-miR-30c, eca- miR-30d, eca-miR-30e, eca-miR-31, eca-miR-32, eca-miR-3200, eca-miR-323-3p, eca-miR- 323-5p, eca-miR-324-3p, eca-miR-324-5p, eca-miR-326, eca-miR-328, eca-miR-329a, eca- miR-329b, eca-miR-330. eca-miR-331, eca-miR-335, eca-miR-337-3p, eca-miR-337-5p. eca- miR-338-3p, eca-miR-338-5p, eca-miR-33a, eca-miR-33b, eca-miR-340-3p, eca-miR-340- 5p, eca-miR-342-3p, eca-miR-342-5p, eca-miR-345-3p, eca-miR-345-5p, eca-miR-346, eca- miR-34a, eca-miR-34b-3p, eca-miR-34b-5p, eca-miR-34c, eca-miR-350, eca-miR-3548, eca- miR-361-3p, eca-miR-361-5p, eca-miR-3613, eca-miR-362-3p, eca-miR-362-5p, eca-miR- 363, eca-miR-365, eca-miR-367, eca-miR-369-3p, eca-miR-369-5p, eca-miR-370, eca-miR- 371-3p, eca-miR-371-5p, eca-miR-372, eca-miR-374a, eca-miR-374b, eca-miR-376a, eca- miR-376b, eca-miR-376c, eca-miR-377, eca-miR-378, eca-miR-379, eca-miR-380, eca-miR- 381, eca-miR-382, eca-miR-383, eca-miR-384, eca-miR-3958, eca-miR-3959, eca-miR-409- 3p, eca-miR-409-5p, eca-miR-410, eca-miR-411, eca-miR-412, eca-miR-421, eca-miR-423- 3p, eca-miR-423-5p, eca-miR-424, eca-miR-425, eca-miR-429. eca-miR-431, eca-miR-432, eca-miR-433, eca-miR-448, eca-miR-449a, eca-miR-449b, eca-miR-450a, eca-miR-450b-3p,eca-miR-450b-5p, eca-miR-450c, eca-miR-451, eca-miR-454, eca-miR-483, eca-miR-485- 3p, eca-miR-485-5p, eca-miR-486-3p. eca-miR-486-5p. eca-miR-487a. eca-miR-487b. eca- miR-488, eca-miR-489, eca-miR-490-3p, eca-miR-490-5p, eca-miR-491-3p, eca-miR-491- 5p, eca-miR-492, eca-miR-493a, eca-miR-493b, eca-miR-494, eca-miR-495, eca-miR-496, eca-miR-497, eca-miR-499-3p, eca-miR-499-5p, eca-miR-500, eca-miR-501-5p, eca-miR- 502-3p, eca-miR-502-5p, eca-miR-503, eca-miR-504. eca-miR-505, eca-miR-506a, eca-miR- 507a. eca-miR-507b. eca-miR-508-3p, eca-miR-508-5p, eca-miR-509a-5p. eca-miR-509b. eca-miR-514, eca-miR-514a, eca-miR-514b, eca-miR-532-3p, eca-miR-532-5p, eca-miR- 539, eca-miR-541, eca-miR-542-3p, eca-miR-542-5p, eca-miR-543, eca-miR-544, eca-miR- 544b. eca-miR-545, eca-miR-551a, eca-miR-551b, eca-miR-568, eca-miR-582-3p, eca-miR- 582-5p, eca-miR-590-3p, eca-miR-590-5p, eca-miR-592, eca-miR-598. eca-miR-615-3p, eca- miR-615-5p, eca-miR-628a, eca-miR-632, eca-miR-652, eca-miR-6529, eca-miR-653, eca- miR-655, eca-miR-656, eca-miR-660, eca-miR-664, eca-miR-670, eca-miR-671-3p, eca- miR-671-5p, eca-miR-672, eca-miR-675, eca-miR-676, eca-miR-684, eca-miR-7, eca-miR- 703, eca-miR-7035, eca-miR-7045, eca-miR-708, eca-miR-711, eca-miR-7143, eca-miR- 7177a, eca-miR-7177b, eca-miR-744, eca-miR-758. eca-miR-761, eca-miR-763. eca-miR- 764-3p, eca-miR-764-5p, eca-miR-7667, eca-miR-767-3p, eca-miR-767-5p, eca-miR-769a- 3p, eca-miR-769a-5p, eca-miR-769b, eca-miR-770-5p, eca-miR-802, eca-miR-872, eca-miR- 873, eca-miR-874, eca-miR-876-3p, eca-miR-876-5p, eca-miR-885-3p. eca-miR-885-5p, eca- miR-889, eca-miR-8908a, eca-miR-8908b, eca-miR-8908c. eca-miR-8908d, eca-miR-8908e, eca-miR-8908f, eca-miR-8908g, eca-miR-8908h, eca-miR-8908i, eca-miR-8908j, eca-miR- 