Aptamer and ribozyme equilibrium shifting (ARES) RNA circuits and uses thereof

ARES RNA circuits with RNA-binding proteins and ribozymes offer precise control over mRNA stability, addressing the limitations of current mRNA therapies by enhancing spatial and temporal control and reducing side effects.

WO2025207923A1PCT designated stage Publication Date: 2025-10-02TRUSTEES OF BOSTON UNIV
View PDF 1 Cites 0 Cited by

Patent Information

Application Number
PCT/US2025/021811
Authority / Receiving Office
WO · WO
Patent Type
Applications
Current Assignee / Owner
Priority Date
2024-03-27
Filing Date
2025-03-27
Publication Date
2025-10-02

AI Technical Summary

Technical Problem

Current mRNA therapies lack precise spatial and temporal control over mRNA stability, leading to potential side effects and inefficiencies.

Method used

The integration of RNA-binding proteins (RBPs) with self-cleaving ribozymes into aptamer and ribozyme equilibrium shifting (ARES) RNA circuits, allowing for precise control of mRNA stability through stabilizing or destabilizing switches triggered by RBPs.

Benefits of technology

This approach provides enhanced spatial and temporal control over mRNA therapeutics, reducing side effects and improving therapeutic efficacy.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure US2025021811_02102025_PF_FP_ABST
    Figure US2025021811_02102025_PF_FP_ABST
Patent Text Reader

Abstract

The technology described herein is directed to Aptamer and Ribozyme Equilibrium Shifting (ARES) regions, including ON-switches and OFF-switches, which can be harnessed to regulate the stability of RNA molecules. Also described herein are compositions comprising such RNA molecules and methods of using them to regulate translation of cargo polypeptides.
Need to check novelty before this filing date? Find Prior Art

Description

APTAMER AND RIBOZYME EQUILIBRIUM SHIFTING (ARES) RNA CIRCUITS ANDUSES THEREOFCROSS-REFERENCE TO RELATED APPLICATIONS

[0001] This application claims benefit under 35 U.S.C. § 119(e) of U.S. Provisional Application No. 63 / 570,609 filed March 27, 2024, the contents of which are incorporated herein by reference in their entirety.TECHNICAL FIELD

[0002] The technology described herein relates to aptamer and ribozyme equilibrium shifting (ARES) RNA circuits and uses thereof.BACKGROUND

[0003] mRNA has gained significant attention for its vast potential in disease prevention and treatment. For example, the development of mRNA COVID vaccines has been a pivotal breakthrough, saving countless lives and highlighting one of mRNA's practical applications. Beyond vaccines, ongoing research explores many other mRNA applications, from protein replacement therapies to disease treatments. The appeal of mRNA lies in its numerous advantages, including rapid development, efficacy, potent immune response, safety profile, and versatility. However, while mRNA holds promise for disease treatments, these applications often present greater challenges than vaccines, as they may cause more pronounced side effects, including systemic reactions and immune responses. Enhanced precision in treatment localization and temporal regulation of mRNA therapies could mitigate many of these potential side effects, underscoring the need for advanced delivery systems and regulatory mechanisms.

[0004] In mRNA therapies, controlling the lifespan of mRNA is crucial for optimizing therapeutic outcomes and ensuring safety. Currently, mRNA stability is regulated through modifications such as the addition of cap structures and polyadenylation, which help protect mRNA from degradation and prolong its lifespan within cells. However, these mechanisms provide limited control over mRNA stability, necessitating the development of more precise regulatory strategies. There is thus great need for improved strategies to control the stability of mRNA therapies.SUMMARY

[0005] In the past decade, mRNA devices and therapeutics have rapidly expanded as promising tools in the fight against various diseases. Despite their potential, these technologies are hindered by a significant limitation: the lack of precise spatial and temporal control. Described herein are compositions, methods and systems with the ability to control target gene expression spatially andtemporally by merging RNA-binding proteins (RBPs) with self-cleaving ribozymes (e.g., hammerhead ribozyme, HHR) into an aptamer and ribozyme equilibrium shifting (ARES) RNA circuit, which can then be inserted into the UTR(s) of a gene to control mRNA stability. Depending on the placement of the aptamer and HHR a stabilizing or destabilizing switch can be developed with the RBP as the trigger. The ARES circuit allows for higher levels of cell-specific delivery and temporal control with the ARES stabilization and destabilizing switches. For the stabilizing switch, translation of a gene of interest (GOI) occurs only in the presence of the corresponding RBP; mRNA will be degraded in its absence. The destabilizing switch permits the translation of a GOI until a specific RBP is present, which then destabilizes and leads to the degradation of the mRNA. Boolean logic in the form of an AND, OR and more gates can also be demonstrated with ARES switches for further control of mRNA stability. This approach offers more precise spatial and temporal control over RNA therapeutics, as the selected RBP can either be a biomarker protein or an additional drug. This advancement results in enhanced efficacy and reduced side effects. Furthermore, the versatility of the RNA switches described herein permit their broad application across various healthcare scenarios.

[0006] RNA delivery vehicles such as lipid nanoparticles (LNPs) exist to deliver mRNA drugs in a cell-specific manner; however, they cannot target all cell types and can be cytotoxic. In contrast, the ARES switch described herein can target any cell type via biomarker proteins and is not inherently toxic. See e.g., Rohner et al. “Unlocking the promise of mRNA therapeutics.” Nat Biotechnol. 40(11): 1586-1600 (2022).

[0007] eToeholds also attempt to deliver cell specificity through RNA triggers. RNA triggers are less ideal than proteins (as used in the systems described herein) for targeted mRNA drug delivery because proteins permit more precise and specific recognition of target cells or tissues, reducing the risk of off-target effects and improving therapeutic efficacy. eToehold also suffers from high leakage and difficulty expressing in high percentages of cells. See e.g., Zhao et al. “RNA-responsive elements for eukaryotic translational control.” Nat Biotechnol. 40(4): 539-545 (2022).

[0008] Methods to extend mRNA lifespan have been developed including cap modifications, self-amplifying mRNA, and circularized RNA. These give some level of temporal control; however, they fail to provide adaptable control. See e.g., Wang et al. “mRNA-based vaccines and therapeutics: an in-depth survey of current and upcoming clinical applications.” J Biomed Sci. 30(1): 84 (2023) (see e.g., Fig. 2 of Wang et al.).

[0009] Others have attempted to use Hammerhead ribozymes and aptamers to control when translation is ON or OFF. However, these systems were detecting a limited number of small molecules (e.g., tetracycline, guanine) not proteins; see e.g., Strobel et al. Nat. Commun. 11, 714 (2020).

[0010] The technology described herein is directed to ON-switch and OFF-switch aptamer ribozyme equilibrium shifting (ARES) domains that can control the stability of associated RNA molecules. One element of the ARES regions described herein include that they can sense any protein or peptide, including biomarkers. The ARES regions also allow for adaptable control where the RNA can be turned OFF or ON at any time and for any extended period of time.

[0011] Accordingly, in one aspect, described herein is an RNA molecule comprising: a) an open reading frame (ORF) encoding at least one cargo polypeptide; and b) at least one untranslated region (UTR) comprising at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region, which comprises: i) a protein-binding aptamer that specifically binds to a target protein; and ii) a ribozyme.

[0012] In some embodiments of any of the aspects, the aptamer is selected from the group consisting of: a MS2 aptamer, a PP7 aptamer, a bovine immunodeficiency virus (BIV) transactivation response (Tar) aptamer, and a P22 aptamer.

[0013] In some embodiments of any of the aspects, the target protein is selected from: a) MS2 coat protein (MCP), which specifically binds to the MS2 aptamer; b) PP7 coat protein (PCP), which specifically binds to the PP7 aptamer; c) BIV trans-activator of transcription (Tat), which specifically binds to the BIV Tar aptamer; d) a P22 N protein, which specifically binds to the P22 aptamer.

[0014] In some embodiments of any of the aspects, the ribozyme is a self-cleaving ribozyme.

[0015] In some embodiments of any of the aspects, the self-cleaving ribozyme is selected from the group consisting of: hammerhead ribozyme (HHR), hepatitis delta virus (HDV) ribozyme, hairpin ribozyme, Varkud satellite (VS) ribozyme, glmS ribozyme, twister ribozyme, twister sister ribozyme, Pistol ribozyme, Hatchet ribozyme, and Hovlinc ribozyme.

[0016] In some embodiments of any of the aspects, the aptamer is 5' of the ribozyme in the ARES region.

[0017] In some embodiments of any of the aspects, the aptamer is 3' of the ribozyme in the ARES region.

[0018] In some embodiments of any of the aspects, the at least one ARES region is located in the UTR 5' of the ORF (5' UTR).

[0019] In some embodiments of any of the aspects, the at least one ARES region is located in the UTR 3' of the ORF (3' UTR).

[0020] In some embodiments of any of the aspects, at least one ARES region is located in 5' UTR, and at least one ARES region is located the 3' UTR.

[0021] In some embodiments of any of the aspects, the at least one ARES region modulates the stability of the RNA molecule and / or modulates translation of the at least one cargo polypeptide encoded by the ORF.

[0022] In some embodiments of any of the aspects, the at least one ARES region is an ON- switch ARES region structured such that either the aptamer or the ribozyme, but not both, can form at one time in the RNA molecule.

[0023] In some embodiments of any of the aspects, in an RNA molecule comprising an ON- switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, and the ORF can be translated (ON); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF).

[0024] In some embodiments of any of the aspects, the ON-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a complementary (b*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region in the ribozyme; and b) the ribozyme comprising: i) the secondary second (b2) region and the complementary (b*) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region.

[0025] In some embodiments of any of the aspects, the ON-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the complementary (b*) region that can hybridize to the primary second (bl) region in the aptamer or to a secondary second (b2) region in the ribozyme; e) the third (c) region; f) the complementary (c*) region that can hybridize to the third (c) region; and g) the secondary second (b2) region.

[0026] In some embodiments of any of the aspects, the ON-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (c) region; d) the complementary (b*) region that can hybridize to the secondary second (b2) region in the ribozyme or to a primary second (bl) region in the aptamer; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; and g) the primary second (bl) region.