8908k, eca-miR-89081, eca-miR-8908m, eca-miR-8908n, eca-miR-8909, eca-miR-8910, eca- miR-8911, eca-miR-8912, eca-miR-8913, eca-miR-8914, eca-miR-8915, eca-miR-8916, eca- miR-8917, eca-miR-8918, eca-miR-8919, eca-miR-8920, eca-miR-8921, eca-miR-8922, eca- miR-8923, eca-miR-8924, eca-miR-8925, eca-miR-8926, eca-miR-8927, eca-miR-8928, eca- miR-8929, eca-miR-8930, eca-miR-8931, eca-miR-8932, eca-miR-8933, eca-miR-8934, eca- miR-8935, eca-miR-8936, eca-miR-8937, eca-miR-8938, eca-miR-8939, eca-miR-8940, eca- miR-8941, eca-miR-8942, eca-miR-8943, eca-miR-8944, eca-miR-8945, eca-miR-8946, eca- miR-8947, eca-miR-8948, eca-miR-8949, eca-miR-8950. eca-miR-8951. eca-miR-8952. eca- miR-8953, eca-miR-8954, eca-miR-8955, eca-miR-8956, eca-miR-8957, eca-miR-8958, eca- miR-8959, eca-miR-8960, eca-miR-8961, eca-miR-8962, eca-miR-8963, eca-miR-8964, eca- miR-8965, eca-miR-8966, eca-miR-8967, eca-miR-8968, eca-miR-8969, eca-miR-8970, eca- miR-8971, eca-miR-8972, eca-miR-8973, eca-miR-8974, eca-miR-8975, eca-miR-8976, eca- miR-8977, eca-miR-8978, eca-miR-8979, eca-miR-8980, eca-miR-8981, eca-miR-8982, eca-miR-8983, eca-miR-8984, eca-miR-8985, eca-miR-8986a, eca-miR-8986b. eca-miR-8987, eca-miR-8988, eca-miR-8989. eca-miR-8990. eca-miR-8991. eca-miR-8992. eca-miR-8993. eca-miR-8994, eca-miR-8995, eca-miR-8996, eca-miR-8997, eca-miR-8998, eca-miR-8999, eca-miR-9000, eca-miR-9001, eca-miR-9002, eca-miR-9003, eca-miR-9004, eca-miR-9005, eca-miR-9006, eca-miR-9007, eca-miR-9008, eca-miR-9009, eca-miR-9010, eca-miR-9011, eca-miR-9012, eca-miR-9013, eca-miR-9014, eca-miR-9015, eca-miR-9016, eca-miR-9017, eca-miR-9018. eca-miR-9019. eca-miR-9020. eca-miR-9021. eca-miR-9022. eca-miR-9023. eca-miR-9024, eca-miR-9025, eca-miR-9026, eca-miR-9027, eca-miR-9028, eca-miR-9029, eca-miR-9030, eca-miR-9031, eca-miR-9032, eca-miR-9033, eca-miR-9034, eca-miR-9035, eca-miR-9036, eca-miR-9037, eca-miR-9038, eca-miR-9039, eca-miR-9040, eca-miR-9041, eca-miR-9042. eca-miR-9043. eca-miR-9044. eca-miR-9045. eca-miR-9046. eca-miR-9047. eca-miR-9048, eca-miR-9049, eca-miR-9050, eca-miR-9051, eca-miR-9052, eca-miR-9053, eca-miR-9054, eca-miR-9055, eca-miR-9056, eca-miR-9057, eca-miR-9058a, eca-miR- 9058b, eca-miR-9059, eca-miR-9060, eca-miR-9061, eca-miR-9062, eca-miR-9063, eca- miR-9064, eca-miR-9065, eca-miR-9066, eca-miR-9067, eca-miR-9068, eca-miR-9069, eca- miR-9070. eca-miR-9071. eca-miR-9072. eca-miR-9073. eca-miR-9074. eca-miR-9075. eca- miR-9076, eca-miR-9077, eca-miR-9078, eca-miR-9079, eca-miR-9080, eca-miR-9081, eca- miR-9082, eca-miR-9083, eca-miR-9084, eca-miR-9085, eca-miR-9086, eca-miR-9087, eca- miR-9088, eca-miR-9089, eca-miR-9090, eca-miR-9091, eca-miR-9092, eca-miR-9093, eca- miR-9094, eca-miR-9095, eca-miR-9096, eca-miR-9097, eca-miR-9098, eca-miR-9099, eca- miR-9100, eca-miR-9101, eca-miR-9102, eca-miR-9103, eca-miR-9104, eca-miR-9105, eca- miR-9106, eca-miR-9107, eca-miR-9108, eca-miR-9109, eca-miR-9110, eca-miR-9111, eca- miR-9112, eca-miR-9113, eca-miR-9114, eca-miR-9115, eca-miR-9116, eca-miR-9117, eca- miR-9118, eca-miR-9119, eca-miR-9120, eca-miR-9121, eca-miR-9122, eca-miR-9123, eca- miR-9124, eca-miR-9125, eca-miR-9126, eca-miR-9127, eca-miR-9128, eca-miR-9129, eca- miR-9130, eca-miR-9131, eca-miR-9132, eca-miR-9133, eca-miR-9134, eca-miR-9135, eca- miR-9136, eca-miR-9137, eca-miR-9138, eca-miR-9139, eca-miR-9140, eca-miR-9141, eca- miR-9142, eca-miR-9143, eca-miR-9144, eca-miR-9145, eca-miR-9146, eca-miR-9147, eca- miR-9148, eca-miR-9149, eca-miR-9150, eca-miR-9151. eca-miR-9152. eca-miR-9153. eca- miR-9154, eca-miR-9155, eca-miR-9156, eca-miR-9157, eca-miR-9158, eca-miR-9159, eca- miR-9160, eca-miR-9161, eca-miR-9162, eca-miR-9163, eca-miR-9164, eca-miR-9165, eca- miR-9166, eca-miR-9167, eca-miR-9168, eca-miR-9169, eca-miR-9170, eca-miR-9171, eca- miR-9172, eca-miR-9173, eca-miR-9174, eca-miR-9175, eca-miR-9176, eca-miR-9177, eca- miR-9178, eca-miR-9179, eca-miR-9180, eca-miR-9181, eca-miR-9182, eca-miR-9183, eca-miR-9184, eca-miR-9185, eca-miR-92a. eca-miR-92b, eca-miR-93, eca-miR-95, eca-miR-96, eca-miR-98, eca-miR-99a, eca-miR-99b, eca-miR-9a. eel-miR-11050-3p, eel-miR-11050-5p, eel-miR-11051-5p, eel-miR-11052-3p, eel-miR-11053-3p, eel-miR-11053-5p, eel-miR- 11054-3p, eel-miR-11054-5p, eel-miR-11055-3p, eel-miR-11055-5p, eel-miR-11056-3p, eel- miR-11056-5p, eel-miR-11057-3p, eel-miR-11057-5p, eel-miR-11058-5p, eel-miR-11059- 3p, eel-miR-11059-5p, eel-miR-11060-3p, eel-miR-11060-5p, eel-miR-11061 -3p, eel-miR- 11062-3p, eel-miR-1 1062-5p, eel-miR-11063-3p. eel-miR-11063-5p. eel-miR-11064-3p, eel- miR-11065-3p eel-miR-11065-5p, eel-miR-7132-3p, eel-miR-7132-5p, eel-miR-7552-2-3p, eel-miR-7552-3p, eel-miR-7552-5p, eel-miR-8160-3p, eel-miR-8160-5p, efu-let-7c, efu-let- 7d, efu-let-7e, efu-let-7f, efu-miR-1, efu-miR-10, efu-miR-101, efu-miR-103a, efu-miR- 103b, efu-miR-106, efu-miR-107, efu-miR-1185, efu-miR-1193, efu-miR-124. efu-miR- 1249, efu-miR-125a, efu-miR-125b, efu-miR-126, efu-miR-127, efu-miR-1271, efu-miR- 128a, efu-miR-128b, efu-miR-129a, efu-miR-129b, efu-miR-130, efu-miR-1307, efu-miR- 132, efu-miR-133-3p, efu-miR-133-5p, efu-miR-1343, efu-miR-135, efu-miR-136, efu-miR- 1388, efu-miR-138a, efu-miR-138b, efu-miR-139, efu-miR-140, efu-miR-141, efu-miR-142, efu-miR-143, efu-miR-145, efu-miR-146. efu-miR-148. efu-miR-149, efu-miR-15. efu-miR- 150, efu-miR-151, efu-miR-152, efu-miR-153, efu-miR-154, efu-miR-155, efu-miR-16, efu- miR-17, efu-miR-18, efu-miR-181a, efu-miR-181b, efu-miR-181c, efu-miR-181d, efu-miR- 181e, efu-miR-181f, efu-miR-182. efu-miR-1842, efu-miR-185, efu-miR-188, efu-miR-19, efu-miR-191, efu-miR-192, efu-miR-193a, efu-miR-193b, efu-miR-194, efu-miR-196. efu- miR-199, efu-miR-20, efu-miR-200a, efu-miR-200b, efu-miR-200c, efu-miR-202, efu-miR- 204, efu-miR-205, efu-miR-206, efu-miR-21, efu-miR-210, efu-miR-211, efu-miR-214, efu- miR-215, efu-miR-218a, efu-miR-218b, efu-miR-219, efu-miR-22, efu-miR-221, efu-miR- 222, efu-miR-223, efu-miR-23a. efu...