[0027] In some embodiments of any of the aspects, the RNA molecule further comprises at least one stabilization domain.

[0028] In some embodiments of any of the aspects, the RNA molecule further comprises at least one degradation domain.

[0029] In some embodiments of any of the aspects, the at least one ARES region is a stabilization / degradation ARES region, which comprises in the 3' UTR, from 5' to 3': a) a stabilization domain; b) an ON-switch ARES region as described herein; and c) a degradation domain.

[0030] In some embodiments of any of the aspects, in an RNA molecule comprising a stabilization / degradation ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, the degradation domain isretained, the RNA molecule is degraded, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, the degradation domain is not retained, the stabilization domain protects the RNA molecule from degradation, and the ORF can be translated (ON).

[0031] In some embodiments of any of the aspects, the at least one ARES region is an OFF- switch ARES region structured such that either both the aptamer and the ribozyme, or at least one stabilization stem, can form at one time in the RNA molecule.

[0032] In some embodiments of any of the aspects, in an RNA molecule comprising an OFF- switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme can form, the at least one stabilization stem cannot form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme cannot form, the at least one stabilization stem can form, the RNA molecule is not cleaved, and the ORF can be translated (ON).

[0033] In some embodiments of any of the aspects, the OFF-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; and c) the at least one stabilization stem comprising: i) a fourth (d) region and a complementary (d*) region that can hybridize to the fourth (d) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer.

[0034] In some embodiments of any of the aspects, the OFF-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the secondary second (b2) region; h) the third (c) region; i) the complementary (c*) region that can hybridize to the third (c) region; and j) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0035] In some embodiments of any of the aspects, the OFF-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (a) region; d) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region or to a primary second (bl) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the primarysecond (bl) region; h) the first (a) region; i) the complementary (a*) region that can hybridize to the first (a) region; and j) the primary complementary (bl*) region that can hybridize to the primary second (bl) region.

[0036] In some embodiments of any of the aspects, the OFF-switch ARES region comprises 2 stabilization stems.

[0037] In some embodiments of any of the aspects, the OFF-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the aptamer and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region.

[0038] In some embodiments of any of the aspects, the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; 1) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0039] In some embodiments of any of the aspects, the OFF-switch ARES region comprises: a) the ribozyme comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the aptamer comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth(dl) region; and ii) the secondary second (b2) region of the aptamer and the primary complementary (bl*) region of the ribozyme; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the ribozyme and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region.

[0040] In some embodiments of any of the aspects, the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; 1) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0041] In some embodiments of any of the aspects, the at least cargo polypeptide is selected from: a) a detectable marker (e.g., a fluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anti-claudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti-cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti-glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL-12, OX40L, IL-23); d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a site-specific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like); h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon-like peptide-1, insulin); or i) an oncogene (e.g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF).

[0042] In some embodiments of any of the aspects, the RNA molecule is a messenger RNA (mRNA), further comprising a 5' cap and a 3' polyA tail.

[0043] In one aspect, described herein is a self-amplifying RNA (saRNA) comprising an RNA as described herein, which further comprises a second open reading frame encoding an RNA-dependent RNA polymerase.

[0044] In one aspect, described herein is a self-amplifying RNA (saRNA) comprising from 5' to 3': a) a 5' conserved sequence element (CSE); b) a first open reading frame (ORF) encoding an RNA- dependent RNA polymerase (RdRP), operably linked to a promoter in the 5' CSE; c) a subgenomic promoter (SGP); d) a second ORF encoding at least one cargo polypeptide, operably linked to the SGP; and e) a 3' CSE; and wherein the 5' CSE, a region between the first and second ORFs, and / or the 3' CSE further comprises at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region in a sense or anti-sense orientation, wherein the ARES region comprises: i) a protein-aptamer that specifically binds to a target protein; and ii) a ribozyme.

[0045] In some embodiments of any of the aspects, when the ARES region is in the sense orientation, the ARES region is functional in the saRNA.

[0046] In some embodiments of any of the aspects, when the ARES region is in the anti-sense orientation, the ARES region is functional when the saRNA is delivered to a cell, the RdRP is translated from the saRNA, and the RdRP synthesizes a reverse complementary negative strand of the saRNA.

[0047] In one aspect, described herein is a polynucleotide comprising an RNA molecule as described herein or an saRNA as described herein.

[0048] In one aspect, described herein is a vector comprising a polynucleotide as described herein.

[0049] In one aspect, described herein is a combination comprising: a) an RNA molecule as described herein or an saRNA as described herein; and b) a target protein as described herein.

[0050] In some embodiments of any of the aspects, the target protein is linked to a polypeptide of interest.

[0051] In one aspect, described herein is a cell comprising an RNA molecule as described herein, an saRNA as described herein, a polynucleotide as described herein, a vector as described herein, and / or a combination as described herein.

[0052] In one aspect, described herein is a pharmaceutical composition comprising an RNA molecule as described herein, an saRNA as described herein, a polynucleotide as described herein, a vector as described herein, a combination as described herein, or a cell as described herein.

[0053] In one aspect, described herein is a method of modulating the translation of at least one cargo polypeptide, the method comprising contacting a cell with an RNA molecule as described herein, an saRNA as described herein, a polynucleotide as described herein, a vector as described herein, a combination as described herein, or a pharmaceutical composition as described herein.

[0054] In some embodiments of any of the aspects, the method further comprises contacting the cell with the target protein.

[0055] In some embodiments of any of the aspects, the cell expresses the target protein.

[0056] In one aspect, described herein is a method of modulating the translation of at least one cargo polypeptide in a subject in need thereof, the method comprising administering to the subject an effective amount of an RNA molecule as described herein, an saRNA as described herein, a polynucleotide as described herein, a vector as described herein, a combination as described herein, a cell as described herein, or a pharmaceutical composition as described herein.

[0057] In some embodiments of any of the aspects, the method further comprises administering to the subject an effective amount of the target protein.

[0058] In some embodiments of any of the aspects, a target cell in the subject expresses the target protein.

[0059] In some embodiments of any of the aspects, the RNA molecule comprises an ON-switch ARES region as described herein.

[0060] In some embodiments of any of the aspects, in an RNA molecule comprising an ON- switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is translated (ON); and / or b) in the absence of the target protein, the at least one cargo polypeptide is not translated (OFF).

[0061] In some embodiments of any of the aspects, the RNA molecule comprises a stabilization / degradation ARES region as described herein.

[0062] In some embodiments of any of the aspects, the RNA molecule comprises an OFF-switch ARES region as described herein.

[0063] In some embodiments of any of the aspects, in an RNA molecule comprising a stabilization / degradation ARES region or an OFF-switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is not translated (OFF); and / or b) in the absence of the target protein, the at least one cargo polypeptide is translated (ON).BRIEF DESCRIPTION OF THE DRAWINGS

[0064] FIG. 1A-1H are a series of schematics showing exemplary ARES regions. FIG. 1A shows an exemplary ON-switch ARES region where the aptamer is 5' of the ribozyme. FIG. IB shows an exemplary ON-switch ARES region where the ribozyme is 5' of the aptamer. FIG. 1C shows an exemplary stabilization / degradation ARES region where the aptamer is 5' of the ribozyme. FIG. ID shows an exemplary stabilization / degradation ARES region where the ribozyme is 5' of the aptamer. FIG. IE shows an exemplary OFF-switch ARES region with a single stabilization stem where the aptamer is 5' of the ribozyme. FIG. IF shows an exemplary OFF-switch ARES region with a single stabilization stem where the ribozyme is 5' of the aptamer. FIG. 1G shows an exemplary OFF-switch ARES region with two stabilization stems where the aptamer is 5' of the ribozyme. FIG. 1H shows an exemplary OFF-switch ARES region with two stabilization stems where the ribozyme is 5' of the aptamer.

[0065] FIG. 2 is a schematic of a hammerhead ribozyme (HHR) in the 3’ UTR of an mRNA. The HHR self-cleaves leaving the 3’ UTR exposed to degradation and leads to an end in translation.

[0066] FIG. 3 is a schematic representing an exemplary ARES ON switch. Both an aptamer and HHR structure can form from the RNA sequence but only one structure is fully formed at a time due to the shared “b” domain. Domains “a” and “c” make the aptamer and HHR structure more or less thermodynamically favored to form. When a RBP corresponding to the aptamer structure is present it binds the aptamer, stabilizing the mRNA. When the RBP is not present, the HHR forms and selfcleaves, leaving the mRNA open to degradation, stopping further translation.

[0067] FIG. 4 shows models of an ARES ON switch with varying “a”, “b”, and “c” domain lengths. The upper left image shows the aptamer formed, upper right and lower left are intermediate structures and the bottom right shows the HHR formed. Each nucleotide position shows its thermodynamic likelihood based on the equilibrium probability scale.

[0068] FIG. 5A-5D: Resulting output of 46 ARES ON switches with BIV Tat aptamer and peptide. FIG. 5A. The ON / OFF ratio of each ARES ON switch tested with the BIV Tat trigger RBP. Left bars show ON / OFF ratios above 2.0, middle bars show ON / OFF ratios between 2-1.5. The ON / OFF ratios below 1.5 are to the right. FIG. 5B. The ON / OFF ratios of the ARES ON switches plotted against their Gibbs free energy of the HHR forming (kcal / mol). FIG. 5C. The ON / OFF ratios of the ARES ON switches plotted against their Gibbs free energy of the aptamer forming (kcal / mol). FIG. 5D. The percent leakage of the ARES ON switches plotted against their Gibbs free energy of the HHR forming (kcal / mol).

[0069] FIG. 6A-6B: Expanding ARES ON switch library to P22N and MCP. FIG. 6A ON / OFF ratios for 46 P22N ARES ON switches. FIG. 6B. ON / OFF ratios for 12 MCP ARES ON switches. In FIG. 6A-6B, left bars show ON / OFF ratios above 2.0, middle bars show ON / OFF ratios between 2-1.5, and right bars show ON / OFF ratios below.