Claims

Claims1. A polynucleotide comprising: a) a nucleotide sequence encoding a ribosomal frameshift stimulator; b) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of said one or more MSE sequences is targeted by a miRNA, and wherein each of said one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting said MSE sequence; c) a first ribosomal frameshift element; d) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, and wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator; and e) optionally one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting mRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator.

2. The polynucleotide of claim 1, wherein the one or more MSE sequences are positioned in the open reading frame (ORF) or in the 3 ’ untranslated region (3 ’ UTR) of the ribosomal frameshift stimulator transcript coding sequence.

3. The polynucleotide of claim 1 or claim 2, wherein the polynucleotide further comprises a first promoter, and w herein expression of the ribosomal frameshift stimulator is under the control of the first promoter.

4. The polynucleotide of claim 3, w herein expression of the first pay load polypeptide is under the control of the first promoter.

5. The polynucleotide of claim 4, wherein the polynucleotide is structured as an alternatively spliced construct, and wherein one transcript comprises the nucleotide sequence encoding the ribosomal frameshift stimulator and one or more MSE sequences, and another transcript comprises the first ribosomal frameshift element and the nucleotide sequence encoding the first payload polypeptide.

6. The polynucleotide of claim 5, wherein the polynucleotide further comprises a 5’ donor splice site and a 3 ' acceptor splice site.

7. The polynucleotide of claim 6, wherein the 5’ donor splice site comprises the sequence AG*GU(A / G)AGU or AG*GU(A / G)GAU, wherein * denotes the splice junction.

8. The polynucleotide of claim 6 or claim 7, wherein the 3’ acceptor splice site comprises a branch point, a pyrimidine tract, and the sequence AG*G, wherein * denotes the splice junction.

9. The polynucleotide of any one of claims 4-8, wherein the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein expression of the first payload polypeptide and the one or more additional payload polypeptides is under the control of the first promoter.

10. The polynucleotide of any one of claims 4-8, wherein the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein expression of the first pay load polypeptide is under the control of the first promoter, and expression of each of the additional payload polypeptides is under the control of respective additional promoters.

11. The polynucleotide of claim 3, wherein the polynucleotide further comprises a second promoter, wherein expression of the first payload polypeptide is under the control of the second promoter.

12. The polynucleotide of claim 11, wherein the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein expression of each of the additional payload polypeptides is under the control of respective additional promoters.

13. The polynucleotide of claim 11, wherein the polynucleotide further comprises one or more DNA insulator elements, wherein said one or more DNA insulator elements are positioned between the 3’UTR of the ribosomal frameshift stimulator transcript coding sequence and the second promoter, and wherein said DNA one or more DNA insulator elements enhance efficiency of termination of transcription of the ribosomal frameshift stimulator.

14. The polynucleotide of claim 12, wherein the polynucleotide further comprises one or more DNA insulator elements, wherein said DNA insulator elements are positioned between the 3’UTR of each subsequent transcript and each subsequent promoter, and wherein said DNA insulator elements enhance efficiency of termination of transcription.

15. The polynucleotide of claim 13 or claim 14, wherein said DNA insulator element comprises CCCTC-binding factor site(s).

16. The polynucleotide of any one of claims 1-15, wherein the nucleotide sequence encoding the first payload polypeptide is positioned in frame with the first ribosomal frameshift element.

17. The polynucleotide of any one of claims 1-15, wherein the nucleotide sequence encoding the first payload polypeptide is positioned in -1 translation frame in relation to the first ribosomal frameshift element.

18. The polynucleotide of claim 16 or claim 17, wherein the polynucleotide comprises one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, and wherein the nucleotide sequence encoding each additional payload polypeptide is independently positioned in frame or in -1 translation frame in relation to its closest 5’ ribosomal frameshift element in the resulting mRNA.

9. A polynucleotide comprising from 5’ to 3‘: a) a first promoter; b) a 5’ donor splice site; c) a nucleotide sequence encoding a ribosomal frameshift stimulator; d) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of said one or more MSE sequences is targeted by a miRNA, and wherein each of said one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting said MSE sequence; e) a 3’ splice acceptor site;1) a first ribosomal frameshift element; and g) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the first payload polypeptide is positioned in frame or in -1 translation frame in relation to the first ribosomal frameshift element.

20. The polynucleotide of claim 19, wherein the polynucleotide further comprises 3’ to the nucleotide sequence encoding the first payload polypeptide from 5' to 3': h) a second promoter; i) a second ribosomal frameshift element, and j) a nucleotide sequence encoding a second payload polypeptide, wherein the second ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the second payload polypeptide, wherein translation of the second payload polypeptide is controlled by the second ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, andwherein the nucleotide sequence encoding the second payload polypeptide is positioned in frame or in -1 translation frame in relation to the second ribosomal frameshift element.

21. The polynucleotide of claim 20, wherein the polynucleotide further comprises a DNA insulator element, wherein said DNA insulator element is positioned between the nucleotide sequence encoding the first payload polypeptide and the second promoter, and wherein said DNA insulator element enhances efficiency of termination of transcription.

22. The polynucleotide of any one of claims 19-21, wherein the 5’ donor splice site comprises the sequence AG*GU(A / G)AGU or AG*GU(A / G)GAU, wherein * denotes the splice junction.

23. The polynucleotide of any one of claims 19-22, wherein the 3‘ acceptor splice site comprises a branch point, a pyrimidine tract, and the sequence AG*G, wherein * denotes the splice junction.

24. A polynucleotide comprising from 5’ to 3’: a) a first promoter; b) a nucleotide sequence encoding a ribosomal frameshift stimulator; c) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of said one or more MSE sequences is targeted by a miRNA, and wherein each of said one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting said MSE sequence, d) a second promoter; e) a first ribosomal frameshift element, and f) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide.wherein translation of the first pay load polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the first payload polypeptide is positioned in frame or in -1 translation frame in relation to the first ribosomal frameshift element.

25. The polynucleotide of claim 24, wherein the polynucleotide further comprises a DNA insulator element, wherein said DNA insulator element is positioned between the 3’UTR of the ribosomal frameshift stimulator transcript coding sequence and the second promoter, and wherein said DNA insulator element enhances efficiency of termination of transcription.

26. The polynucleotide of claim 24 or claim 25, wherein the polynucleotide further comprises 3’ to the nucleotide sequence encoding the first payload polypeptide from 5 ’ to 3 ’ : g) a third promoter; h) a second ribosomal frameshift element, and i) a nucleotide sequence encoding a second payload polypeptide, wherein the second ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the second payload polypeptide, wherein translation of the second payload polypeptide is controlled by the second ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the second payload polypeptide is positioned in frame or in -1 translation frame in relation to the second ribosomal frameshift element.

27. The polynucleotide of claim 26, wherein the polynucleotide further comprises a DNA insulator element, wherein said DNA insulator element is positioned between the nucleotide sequence encoding the first payload polypeptide and the third promoter, and wherein said DNA insulator element enhances efficiency of termination of transcription.