[0070] FIG. 7A-7B: Lowering leakage of ARES ON switch. FIG. 7A. Schematic showing the concatenation of ARES ON switches in the 3’ UTR. FIG. 7B. The normalized GFP MFI of the negative control (left bar) an ARES ON switch (middle bar), and two ARES ON switches concatenated (right bar) all with no RBP present.

[0071] FIG. 8: Schematic representing general ARES OFF switch. At one time both the aptamer and HHR can be frilly formed or a middle stem loop structure (“ON stem”) due to the shared “b” domain. Domains “a”, “c”, and “d” change the thermodynamic likelihood that the aptamer / HHR configuration is formed, or the middle stem loop is formed. When the aptamer / HHR is formed and the RBP present, the RBP will bind, stabilizing the HHR leading to a self-cleavage reaction and degradation of the mRNA. Without the RBP the HHR will not be stably formed for long enough to cleave.

[0072] FIG. 9A-9C: Overview of ARES OFF switch. FIG. 9A Models of BIV Tat ARES OFF switch with varying “a”, “b”, “c”, and “d” domain lengths. The top left image shows the aptamer and HHR formed, top right and bottom left are intermediate structures and the bottom right shows the middle stem loop formed. Each nucleotide position shows its thermodynamic likelihood based on the equilibrium probability scale. FIG. 9B ON / OFF ratios of all 83 OFF switches. FIG. 9C. The normalized GFP MFI of the negative control (left bar), best OFF switch without BIV Tat (middle bar), best OFF switch with BIV Tat (right bar).

[0073] FIG. 10: Schematical representation of cell-specific activation of ARES ON switch.Adding an ARES ON switch to a stable cell line producing the corresponding RBP results in gene expression. Adding the ARES ON switch to cells that do not produce the RBP results in mRNA degradation and no gene expression.

[0074] FIG. 11: Schematical representation of temporal control with ARES ON switch.When adding the ARES ON switch along with the corresponding RBP to cells the mRNA is stable and translation can occur. However, once the RBP is removed from cells the mRNA destabilizes and translation stops.

[0075] FIG. 12: Schematical representation of cell-specific activation of ARES OFF switch. Adding an ARES OFF switch to a stable cell line producing the corresponding RBP results in mRNA degradation and no translation. Adding the ARES OFF switch to cells that do not produce the RBP results in translation.

[0076] FIG. 13: Schematic representation of temporal control with ARES OFF switch.When the ARES OFF switch is added to cells the mRNA remains stable and translation occurs until the corresponding RBP is added. Once the RBP is added the mRNA is destabilized, degraded, and translation turns off.

[0077] FIG. 14: Diagram showing AND logic gate with ARES system. Two ARES ON switches are concatenated together in the 3’ UTRto create an AND gate where both RBPs are required to stabilize the mRNA and allow translation to occur.

[0078] FIG. 15: Diagram showing NOR logic gate with ARES system. Two ARES OFF switches are concatenated together in the 3 ’ UTR to create a NOR gate where at least one RBP is required to destabilize the mRNA, preventing further translation.

[0079] FIG. 16: Diagram showing A AND NOT B logic gate with ARES system. One ARES ON switch and one OFF switch are concatenated together in the 3’ UTRto create an A AND NOT B gate. If RBP A is present translation occurs, but if RBP B is present at all, translation is turned off.

[0080] FIG. 17A-17C: Hammerhead Ribozyme (HHR) and Aptamer Structures and Functions. (FIG. 17A) A HHR positioned in the 3’ UTR self-cleaves, removing the poly-A tail and triggering RNA degradation. (FIG. 17B) A HHR positioned in the 5’ UTR self-cleaves, removing the5’ cap and leading to RNA degradation. (FIG. 17C) Structures of three distinct aptamers: MS2, PP7, and BIV-Tar. The black bar regions are utilized in the ARES switch in the “a” and “b” domains.

[0081] FIG. 18A-18D: The ARES ON Switch in the 3’ UTR. (FIG. 18A) Schematic representation of the ARES ON switch in the 3’ UTR. Both aptamer and HHR structures can form. When the RNA-binding protein (RBP) is present, it binds and stabilizes the mRNA, leading to payload expression. In the absence of RBP, the HHR self-cleaves, triggering mRNA degradation. (FIG. 18B) Gibbs free energy of aptamer formation versus the ON / OFF ratio for 46 PP7 ARES ON switches. The trend line represents a linear fit with an R-squared value of 0.72. (FIG. 18C) Defect level of the HHR versus the percent leakage of 46 PP7 ARES ON switches in the absence of RBP. The trend line represents a fitted Hill function with an R-squared value of 0.56. (FIG. 18D) Normalized mCherry mean fluorescence intensity (MFI) of the best-performing MS2, PP7, and BIV- TAR (BT) ARES ON switches with (gray triangles) and without (black circles) their respective RBP.

[0082] FIG. 19A-19D: Variations of the ARES ON Switch. (FIG. 19A) Schematic representation of the ARES ON switch in the 5’ UTR. (FIG. 19B) Percentage of mCherry (ARES reporter) positive cells for the best-performing MS2 and PP7 designs in the 5’ UTR. Black circles indicate the absence of RBP, while gray triangles indicate the presence of RBP. (FIG. 19C) Schematic of the flipped ARES ON switch design, where the HHR is positioned upstream of the aptamer. (FIG. 19D) Percentage of mCherry (ARES reporter) positive cells for the best-performing MS2 and PP7 flipped designs. Black circles indicate the absence of RBP, while triangles indicate the presence of RBP.

[0083] FIG. 20A-20E: Utilizing Multiple ARES Switches to Reduce Leakage and Produce a Digital-to-Analog Effect. (FIG. 20A) Schematic representation of multiple ARES ON switches within the same mRNA. ARES switches can be concatenated in the 3’ UTR or placed in different UTRs. (FIG. 20B) Normalized mCherry MFI of concatenated MS2 ARES switches in the 3’ UTR in the absence of RBP. (FIG. 20C) Normalized mCherry MFI of concatenated MS2 ARES switches in the 3’ UTR with (gray triangle) and without (black circle) RBP. (FIG. 20D) Normalized mCherry MFI of concatenated MS2 and PP7 ARES switches in the 3’ UTR under different conditions: without RBP (circle), with MCP only (star), with PCP only (diamond), or with both RBPs (triangle). (FIG. 20E) Percentage of mCherry-positive cells for designs incorporating an MS2 ARES switch in the 5 ’ UTR and a PP7 ARES switch in the 3’ UTR under different conditions: without RBP (circle), with MCP only (star), with PCP only (diamond), or with both RBPs (triangle).

[0084] FIG. 21A-21D: The ARES OFF Switch in the 3’ UTR. (FIG. 21A) Schematic representation of the first ARES OFF switch design in the 3’ UTR. Both aptamer and HHR structures form at the same time or the stabilizing stem. When the RNA-binding protein (RBP) is present, it binds the aptamer leading to the HHR cleavage, triggering mRNA degradation. In the absence of RBP payload expression is on. (FIG. 21B) Percent GFP (reporter) positive cells of the best-performing BTARES OFF switch with (gray triangle) and without (black circle) RBP. (FIG. 21C) Schematic representation of the second ARES OFF switch design in the 3’ UTR. Both aptamer and HHR structures form at the same time or two stabilizing stems. When the RNA-binding protein (RBP) is present, it binds the aptamer leading to the HHR cleavage, triggering mRNA degradation. In the absence of RBP payload expression is on. (FIG. 21D) Normalized mCherry MFI of the bestperforming MS2 ARES OFF switch with (gray triangle) and without (black circle) RBP.

[0085] FIG. 22: Additional ARES OFF Switch Design in the 3’ UTR. Schematic representation of the third ARES OFF switch design in the 3’ UTR. An ARES ON switch is positioned between an upstream stabilizing domain (triangle) and a downstream degradation domain (four box repeat). When the RBP is present, it binds the aptamer and prevents HHR cleavage, keeping the degradation domain attached to the mRNA and leading to its degradation. In the absence of RBP, the HHR cleaves the degradation domain, allowing the stabilizing domain to protect the mRNA from degradation.

[0086] FIG. 23A-23B: Life Cycle of Self-Amplifying RNA (saRNA) and Integration of ARES Switch. (FIG. 23A) The amplification cycle of saRNA. Upon entry into the cell, translation of the RNA-dependent RNA polymerase (RdRp) (nsPl-4) begins. The RdRp first recognizes the active promoter sequence (black arrows) at the 3’ end of the positive-sense strand. Synthesis of the negative -sense strand by RdRp generates two new promoter sequences, which are then used to synthesize both the full-length positive -sense strand and the subgenomic strand. The subgenomic strand is responsible for payload production. Asterisks (*) indicate reverse complement sequences. (FIG. 23B) Integration sites (A, B, C, D) for ARES switches in the saRNA.DETAILED DESCRIPTION

[0087] mRNA devices and therapeutics have rapidly expanded as promising tools in the fight against various diseases. Despite their potential, these technologies are hindered by a significant limitation: the lack of precise spatial and temporal control. Presently, the specific delivery of mRNA relies on delivery vehicles, but such systems cannot achieve cell-specific delivery. Additionally, temporal control has been achieved through the addition of cap structures, degradation tags, and similar methods; however, this only extends or shortens lifespan and does not give adaptable control. To tackle these issues, described herein are systems that merge RNA binding proteins (RBPs) with self-cleaving ribozymes (e.g., hammerhead ribozyme, HHR) into an aptamer and ribozyme equilibrium shifting (ARES) RNA circuit, which can then be inserted into the UTR of a gene to control mRNA stability. Depending on the placement of the aptamer and HHR, a stabilizing or destabilizing switch can be developed with the RBP as the trigger.

[0088] First, described herein is a stabilization or ON-switch ARES region, where translation of a gene of interest (GOI) occurs only in the presence of the corresponding RBP; mRNA is degraded inits absence. Second, described herein is a destabilizing or OFF-switch ARES region, permitting translation of a GOI until a specific RBP is present, which then destabilizes and leads to the degradation of the mRNA. Third, described herein is higher-order control in the form of logic gates. These gates utilize developed stabilizing and destabilizing switches to form AND, OR, and A AND NOT B logic. This approach offers more precise spatial and temporal control over RNA therapeutics, as the selected RBP can be, for example, a biomarker protein or an additional drug. This advancement results in enhanced efficacy and reduced side effects. Furthermore, the versatility of the RNA switches described herein permit their broad application across various healthcare scenarios. Fourth, described herein are stabilization / degradation ARES regions, which can function as an OFF switch. Fifth, described herein are self-amplifying RNAs comprising at least one of the ARES regions described herein.