28. The polynucleotide of any one of claims 3-27, wherein the first promotor is an RNA polymerase II promoter.

29. The polynucleotide of claim 28, wherein the first promoter is a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

30. The polynucleotide of any one of claims 11-15 and 20-27, wherein the second promoter is an RNA polymerase II promoter.

31. The polynucleotide of claim 30, wherein the second promoter is a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

32. The polynucleotide of claim 26 or claim 27, wherein the third promoter is an RNA polymerase 11 promoter.

33. The polynucleotide of claim 32, wherein the third promoter is a cytomegalovirus (CMV) promoter, a simian virus 40 (SV40) promoter, a human elongation factor 1 alpha (EFla) promoter, or a phosphoglycerate kinase (PGK) promoter.

34. The polynucleotide of claim 4, wherein the first promoter is a bi-directional promoter which drives expression of the ribosomal frameshift stimulator in one direction and the first payload polypeptide in the opposite direction.

35. A polynucleotide comprising from 5’ to 3’: a) one or more microRNA (miRNA) Silencing Element (MSE) sequences, wherein each of said one or more MSE sequences is targeted by a miRNA, b) a nucleotide sequence encoding a ribosomal frameshift stimulator, wherein each of said one or more MSE sequences is positioned with respect to the nucleotide sequence encoding the ribosomal frameshift stimulator to allow expression of the ribosomal frameshift stimulator in the absence of the respective miRNA targeting said MSE sequence; c) a bi-directional promoter;d) a first ribosomal frameshift element; e) a nucleotide sequence encoding a first payload polypeptide, wherein the first ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the first payload polypeptide, wherein translation of the first payload polypeptide is controlled by the first ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the bidirectional promoter drives expression of the ribosomal frameshift stimulator in one direction and the first payload polypeptide in the opposite direction; and f) optionally one or more additional combinations of a ribosomal frameshift element and a nucleotide sequence encoding a payload polypeptide, wherein within each combination, the ribosomal frameshift element is positioned 5?to the nucleotide sequence encoding the payload polypeptide, wherein translation of each additional payload polypeptide is controlled by its closest 5’ ribosomal frameshift element in the resulting mRNA and independently requires either the presence or absence of the ribosomal frameshift stimulator,36. The polypeptide of claim 34 or claim 35, wherein bi-directional promoter is selected from human promoter for 3-phosphoglycerate kinase (hPGK) promoter, a minimal Cytomegalovirus (CMV) promoter, TRE3G promoter, Ponasterone A, and combinations thereof.

37. The polynucleotide of any one of claims 1-36, wherein the ribosomal frameshift stimulator is a cardiovirus 2A protein.

38. The polynucleotide of claim 37, wherein the cardiovirus 2A protein comprises the amino acid sequenceMSPNALDISRTYPTLHVLIQFNHRGLEVRLFRHGHFWAETRADVILRSKTK QVSFLSNGNYPSMDSRAPWNPWKNTYQAVLRAEPCRVTMDIYYKRVRPF RLPLVQKEWPVREENVFGLYRIFNAHYAGYFADLLIHDIETNPG (SEQ ID NO: 1), or a variant thereof.

39. The polynucleotide of claim 38, wherein the cardiovirus 2A protein consists of the amino acid sequenceMSPNALDISRTYPTLHVLIQFNHRGLEVRLFRHGHFWAETRADVILRSKTKQVSFLSNGNYPSMDSRAPWNPWKNTYQAVLRAEPCRVTMDIYYKRVRPFRLPLVQKEWPVREENVFGLYRIFNAHYAGYFADLLIHDIETNPG (SEQ ID NO: 1), or a variant thereof.

40. The polynucleotide of claim 37, wherein the nucleotide sequence encoding the cardiovirus 2A protein comprises the sequenceATGAGTCCAAATGCCCTAGACATTTCAAGAACATACCCCACGTTACATGTTCTCATTCAATTCAACCATAGAGGTTTGGAGGTTAGATTGTTTAGACATGGACACTTTTGGGCTGAAACACGTGCGGACGTGATTCTGAGATCAAAGACCAAACAGGTCTCTTTCCTGAGCAACGGGAACTACCCGTCAATGGACTCTAGAGCTCCCTGGAATCCTTGGAAGAATACCTACCAGGCGGTTCTAAGAGCAGAACCATGTAGAGTGACCATGGATATATATTATAAGAGAGTCAGGCCTTTTAGACTGCCCCTGGTTCAGAAGGAATGGCCCGTGCGAGAGGAGAACGTTTTCGGTTTGTACCGGATCTTCAATGCCCACTACGCTGGTTACTTTGCGGACCTACTGATTCATGACATTGAGACAAATCCAGGG TAG (SEQ ID NO: 2), or a variant thereof.