[0089] As such, embodiments of the technology described herein relate to RNA molecules comprising at least one ARES region described herein, for example at least one ON-switch ARES region, at least one OFF-switch ARES region, and / or at least one stabilization and degradation ARES region. In multiple aspects, described herein is an RNA molecule comprising a) an open reading frame (ORF) encoding at least one cargo polypeptide; and b) at least one untranslated region (UTR) comprising at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region. In some embodiments, the ARES region comprises i) at least one a protein-binding aptamer that specifically binds to a protein; and ii) at least one ribozyme, as described further herein.

[0090] In some embodiments, an RNA molecule comprises at least one ARES region as described herein (e.g., 1, 2, 3, 4, 5, or more ARES regions, which can be the same or different ARES regions), which is located in the UTR 5' of the ORF (5' UTR). In some embodiments, an RNA molecule comprises at least one ARES region as described herein (e.g., 1, 2, 3, 4, 5, or more ARES regions, which can be the same or different ARES regions), which is located in the UTR 3' of the ORF (3' UTR). In some embodiments, an RNA molecule comprises at least one ARES region as described herein (e.g., 1, 2, 3, 4, 5, or more ARES regions, which can be the same or different ARES regions), which is located in the UTR 5' of the ORF (5' UTR), and at least one ARES region as described herein (e.g., 1, 2, 3, 4, 5, or more ARES regions, which can be the same or different ARES regions), which is located in the UTR 3' of the ORF (3' UTR).

[0091] In some embodiments, as discussed further herein, the at least one ARES region modulates the stability of the RNA molecule. In some embodiments, as discussed further herein, the at least one ARES region modulates translation of the at least one cargo polypeptide encoded by the ORF. In some embodiments, as discussed further herein, the at least one ARES region modulates the stability of the RNA molecule and modulates translation of the at least one cargo polypeptide encoded by the ORF.

[0092] In multiple aspects, described herein is an RNA molecule that comprises two different ARES domains (see e.g., Table 9). In some embodiments, the first ARES region comprises an aptamer that specifically binds to a first target protein, and the second ARES region comprises an aptamer that specifically binds to a second target protein. In some embodiments, the first ARES region comprises an aptamer that specifically binds to a first target protein, and the second ARES region comprises an aptamer that specifically binds to the first target protein. As an example, an RNA molecule that comprises two ON-switch ARES regions, where each ARES region comprises an aptamer that specifically binds to a different target protein, can be referred to herein as an “AND logic gate” (see e.g., FIG. 14). As another example, an RNA molecule that comprises two OFF -switch ARES regions (or two stabilization / degradation ARES regions; or an OFF-switch ARES region and a stabilization / degradation ARES region), where each ARES region comprises an aptamer that specifically binds to a different target protein, can be referred to herein as a “NOR logic gate” (see e.g., FIG. 15). As a further example, an RNA molecule that comprises an OFF-switch ARES region and an OFF-switch ARES region (or a stabilization / degradation ARES region), where each ARES region comprises an aptamer that specifically binds to a different target protein, can be referred to herein as an “A AND NOT B logic gate” (see e.g., FIG. 16).

[0093] Table 9: Exemplary Combinations of ARES regions in an RNA moleculeAptamers and Target Proteins

[0094] In multiple aspects, described herein are ARES regions, which comprise at least one protein-binding aptamer (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more aptamers, which can be the same or different aptamers). As used herein, the term “protein-binding aptamer” refers to a single -stranded nucleic acid molecule (e.g., single -stranded RNA, ssRNA) that can hybridize to itself to form at least one stem and loop secondary structure (e.g., a hairpin) that is configured to specifically bind to at least one target protein (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more target proteins, which can be the same or different target proteins). The target protein binding to the aptamer can stabilize the formation of the aptamer and influence the formation of other secondary structures in the ARES region (e.g.,ribozymes, stabilization loops, etc.), as described further herein. In some embodiments, the target protein is an RNA-binding protein (RBP).

[0095] The ARES regions described herein can comprise any aptamer known in the art or discovered to be capable of specifically binding to a target protein. Non-limiting examples of proteinbinding aptamers and their associated target proteins include a portion of a viral genome (e.g., an RNA recognition site) that binds to a viral capsid protein, a viral coat protein, or another viral protein. For example, the MS2 aptamer from the MS2 bacteriophage (e.g., SEQ ID NO: 1) specifically binds to MS2 coat protein (MCP, SEQ ID NO: 5). As another example, the PP7 aptamer from the PP7 bacteriophage (e.g., SEQ ID NO: 2) specifically binds to PP7 coat protein (PCP, SEQ ID NO: 6). As a third example, the bovine immunodeficiency virus (BIV) Tar aptamer (e.g., SEQ ID NO: 3) specifically binds to BIV trans-activator of transcription (Tat, SEQ ID NO: 7). As a fourth example, the P22 aptamer from the bacteriophage P22, also referred to as the BoxB aptamer, (e.g., SEQ ID NO: 4) specifically binds to P22 N protein (SEQ ID NO: 8).

[0096] Table 8: Exemplary protein-binding aptamer sequences and their associated target proteins

[0097] In some embodiments, the protein-binding aptamer comprises one of SEQ ID NOs: 1-4 or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 1-4, which maintains its functions (e.g., stem-loop formation, target protein binding), or a functional fragment thereof.

[0098] In some embodiments, the target protein comprises one of SEQ ID NOs: 5-8 or an amino acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least98%, or at least 99% identical to one of SEQ ID NOs: 5-8, which maintains its function (e.g., RNA binding), or a functional fragment thereof.

[0099] SEQ ID NO: 5, MCP:MASNFTQFVLVDNGGTGDVTVAPSNFANGIAEWISSNSRSQAYKVTCSVRQSSAQNRKYTIK VEVPKGAWRSYLNMELTIPIFATNSDCELIVKAMQGLLKDGNPIPSAIAANSGIY

[0100] SEQ ID NO: 6, PCP:MSKTIVLSVGEATRTLTEIQSTADRQIFEEKVGPLVGRLRLTASLRQNGAKTAYRVNLKLDQ ADVVDSGLPKVRYTQVWSHDVTIVANSTEASRKSLYDLTKSLVATSQVEDLVVNLVPLG

[0101] SEQ ID NO: 7, BIV Tat: SGPRPRGTRGKGRRIRR

[0102] SEQ ID NO: 8, P22 N protein: NAKTRRHERRRKLAIER

[0103] In some embodiments, the target protein is encoded by a nucleic acid comprising one ofSEQ ID NOs: 373-376 or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 373- 376, which maintains its function when translated as a polypeptide (e.g., RNA binding), or a codon- optimized version thereof, or a functional fragment thereof.

[0104] SEQ ID NO: 373, MCP nucleic acid:ATGGCCTCTAACTTTACCCAATTCGTCCTCGTCGATAATGGCGGCACAGGAGATGTGACA GTGGCTCCTAGTAATTTCGCAAATGGCATCGCTGAATGGATTTCCAGTAACAGCCGCAGC CAGGCTTATAAGGTGACCTGTTCCGTTCGGCAGTCCTCAGCACAAAACCGGAAATATACA ATAAAGGTGGAAGTACCTAAAGGCGCTTGGCGCTCTTACCTCAATATGGAATTAACAATT CCCATATTTGCAACGAATTCCGATTGCGAGTTGATCGTCAAGGCAATGCAGGGGCTCCTG AAAGACGGGAATCCCATCCCTAGTGCAATTGCCGCTAATTCTGGAATCTAT

[0105] SEQ ID NO: 374, PCP nucleic acid:ATGTCCAAGACTATCGTCTTATCAGTTGGAGAGGCGACCCGCACCTTAACCGAGATCCAA TCCACTGCCGATAGACAAATCTTCGAGGAGAAGGTCGGCCCACTCGTGGGTCGGTTGCG CCTTACAGCTAGTCTGCGGCAGAATGGTGCCAAGACCGCCTACAGAGTCAACCTTAAACT GGATCAAGCTGATGTGGTGGATAGCGGCCTTCCGAAGGTTCGTTATACGCAGGTGTGGA GTCATGACGTTACAATCGTGGCGAACTCTACTGAAGCCTCTCGGAAGAGCTTGTACGACC TTACTAAGAGCTTAGTGGCGACGTCCCAGGTCGAAGACCTGGTTGTAAACCTGGTACCTC TGGGC

[0106] SEQ ID NO: 375, BIV Tat nucleic acid:AGTGGACCGAGACCAAGAGGAACACGCGGAAAGGGCAGGCGGATCCGACGG

[0107] SEQ ID NO: 376, P22 N nucleic acid:AATGCCAAGACTCGACGGCATGAGAGAAGGCGGAAACTGGCTATCGAACGG

[0108] In some embodiments, the aptamer specifically binds to a target protein, which is specifically produced by cells infected by a bacterium or virus or fungus, and not by healthy, uninfected cells. In some embodiments, the aptamer specifically binds to a target protein, which isspecifically produced by cells associated with a disease or disorder, and not by healthy cells. In some embodiments, the aptamer specifically binds to a target protein, which is a mutant variant of a naturally occurring polypeptide. For example, an aptamer can specifically bind to a mutant variant of a naturally occurring polypeptide expressed by cancer cells but does not bind to the naturally occurring polypeptide expressed by non-cancerous cells.

[0109] Further non-limiting examples of target proteins to which the aptamer can specifically bind include: a) a detectable marker (e.g., a fluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anti-claudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti-cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti-glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL-12, OX40L, IL-23); d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a site-specific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like); h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon-like peptide-1, insulin); or i) an oncogene (e.g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF).