41. The polynucleotide of claim 40, wherein the nucleotide sequence encoding the cardiovirus 2A protein consists of the sequenceATGAGTCCAAATGCCCTAGACATTTCAAGAACATACCCCACGTTACATGTTCTCATTCAATTCAACCATAGAGGTTTGGAGGTTAGATTGTTTAGACATGGACACTTTTGGGCTGAAACACGTGCGGACGTGATTCTGAGATCAAAGACCAAACAGGTCTCTTTCCTGAGCAACGGGAACTACCCGTCAATGGACTCTAGAGCTCCCTGGAATCCTTGGAAGAATACCTACCAGGCGGTTCTAAGAGCAGAACCATGTAGAGTGACCATGGATATATATTATAAGAGAGTCAGGCCTTTTAGACTGCCCCTGGTTCAGAAGGAATGGCCCGTGCGAGAGGAGAACGTTTTCGGTTTGTACCGGATCTTCAATGCCCACTACGCTGGTTACTTTGCGGACCTACTGATTCATGACATTGAGACAAATCCAGGG TAG (SEQ ID NO: 2), or a variant thereof.

42. The polynucleotide of any one of claims 1-41, wherein the first ribosomal frameshift element comprises from 5' to 3':1) a 5 ’ shift site,2) a spacer sequence, and3) a stem-loop structure.

43. The polynucleotide of any one of claims 20-23, 26 and 27, wherein the second ribosomal frameshift element comprises from 5’ to 3’:1) a 5 ’ shift site,2) a spacer sequence, and3) a stem-loop structure.

44. The polynucleotide of claim 42 or claim 43, wherein the 5’ shift site comprises the sequence 5 -GGUUUUU-3’.

45. The polynucleotide of claim 44, wherein the 5’ shift site consists of the sequence 5 -GGUUUUU-3’.

46. The polynucleotide of any one of claims 42-45, wherein the spacer sequence is 13 orl4 nucleotides long.

47. The polynucleotide of claim 46, wherein the spacer sequence comprises the sequence CAGACUCAAGGAG (SEQ ID NO: 4).

48. The polynucleotide of claim 47, wherein the spacer sequence consists of the sequence CAGACUCAAGGAG (SEQ ID NO: 4).

49. The polynucleotide of any one of claims 42-48, wherein the stem-loop structure comprises a stem of 7 nucleotides.

50. The polynucleotide of claim 49, wherein the stem-loop structure comprises the sequence 5'-CGGCAGU-3’ followed by a 21 nucleotide loop and the complementary sequence 5 ACUGCCG-37.

51. The polynucleotide of any one of claims 42-50, wherein the loop of the stem-loop structure comprises an adenosine triplet followed by a cytosine triplet.

52. The polynucleotide of claim 50 or claim 51, wherein the loop structure comprises the sequence GUCAUCAAUGGCUCAAACCCU (SEQ ID NO: 7).

53. The polynucleotide of claim 52, wherein the loop structure consists of the sequence GUCAUCAAUGGCUCAAACCCU (SEQ ID NO: 7).

54. The polynucleotide of any one of claims 1-53. wherein the first ribosomal frameshift element comprises the sequence GGUUUUUCAGACUCAAGGAGCGGCAGUGUCAUCAAUGGCUCAAACC CUACUGCCG (SEQ ID NO: 8), or a sequence having at least 60% identity thereto.

55. The polynucleotide of any one of claims 20-23, 26, 27, and 43-54 wherein the second ribosomal frameshift element comprises the sequence GGUUUUUCAGACUCAAGGAGCGGCAGUGUCAUCAAUGGCUCAAACC CUACUGCCG (SEQ ID NO: 8), or a sequence having at least 60% identity thereto.

56. The polynucleotide of any one of claims 1-55, wherein the first ribosomal frameshift element causes a -1 frameshift in the presence of the ribosomal frameshift stimulator.

57. The polynucleotide of any one of claims 20-23, 26, 27, and 43-56, wherein the second ribosomal frameshift element causes a -1 frameshift in the presence of the ribosomal frameshift stimulator.

58. The polynucleotide of any one of claims 1-57, wherein the polynucleotide further comprises one or more additional combinations of an additional ribosomal frameshift element and a nucleotide sequence encoding an additional payload polypeptide, wherein the additional ribosomal frameshift element is positioned 5’ to the nucleotide sequence encoding the additional payload polypeptide, wherein translation of the additional payload polypeptide is controlled by the additional ribosomal frameshift element and requires either the presence or absence of the ribosomal frameshift stimulator, and wherein the nucleotide sequence encoding the additional payload polypeptide is positioned in frame or in -1 translation frame in relation to the additional ribosomal frameshift element.

59. The polynucleotide of any one of claims 1-58, wherein the polynucleotide comprises two MSE sequences.

60. The polynucleotide of any one of claims 1-59. wherein when two or more MSE sequences are present, at least two of these MSE sequences are targeted by the same miRNA.61 . The polynucleotide of any one of claims 1 -59, wherein when two or more MSE sequences are present, at least tw o of these MSE sequences are targeted by different miRNAs.

62. The polynucleotide of any one of claims 1-61, w herein the one or more MSE sequences are targeted by miRNA(s) which is characterized by tissue-specific, cell type-specific, cell-state-specific or species-specific expression.

63. The polynucleotide of claim 62, wherein the one or more MSE sequences is targeted by miR-1, miR-155, miR-124, miR-182, miR-96, miR-183, miR-21, miR-16, miR-17, miR-19, miR-25, miR-34, miR-92, miR-93, miR-142, miR-222, miR-149, miR-375, miR-503, or miR-181b-2.

64. The polynucleotide of any one of claims 1-63, wherein the first payload polypeptide is a gene editing nuclease, a chimeric antigen receptor (CAR), an antibody, a cytotoxic protein, a cell surface receptor, a transcription factor, an enzyme, a reporter protein, a cytokine, or a polypeptide that confers drug resistance.

65. The polynucleotide of any one of claims 20-23, 26 and 27, wherein the second payload polypeptide is a gene editing nuclease, a chimeric antigen receptor (CAR), an antibody, a cytotoxic protein, a cell surface receptor, a transcription factor, an enzyme, a reporter protein, a cytokine, or a polypeptide that confers drug resistance.

66. The polynucleotide of claim 64 or claim 65, wherein the gene editing nuclease is a Cas protein, ZFN nuclease, or TALEN.

67. The polynucleotide of claim 66, wherein the Cas protein is Cas9.

68. A vector comprising the polynucleotide of any one of claims 1-67.

69. The vector of claim 68, wherein the vector is a viral vector.

70. The vector of claim 69. wherein the viral vector is a retroviral vector, an adenovirus vector, a parvovirus vector, an influenza virus vector, a herpes virus vector, a poxvirus vector, a rhabdovirus vector, a paramyxovirus vector, a morbillivirus vector, or a reovirus vector.

71. The vector of claim 70, wherein the retroviral vector is a lentiviral vector.

72. The vector of claim 70. wherein the parvoviral vector is an adeno-associated virus (AAV) vector.

73. The vector of claim 70, wherein the paramyxovirus vector is a Sendai virus (SeV) vector.

74. A composition comprising the polynucleotide of any one of claims 1-67 or the vector of any one of claims 68-73 and a carrier or excipient.

75. The composition of claim 74, wherein the composition is a pharmaceutical composition comprising the polynucleotide or the vector and a pharmaceutically acceptable carrier or excipient.

76. A host cell comprising the polynucleotide of any one of claim 1-67, or the vector of any of claims 68-73.

77. A method of selectively expressing a payload polypeptide in a target cell type or tissue or a cell in a specific state within a multicellular organism, comprising introducing to the multicellular organism an effective amount of the polynucleotide of any one of claims 1-67, or the vector of any one of claims 68- 73, or the composition of claim 74 or 75.

78. The method of claim 77, wherein the multicellular organism is an animal, a plant, or a fungus.

79. The method of claim 77, wherein the animal is a human, veterinary animal, or experimental animal.

Images