[0110] In some embodiments, the aptamer comprises Iron responsive element (IRE), and the target protein comprises Iron responsive protein (IRP); see e.g., Levenson et al. “Iron and ageing: an introduction to iron regulatory mechanisms.” Ageing Res Rev. 3(3): 251-263 (2004).

[0111] In some embodiments, aptamers (e.g., RNA aptamers) can be selected for particular target proteins using a techniques, including but not limited to, Systematic Evolution of Ligands by Exponential enrichment (SELEX).

[0112] In some embodiments, the aptamer is located 5' of the ribozyme in the ARES region. In some embodiments, the aptamer is located 3' of the ribozyme in the ARES region.Ribozymes

[0113] In multiple aspects, described herein are ARES regions, which comprise at least ribozyme (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more ribozymes, which can be the same or different ribozymes). As used herein, the term “ribozyme” refers to an RNA-comprising nucleic acid, which is capable of functioning as an enzyme. Any ribozyme known in the art or discovered can be used in the ARES regions described herein. In some embodiments, the ribozyme is a self-cleaving ribozyme, that is theribozyme is capable of cleaving itself (i.e., endonucleolytic cleavage). Non-limiting examples of selfcleaving ribozymes include hammerhead ribozyme (HHR), hepatitis delta virus (HDV) ribozyme, hairpin ribozyme, Varkud satellite (VS) ribozyme, glmS ribozyme, twister ribozyme, twister sister ribozyme, Pistol ribozyme, Hatchet ribozyme, and Hovlinc ribozyme; for more details about selfcleaving ribozymes, see e.g., Jimenez et al. “Chemistry and Biology of Self-Cleaving Ribozymes.” Trends Biochem Sci. 40(11): 648-661 (2015); Peng et al. “Self-cleaving ribozymes: substrate specificity and synthetic biology applications.” RSC Chem Biol. 2(5): 1370-1383 (2021); the contents of each of which are incorporated herein by reference in their entirety.

[0114] In some embodiments, the self-cleaving ribozyme comprises a hammerhead ribozyme (HHR). A HHR comprises a catalytic core of conserved nucleotides, which is flanked by three helices; two of the helices can form tertiary interactions that can permit self-cleavage. HHRs occur in many species’ genomes, including in subviral plant pathogens.

[0115] In some embodiments, the hammerhead ribozyme (HHR) comprises SEQ ID NO: 370 or an nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 370, , which maintains its function (e.g., self-cleavage), or a functional fragment thereof.

[0116] SEQ ID NO: 370, hammerhead ribozyme (HHR):GCGCGTCCTGGATTCGCGGAAACGCGTACATCCAGCTGACGAGTCCCAAATAGGACGAA ACGCGC

[0117] In some embodiments, the ribozyme is located 5' of the aptamer in the ARES region. In some embodiments, the ribozyme is located 3' of the aptamer in the ARES region.ON-Switch ARES Regions

[0118] In multiple aspects, described herein are ON-switch ARES region. As used herein, the term “ON-switch ARES region” refers to an ARES region which can turn the translation of at least one cargo polypeptide ON in the presence of a target protein that specifically binds to the proteinbinding aptamer. Specifically, in an RNA molecule comprising an ON-switch ARES region, in the presence of the target protein, the aptamer is stabilized, the ribozyme (e.g., self-cleaving ribozyme) cannot form, the RNA molecule is not cleaved (e.g., by the self-cleaving ribozyme), and the ORF encoding the at least one cargo polypeptide can be translated (ON). Furthermore, in an RNA molecule comprising an ON-switch ARES region, the aptamer is not stabilized, the self-cleaving ribozyme can form, the RNA molecule is cleaved (e.g., by the self-cleaving ribozyme), and the ORF encoding the at least one cargo polypeptide cannot be translated (OFF). In some embodiments, the ON-switch ARES region is structured such that either the aptamer or the ribozyme, but not both, can form at one time inthe RNA molecule. For example, the ON-switch ARES region can be structured such that the aptamer and the ribozyme share at least one region.

[0119] In one aspect, described herein is an ON-switch ARES region comprising: a) at least one aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a complementary (b*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region in the ribozyme; and b) at least one ribozyme comprising: i) the secondary second (b2) region and the complementary (b*) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region.

[0120] In some embodiments, in an ON-switch ARES region, the aptamer and ribozyme share at least one region (e.g., the complementary (b*) region).

[0121] In some embodiments, the aptamer is 5’ of the ribozyme in the ON-switch ARES region (see e.g., FIG. 1A). In some embodiments, the ON-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the complementary (b*) region that can hybridize to the primary second (bl) region in the aptamer or to a secondary second (b2) region in the ribozyme; e) the third (c) region; f) the complementary (c*) region that can hybridize to the third (c) region; and g) the secondary second (b2) region.

[0122] In some embodiments, the ribozyme is 5’ of the aptamer in the ON-switch ARES region (see e.g., FIG. IB). In some embodiments, the ON-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (c) region; d) the complementary (b*) region that can hybridize to the secondary second (b2) region in the ribozyme or to a primary second (bl) region in the aptamer; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; and g) the primary second (bl) region.

[0123] In some embodiments, the ON-switch ARES region comprises a sequence selected from Table 1 (Exemplary MS2 ON switches), Table 3 (Exemplary PP7 ON switches), Table 4 (Exemplary BIV Tar ON switches), Table 6 (Exemplary P22N ON switches), or Table 7 (Exemplary High- Performing ON and OFF switches).

[0124] In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 9- 26, 122-218, or 313-369 or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 9-26, 122-218, or 313-369, which maintains its function (e.g., ON-switch ARES region).

[0125] In some embodiments, the ON-switch ARES region comprises an MS2 aptamer 5’ of an HHR. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 9-23, or anucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 9-23, which maintains its function (e.g., ON-switch ARES region).

[0126] In some embodiments, the ON-switch ARES region comprises an HHR 5’ of an MS2 aptamer. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 24-26, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 24-26, which maintains its function (e.g., ON-switch ARES region).

[0127] In some embodiments, the ON-switch ARES region comprises a PP7 aptamer 5’ of an HHR. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 122-168, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 122-168, which maintains its function (e.g., ON-switch ARES region).

[0128] In some embodiments, the ON-switch ARES region comprises an HHR 5’ of a PP7 aptamer. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 169- 172, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 169-172, which maintains its function (e.g., ON-switch ARES region).

[0129] In some embodiments, the ON-switch ARES region comprises a BIV Tar aptamer 5’ of an HHR. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 173- 218, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 173-218, which maintains its function (e.g., ON-switch ARES region). In some embodiments, the ON-switch ARES region comprises an HHR 5’ of a BIV Tar aptamer.

[0130] In some embodiments, the ON-switch ARES region comprises a P22 aptamer 5’ of an HHR. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 313-369, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 313-369, which maintains its function (e.g., ON-switch ARES region). In some embodiments, the ON-switch ARES region comprises an HHR 5’ of a P22 aptamer.

[0131] In some embodiments, the ON-switch ARES region is a high-performing ON-switch ARES region. In some embodiments, the ON-switch ARES region comprises one of SEQ ID NOs: 10, 12, 18, 22, 24, 122, 130, 136, 149, 157, 169, 204, 214, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 10, 12, 18, 22, 24, 122, 130, 136, 149, 157, 169, 204, 214, which maintains its function (e.g., ON-switch ARES region).Stabilization and Degradation ARES Regions

[0132] In multiple aspects, described herein are ARES region that comprise at least one stabilization domain (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more stabilization domains, which can be the same or stabilization domains) and / or at least one degradation domain (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more degradation domains, which can be the same or degradation domains). As used herein, the term “stabilization domain” or “stabilizing domain” refers to a nucleic acid sequence (e.g., ssRNA) that increases the half-life of a nucleic acid (e.g., RNA molecule) that comprises it. As used herein, the term “degradation domain” or “destabilization domain” or “destabilizing domain” refers to a nucleic acid sequence (e.g., ssRNA) that decreases the half-life of a nucleic acid (e.g., RNA molecule) that comprises it and / or increase the degradation rate of a nucleic acid (e.g., RNA molecule) that comprises it. For more details about stabilization domains and degradation domains, see e.g., Wroblewska et al. (2015). “Mammalian synthetic circuits with RNA binding proteins for RNA-only delivery.” Nature biotechnology, 33(8), 839-841, the contents of which are incorporated herein by reference in their entirety.

[0133] In some embodiments, an RNA molecule comprises a stabilization / degradation ARES region. In some embodiments, the stabilization / degradation ARES region is in the 3' UTR of the RNA molecule. In some embodiments, the stabilization / degradation ARES region is in the 5' UTR of the RNA molecule. In some embodiments, the stabilization / degradation ARES region comprises at least one stabilization domain, at least one ONE-switch ARES region as described herein, and at least one degradation domain.

[0134] In some embodiments, in an RNA molecule comprising a stabilization / degradation ARES region, in the presence of the target protein, the aptamer is stabilized, the ribozyme (e.g., self-cleaving ribozyme) cannot form, the RNA molecule is not cleaved (e.g., by the self-cleaving ribozyme), the degradation domain is retained, the RNA molecule is degraded, and the ORF encoding the at least one cargo polypeptide cannot be translated (OFF). In some embodiments, in an RNA molecule comprising a stabilization / degradation ARES region, in the absence of the target protein, the aptamer is not stabilized, the ribozyme (e.g., self-cleaving ribozyme) can form, the RNA molecule is cleaved (e.g., by the self-cleaving ribozyme), the degradation domain is not retained, the stabilization domainprotects the RNA molecule from degradation, and the ORF encoding the at least one cargo polypeptide can be translated (ON).

[0135] In one aspect, described herein is a stabilization / degradation ARES region comprising from 5' to 3': a) a stabilization domain; b) an ON-switch ARES region structured such that either the aptamer or the ribozyme, but not both, can form at one time in the RNA molecule; and c) a degradation domain.

[0136] In one aspect, described herein is a stabilization / degradation ARES region comprising from 5' to 3': a) a stabilization domain; b) an ON-switch ARES region as described herein; and c) a degradation domain. In one aspect, described herein is an ON-switch ARES region comprising: a) a stabilization domain; b) at least one aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a complementary (b*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region in the ribozyme; c) at least one ribozyme comprising: i) the secondary second (b2) region and the complementary (b*) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; and d) at least one degradation domain.

[0137] In some embodiments, the aptamer is 5 ’ of the ribozyme in the stabilization / degradation ARES region (see e.g., FIG. 1C). In some embodiments, the stabilization / degradation ARES region comprises from 5' to 3': a) the stabilization domain; b) the primary second (bl) region; c) the first (a) region; d) the complementary (a*) region that can hybridize to the first (a) region; e) the complementary (b*) region that can hybridize to the primary second (bl) region in the aptamer or to a secondary second (b2) region in the ribozyme; f) the third (c) region; g) the complementary (c*) region that can hybridize to the third (c) region; h) the secondary second (b2) region; and i) the degradation domain.

[0138] In some embodiments, the ribozyme is 5’ of the aptamer in the stabilization / degradation (see e.g., FIG. ID). In some embodiments, the stabilization / degradation ARES region comprises from 5' to 3': a) the stabilization domain; b) the secondary second (b2) region; c) the third (c) region; d) the complementary (c*) region that can hybridize to the third (c) region; e) the complementary (b*) region that can hybridize to the secondary second (b2) region in the ribozyme or to a primary second (bl) region in the aptamer; f) the first (a) region; g) the complementary (a*) region that can hybridize to the first (a) region; h) the primary second (bl) region; and i) the degradation domain.

[0139] In some embodiments, the stabilization domain comprises SEQ ID NO: 371 or an nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 371, which maintains its function (e.g., stabilization of an RNA molecule), or a functional fragment thereof.

[0140] SEQ ID NO: 371, stabilization domain:GATTCGTCAGTAGGGTTGTAAAGGTTTTTCTTTTCCTGAGAAAACAACCTTTTGTTTTCTC AGGTTTTGCTTTTTGGCCTTTCCCTAGCTTTAAAAAAAAAAAAGCAAAA

[0141] In some embodiments, the degradation domain comprises 30 repeats of TAAGTTAT. In some embodiments, the degradation domain comprises at least 5, at least 10, at least 15, at least 20, at least 25, or at least 30 repeats of TAAGTTAT. In some embodiments, the degradation domain comprises SEQ ID NO: 372 or an nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to SEQ ID NO: 372, which maintains its function (e.g., destabilization of an RNA molecule and / or degradation of an RNA molecule), or a functional fragment thereof.

[0142] SEQ ID NO: 372, degradation domain:TAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGT TATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTA AGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTA TTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATTAAGTTATOFF-Switch ARES Regions

[0143] In multiple aspects, described herein are OFF-switch ARES region. As used herein, the term “OFF-switch ARES region” refers to an ARES region which can turn the translation of at least one cargo polypeptide OFF in the presence of a target protein that specifically binds to the proteinbinding aptamer. Specifically, in an RNA molecule comprising an OFF-switch ARES region, in the presence of the target protein, the aptamer is stabilized, the ribozyme (e.g., self-cleaving ribozyme) can form, at least one stabilization stem cannot form, the RNA molecule is cleaved (e.g., by the selfcleaving ribozyme), and the ORF encoding the at least one cargo polypeptide cannot be translated (OFF). Furthermore, in an RNA molecule comprising an OFF-switch ARES region, in the absence of the target protein, the aptamer is not stabilized, the ribozyme (e.g., self-cleaving ribozyme) cannot form, at least one stabilization stem can form, the RNA molecule is not cleaved (e.g., by the selfcleaving ribozyme), and the ORF encoding the at least one cargo polypeptide can be translated (ON). In some embodiments, the OFF-switch ARES region is structured such that either both the aptamer and the ribozyme, or at least one stabilization stem, can form at one time in the RNA molecule.

[0144] In some embodiments, the OFF-switch ARES region comprises at least one stabilization stem (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more stabilization stems, which can be the same or different stabilization stems). As used herein, the term “stabilization stem” or “ON stem” refers to a secondary structure that can form in the OFF-switch ARES region, which prevents the formation of the aptamer and the ribozyme. Since the self-cleaving ribozyme cannot form when the at least one stabilizationstem is present, the OFF-switch ARES region is “ON” when the at least one stabilization stem is formed. In some embodiments, the at least one stabilization stem has more a stable secondary structure that is preferred to the less stable structures of the aptamer and ribozyme, when the target protein is not present. When the target protein is present, its binding to the aptamer stabilizes the aptamer and allows the ribozyme to form, and the at least one stabilization stem is not formed. In some embodiments, the at least one stabilization stem shares at least one region with the aptamer and / or ribozyme, such that either the at least one stabilization stem, or both the aptamer and the ribozyme, can form at one time in the RNA molecule.

[0145] In some embodiments, the OFF-switch ARES region comprises one stabilization stem. In one aspect, described herein is an OFF-switch ARES region comprising: a) at least one aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) at least one ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; and c) at least one stabilization stem comprising: i) a fourth (d) region and a complementary (d*) region that can hybridize to the fourth (d) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer.

[0146] In some embodiments, in an OFF-switch ARES region with a single stabilization stem, the 5' to 3' order is: aptamer, stabilization stem, and ribozyme. In some embodiments, in an OFF- switch ARES region with a single stabilization stem, the 5' to 3' order is: ribozyme, stabilization stem, and aptamer. In some embodiments, in an OFF-switch ARES region, the aptamer and stabilization stem share at least one region (e.g., the primary complementary (bl*) region). In some embodiments, in an OFF-switch ARES region, the ribozyme and stabilization stem share at least one region (e.g., the secondary second (b2) region).

[0147] In some embodiments, the aptamer is 5’ of the ribozyme in the OFF-switch ARES region with a single stabilization stem (see e.g., FIG. IE). In some embodiments, the OFF-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the secondary second (b2) region; h) the third (c) region; i) the complementary (c*) region that can hybridize to the third (c) region; and j) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0148] In some embodiments, the ribozyme is 5’ of the aptamer in the OFF-switch ARES region with a single stabilization stem (see e.g., FIG. IF). In some embodiments, the OFF-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (a) region; d) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region or to a primary second (bl) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the primary second (bl) region; h) the first (a) region; i) the complementary (a*) region that can hybridize to the first (a) region; and j) the primary complementary (bl*) region that can hybridize to the primary second (bl) region.

[0149] In some embodiments, the OFF-switch ARES region comprises two stabilization stems. In one aspect, described herein is an OFF-switch ARES region comprising: a) an aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) a ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the aptamer and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region (see e.g., FIG. 1G).

[0150] In some embodiments, in an OFF-switch ARES region with two stabilization stems, the 5' to 3' order is: second stabilization stem, aptamer, first stabilization stem, and ribozyme. In some embodiments, in an OFF-switch ARES region with two stabilization stems, the aptamer and the first stabilization stem share at least one region (e.g., the primary complementary (bl*) region). In some embodiments, in an OFF-switch ARES region with two stabilization stems, the aptamer and the second stabilization stem share at least one region (e.g., the primary second (bl) region). In some embodiments, in an OFF-switch ARES region with two stabilization stems, the ribozyme and stabilization stem share at least one region (e.g., the secondary second (b2) region).

[0151] In some embodiments, the aptamer is 5’ of the ribozyme in the OFF-switch ARES region with two stabilization stems (see e.g., FIG. 1G). In some embodiments, the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region;f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; 1) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0152] In one aspect, described herein is an OFF-switch ARES region comprising: a) a ribozyme comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) an aptamer comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the aptamer and the primary complementary (bl*) region of the ribozyme; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the ribozyme and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region (see e.g., FIG. 1H).

[0153] In some embodiments, in an OFF-switch ARES region with two stabilization stems, the 5' to 3' order is: second stabilization stem, ribozyme, first stabilization stem, and aptamer. In some embodiments, in an OFF-switch ARES region with two stabilization stems, the ribozyme and the first stabilization stem share at least one region (e.g., the primary complementary (bl*) region). In some embodiments, in an OFF-switch ARES region with two stabilization stems, the ribozyme and the second stabilization stem share at least one region (e.g., the primary second (bl) region). In some embodiments, in an OFF-switch ARES region with two stabilization stems, the aptamer and stabilization stem share at least one region (e.g., the secondary second (b2) region).

[0154] In some embodiments, the ribozyme is 5’ of the aptamer in the OFF-switch ARES region with two stabilization stems (see e.g., FIG. 1H). In some embodiments, the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c)region; 1) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

[0155] In some embodiments, the OFF-switch ARES region comprises a sequence selected from Table 2 (Exemplary MS2 OFF switches, with 2 stabilization stems), Table 5 (Exemplary BIV Tar OFF switches, with 1 stabilization stem), or Table 7 (Exemplary High-Performing ON and OFF switches).

[0156] In some embodiments, the OFF-switch ARES region comprises one of SEQ ID NOs: 27- 121 or 219-312 or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 27-121 or 219- 312, which maintains its function (e.g., OFF-switch ARES region).

[0157] In some embodiments, the OFF-switch ARES region comprises an MS2 aptamer 5’ of an HHR (e.g., with 2 stabilization stems). In some embodiments, the OFF-switch ARES region comprises one of SEQ ID NOs: 27-121, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 27-121, which maintains its function (e.g., OFF-switch ARES region). In some embodiments, the OFF-switch ARES region comprises an HHR 5’ of an MS2 aptamer. In some embodiments, the OFF-switch ARES region comprises a PP7 aptamer 5’ of an HHR. In some embodiments, the OFF- switch ARES region comprises an HHR 5’ of a PP7 aptamer.

[0158] In some embodiments, the OFF-switch ARES region comprises a BIV Tar aptamer 5’ of an HHR (e.g., with 1 stabilization stem). In some embodiments, the OFF-switch ARES region comprises one of SEQ ID NOs: 219-312, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NOs: 219-312, which maintains its function (e.g., OFF-switch ARES region). In some embodiments, the OFF-switch ARES region comprises an HHR 5’ of a BIV Tar aptamer. In some embodiments, the OFF-switch ARES region comprises a P22 aptamer 5’ of an HHR. In some embodiments, the OFF- switch ARES region comprises an HHR 5’ of a P22 aptamer.

[0159] In some embodiments, the OFF-switch ARES region is a high-performing OFF-switch ARES region. In some embodiments, the OFF-switch ARES region comprises one of SEQ ID NO: 41 or SEQ ID NO: 263, or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identical to one of SEQ ID NO: 41 or SEQ ID NO: 263, which maintains its function (e.g., OFF-switch ARES region).Self-Amplifying RNAs

[0160] In some aspects, the RNA molecules described herein are comprised by a self-amplifying RNA (saRNA). As used herein, the terms “self-amplifying RNA” or “saRNA” or “self-replicating RNA” or “srRNA” are used interchangeably and refer to a positive sense RNA (e.g., +ssRNA; e.g., genome), which encodes machinery for its own replication (e.g., an RNA-dependent RNA polymerase, RdRP) and is thus capable of undergoing replication activity that results in reverse complementary negative sense strands (e.g., anti-sense; e.g., -ssRNA; e.g., anti-genome) and replicate strands (e.g., +ssRNA) from the original positive sense RNA strand. In some embodiments, the saRNA is derived from a viral genome. In some embodiments, the saRNA is derived from an alphaviral genome.

[0161] In one aspect, described herein is a self-amplifying RNA (saRNA) comprising an RNA molecule as described herein (which comprises an open reading frame encoding at least one cargo polypeptide, and at least one ARES region as described herein), where the saRNA further comprises an additional open reading frame encoding an RNA-dependent RNA polymerase.

[0162] In some embodiments, the saRNA comprises from 5' to 3': a) a 5' conserved sequence element (CSE); b) a first open reading frame (ORF) encoding an RNA-dependent RNA polymerase (RdRP), operably linked to a promoter in the 5' CSE; c) a subgenomic promoter (SGP); d) a second ORF encoding at least one cargo polypeptide, operably linked to the SGP; and e) a 3' CSE. In some embodiments, the 5' CSE, a region between the first and second ORFs, and / or the 3' CSE further comprises at least one ARES region as described herein (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more ARES regions, which can be the same or different ARES regions; e.g., an ON-switch ARES region, a stabilization / degradation ARES region, and / or an OFF-switch ARES region). In some embodiments, the at least one ARES region is in a sense orientation in the saRNA, such that the ARES region is functional in the saRNA (e.g., in the positive sense saRNA; e.g., prior and after replication of the saRNA by the encoded RdRP). In some embodiments, the at least one ARES region is in an anti-sense orientation in the saRNA, such that the ARES region is not functional in the saRNA (e.g., in the positive sense saRNA; e.g., not functional prior to replication of the saRNA by the encoded RdRP), and the antisense -orientation ARES region is functional when the saRNA is delivered to a cell, the RdRP is translated from the saRNA, and the RdRP synthesizes a reverse complementary negative strand of the saRNA.

[0163] In some embodiments, the first open reading frame (ORF), which encodes an RNA- dependent RNA polymerase (RdRP), specifically encodes non-structural protein 1 (nspl), non- structural protein 2 (nsp2), non-structural protein 3 (nsp3), and / or non-structural protein 4 (nsp4), each derived from at least one virus (e.g., an alphavirus).

[0164] In some embodiments, the saRNAs described herein are derived from at least one alphavirus. Non-limiting examples of alphaviruses include: Aura Virus (AURAV), Barmah ForestVirus (BFV), Bebaru virus, Caaingua virus, Cabassou virus, Chikungunya Virus (CHIKV), Eastern Equine Encephalitis Virus (EEEV), Eliat virus, Everglades Virus (EVEV), Fort Morgan virus, Getah Virus (GETV), Highlands J Virus (HJV), Madariaga virus, Mayaro Virus (MAYV), Middleburg Virus (MIDV), Mosso das Pedras virus, Mucambo Virus (MUCV), Ndumu virus, O'nyong nyong virus (ONNV), Pixuna virus, Rio Negro Virus (RNV), Ross River Virus (RRV), Salmon pancreas disease virus, Semliki Forest Virus (SFV), Sindbis Virus (SIN), Southern elephant seal virus, Tonate Virus (TONV), Trocara virus, Una Virus (UNAV), Venezuela Equine Encephalitis Virus (VEEV), Western Equine Encephalitis Virus (WEEV), and Whataroa virus.

[0165] Alphavirus is a genus of RNA viruses, the sole genus in the Togaviridae family. Alphaviruses belong to group IV of the Baltimore classification of viruses, with a positive-sense, single -stranded RNA genome. The alphaviruses are small, spherical, enveloped viruses with a genome of a single strand of positive -sense RNA. The total genome length ranges between 11,000 and 12,000 nucleotides, and the genome resembles mRNA with a 5' cap and a 3' poly-A tail. The four non- structural protein genes are encoded in the 5' two-thirds of the genome, while the three structural proteins are translated from a subgenomic mRNA colinear with the 3' one-third of the genome. There are two open reading frames (ORFs) in the genome, nonstructural and structural. The first is non- structural and encodes proteins (nsPl-nsP4) necessary for transcription and replication of viral RNA. The second encodes three structural proteins: the core nucleocapsid protein C, and the envelope proteins P62 and El.

[0166] In some embodiments of any of the aspects, the saRNAs described herein do not comprise structural proteins derived from at least one alphavirus. In some embodiments of any of the aspects, the saRNAs described herein do not comprise capsid or envelope proteins derived from at least one alphavirus.

[0167] In some embodiments, chemical modifications (e.g., modified bases) may be introduced into the saRNA containing the ARES region(s) (e.g., in the sense direction) such that the modification disrupts the function of the ribozyme and ensures the complete saRNA is delivered into the cell without any ribozyme cleavage. As the saRNA is replicated in the cell, the RdRp will eventually synthesize positive sense saRNA copies that do not comprise chemical modifications (e.g., modified bases) and contain an active ribozyme so that the ARES regulatory functions are activated. Nonlimiting examples of such modified bases include 5 -hydroxymethylcytidine, 5 -methylcytidine, and / or 5 -methyluridine.

[0168] In some embodiments, the saRNA comprises a sequence selected from Table 11 (Exemplary saRNA sequences).

[0169] In some embodiments, the saRNA comprises one of SEQ ID NOs: 377-393 or a nucleic acid sequence that is at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least98%, or at least 99% identical to one of SEQ ID NOs: 377-393, which maintains its function (e.g., self-amplification; ARES region function), or a functional fragment thereof.Nucleic Acids and Vectors

[0170] Described herein in multiple aspects are RNA molecules comprising at least one ARES region, which regulates the translation of at least one cargo polypeptide (also referred to herein as “payload” or “gene”) encoded in a ORF of the RNA molecule. In some embodiments, the RNA molecule comprises at least one open reading frame (ORF; e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more ORFs, which can be the same or different ORFs). In some embodiments, each ORF encodes at least one cargo polypeptide (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, or more cargo polypeptides, which can be the same or different cargo polypeptides).

[0171] It is contemplated herein that any cargo polypeptide known or to be discovered can be encoded by the at least one ORF of the RNA molecule. In some embodiments, the cargo polypeptide is an enzyme, a structural protein, or an immune protein. Further non-limiting examples of such cargo polypeptides include: a) a detectable marker (e.g., a fluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anti-claudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti-cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti- glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL-12, OX40L, IL-23); d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a sitespecific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like); h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon-like peptide-1, insulin); or i) an oncogene (e.g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF).

[0172] In some embodiments, the RNA molecule described herein is a messenger RNA (mRNA) molecule. In some embodiments, the RNA molecule described herein comprises a 5' cap (e.g., a 7- methylguanylate cap). In some embodiments, the RNA molecule described herein comprises a 3' polyA (i.e., polyadenylated) tail. The 5' cap and the 3' polyA tail help to increase the stabilization of the RNA molecule, increase the RNA molecule’s transport from the nucleus into the cytoplasm, and help to allow the RNA molecule to be translated by a ribosome during protein synthesis.

[0173] In some embodiments, the RNA molecules described herein can be encoded and / or expressed by nucleic acids and / or vectors. Accordingly, in one aspect described herein is a nucleic acid (e.g., a polynucleotide) encoding or comprising an RNA molecule as described herein. In another aspect described herein is a vector encoding or comprising an RNA molecule as described herein.

[0174] In some embodiments of any of the aspects, the nucleic acid encoding or comprising an RNA molecule as described herein comprises DNA. In some embodiments of any of the aspects, the nucleic acid encoding an RNA molecule as described herein consists essentially of DNA. In some embodiments of any of the aspects, the nucleic acid encoding an RNA molecule as described herein consists of DNA.

[0175] In some embodiments of any of the aspects, a DNA molecule encoding an RNA molecule as described herein comprises at least one regulatory sequence upstream of the encoded RNA molecule. In some embodiments of any of the aspects, a DNA molecule encoding an RNA molecule as described herein comprises a promoter for transcription of the RNA molecule using an RNA polymerase. In some embodiments of any of the aspects, a DNA molecule encoding an RNA molecule as described herein comprises a T7 promoter.

[0176] When the nucleic acid molecule that encodes any of the RNA molecules described herein is expressed in a cell, a variety of transcription control sequences (e.g., promoter / enhancer sequences) can be used to direct its expression. The promoter can be a native promoter, e.g., the promoter of the at least one cargo polypeptide in its endogenous context, which provides normal regulation of expression of the cargo polypeptide. In some embodiments the promoter can be constitutive, i.e., the promoter is unregulated allowing for continual transcription of the RNA molecule. A variety of conditional promoters also can be used, such as promoters controlled by the presence or absence of a molecule.

[0177] The precise nature of the regulatory sequences needed for expression can vary between species or cell types, but in general can include, as necessary, 5' non-transcribed and 5' non-translated sequences involved with the initiation of transcription and translation respectively, such as a TATA box, capping sequence, CAAT sequence, and the like. In particular, such 5' non-transcribed regulatory sequences can include a promoter region which includes a promoter sequence for transcriptional control of the encoded RNA molecule. Regulatory sequences can also include enhancer sequences or upstream activator sequences as desired.

[0178] As used herein, an RNA-encoding sequence and regulatory sequences are said to be “operably” joined when they are covalently linked in such a way as to place the transcription of the RNA-encoding sequence under the influence or control of the regulatory sequences. If it is desired that at least one cargo polypeptide encoded in the RNA molecule be translated into a functional protein, two DNA sequences are said to be operably joined if induction of a promoter in the 5' regulatory sequences results in the transcription of the RNA molecule and if the nature of the linkagebetween the two DNA sequences does not (1) result in the introduction of a frame-shift mutation, (2) interfere with the ability of the promoter region to direct the transcription of the RNA molecule, or (3) interfere with the ability of the at least one cargo polypeptide encoded in the RNA molecule to be translated into a protein.

[0179] A nucleic acid molecule that encodes an RNA molecule as described herein can be introduced into a cell or cells using methods and techniques that are standard in the art. For example, nucleic acid molecules can be introduced by standard protocols such as transformation including chemical transformation and electroporation, transduction, particle bombardment, etc. Expressing the nucleic acid molecule encoding an RNA molecule as described herein can also be accomplished by integrating the nucleic acid molecule into the genome.

[0180] In some embodiments, one or more of the RNA molecules described herein is expressed in a recombinant expression vector or plasmid. As used herein, the term "vector" refers to a polynucleotide sequence suitable for transferring nucleic acids (e.g., RNA molecules as described herein) into a host cell. The vector can encompass any genetic element that is capable of replication when associated with the proper control elements and that can transfer nucleic acid sequences to cells. The term “vector” includes a plasmid, a cloning vector, an expression vector, naked DNA, a mini-chromosome, a chromosome, a transposon, a cosmid, a virus, virion, phage, and the like. See, for example, U.S. Pat. Nos. 4,980,285; 5,631,150; 5,707,828; 5,759,828; 5,888,783 and, 5,919,670, and, Sambrook et al, Molecular Cloning: A Laboratory Manual, 2nd Ed., Cold Spring Harbor Press (1989). One type of vector is a "plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments are ligated. Another type of vector is a viral vector, wherein additional DNA segments are ligated into the viral genome. Certain vectors are capable of autonomous replication in a host cell into which they are introduced (e.g., bacterial vectors having a bacterial origin of replication and episomal mammalian vectors). Moreover, certain vectors are capable of directing the expression of encoded RNA molecules to which they are operatively linked. Such vectors are referred to herein as "expression vectors". In general, expression vectors of utility in recombinant DNA techniques are often in the form of plasmids. In the present specification, "plasmid" and "vector" are used interchangeably as the plasmid is the most commonly used form of vector. However, the technology is intended to include such other forms of expression vectors, such as viral vectors (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), which serve equivalent functions.

[0181] In some embodiments of any of the aspects, the vector is recombinant, e.g., it comprises sequences originating from at least two different sources. In some embodiments of any of the aspects, the vector comprises sequences originating from at least two different species. In some embodiments of any of the aspects, the vector comprises sequences originating from at least two different genes, e.g., it comprises a fusion protein or a nucleic acid encoding an expression product which is operablylinked to at least one non-native (e.g., heterologous) genetic control element (e.g., a promoter, suppressor, activator, enhancer, response element, or the like).

[0182] In some embodiments of any of the aspects, the vector or nucleic acid described herein is codon-optimized, e.g., the native or wild-type sequence of the nucleic acid sequence has been altered or engineered to include alternative codons such that altered or engineered nucleic acid encodes the same polypeptide expression product as the native / wild-type sequence, but will be transcribed and / or translated at an improved efficiency in a desired expression system. In some embodiments of any of the aspects, the expression system is an organism other than the source of the native / wild-type sequence (or a cell obtained from such organism). In some embodiments of any of the aspects, the vector and / or nucleic acid sequence described herein is codon-optimized for expression in a mammal or mammalian cell, e.g., a mouse, a murine cell, or a human cell. In some embodiments of any of the aspects, the vector and / or nucleic acid sequence described herein is codon-optimized for expression in a human cell. In some embodiments of any of the aspects, the vector and / or nucleic acid sequence described herein is codon-optimized for expression in a yeast or yeast cell. In some embodiments of any of the aspects, the vector and / or nucleic acid sequence described herein is codon-optimized for expression in a bacterial cell. In some embodiments of any of the aspects, the vector and / or nucleic acid sequence described herein is codon-optimized for expression in an E. coli cell.

[0183] A cloning vector is one which is able to replicate autonomously or integrated in the genome in a host cell, and which is further characterized by one or more endonuclease restriction sites at which the vector can be cut in a determinable fashion and into which a desired DNA sequence (e.g., encoding an RNA molecule as described herein) can be ligated such that the new recombinant vector retains its ability to replicate in the host cell. In the case of plasmids, replication of the desired sequence can occur many times as the plasmid increases in copy number within the host cell such as a host bacterium or just a single time per host before the host reproduces by mitosis. In the case of phage, replication can occur actively during a lytic phase or passively during a lysogenic phase.

[0184] An expression vector is one into which a desired DNA sequence (e.g., encoding an RNA molecule as described herein) can be inserted by restriction and ligation such that it is operably joined to regulatory sequences and can be expressed as an RNA molecule. Vectors can further contain one or more marker sequences suitable for use in the identification of cells which have or have not been transformed or transformed or transfected with the vector. Markers include, for example, genes encoding proteins which increase or decrease either resistance or sensitivity to antibiotics or other compounds (e.g., ampicillin resistance), genes which encode enzymes whose activities are detectable by standard assays known in the art (e.g., [3-galactosidase, luciferase or alkaline phosphatase), and genes which visibly affect the phenotype of transformed or transfected cells, hosts, colonies or plaques (e.g., green fluorescent protein). In certain embodiments, the vectors used herein are capable of autonomous replication and expression of the RNA molecules present in the DNA segments towhich they are operably joined. The sequences expressed will often, but not necessarily, be heterologous to the cell. An expression vector may comprise additional elements, for example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in human cells for expression and in a prokaryotic host for cloning and amplification.

[0185] Expression vectors containing all the necessary elements for expression are commercially available and known to those skilled in the art. See, e.g., Sambrook et al., Molecular Cloning: A Laboratory Manual, Second Edition, Cold Spring Harbor Laboratory Press, 1989. Cells are genetically engineered by the introduction into the cells of heterologous DNA (or RNA). That heterologous DNA (or RNA) is placed under operable control of transcriptional elements to permit the expression of the heterologous DNA in the host cell.

[0186] As used herein, the term “viral vector" refers to a nucleic acid vector construct that includes at least one element of viral origin and has the capacity to be packaged into a viral vector particle. The viral vector can contain the nucleic acid encoding a polypeptide as described herein in place of non-essential viral genes. The vector and / or particle may be utilized for the purpose of transferring any nucleic acids into cells either in vitro or in vivo. Numerous forms of viral vectors are known in the art. Non-limiting examples of a viral vector of this invention include an AAV vector, an adenovirus vector, a lentivirus vector, a retrovirus vector, a herpesvirus vector, an alphavirus vector, a poxvirus vector, a baculovirus vector, and a chimeric virus vector.

[0187] It should be understood that the vectors described herein can, in some embodiments, be combined with other suitable compositions and therapies. In some embodiments, the vector is episomal. The use of a suitable episomal vector provides a means of maintaining the nucleic acid of interest (e.g., RNA molecules as described herein) in the subject in high copy number extra chromosomal DNA thereby eliminating potential effects of chromosomal integration.Nucleic Acid Modifications

[0188] In some embodiments of any of the aspects, a nucleic acid (e.g., an RNA molecule as described herein, or a DNA molecule encoding such an RNA molecule) is chemically modified to enhance stability or other beneficial characteristics. The nucleic acids described herein may be synthesized and / or modified by methods well established in the art, such as those described in “Current protocols in nucleic acid chemistry,” Beaucage, S.L. et al. (Edrs.), John Wiley & Sons, Inc., New York, NY, USA, which is hereby incorporated herein by reference. Modifications include, for example, (a) end modifications, e.g., 5’ end modifications (phosphorylation, conjugation, inverted linkages, etc.) 3’ end modifications (conjugation, DNA nucleotides, inverted linkages, etc.), (b) base modifications, e.g., replacement with stabilizing bases, destabilizing bases, or bases that base pair with an expanded repertoire of partners, removal of bases (abasic nucleotides; 1’, 2 ’-dideoxyriboseabasic nucleotides), or conjugated bases, (c) sugar modifications (e.g., at the 2’ position or 4’ position) or replacement of the sugar, as well as (d) backbone modifications, including modification or replacement of the phosphodiester linkages. Specific examples of nucleic acid compounds useful in the embodiments described herein include, but are not limited to nucleic acids containing modified backbones or no natural intemucleoside linkages, nucleic acids having modified backbones include, among others, those that do not have a phosphorus atom in the backbone. For the purposes of this specification, and as sometimes referenced in the art, modified nucleic acids that do not have a phosphorus atom in their intemucleoside backbone can also be considered to be oligonucleosides. In some embodiments of any of the aspects, the modified nucleic acid will have a phosphorus atom in its intemucleoside backbone.

[0189] Modified nucleic acid backbones can include, for example, phosphorothioates, chiral phosphorothioates, phosphorodithioates, phosphotriesters, aminoalkylphosphotriesters, methyl and other alkyl phosphonates including 3'-alkylene phosphonates and chiral phosphonates, phosphinates, phosphoramidates including 3'-amino phosphoramidate and aminoalkylphosphoramidates, thionophosphoramidates, thionoalkylphosphonates, thionoalkylphosphotriesters, and boranophosphates having normal 3'-5' linkages, 2'-5' linked analogs of these, and those) having inverted polarity wherein the adjacent pairs of nucleoside units are linked 3'-5' to 5'-3' or 2'-5' to 5'-2'. Various salts, mixed salts and free acid forms are also included. Modified nucleic acid backbones that do not include a phosphorus atom therein have backbones that are formed by short chain alkyl or cycloalkyl intemucleoside linkages, mixed heteroatoms and alkyl or cycloalkyl intemucleoside linkages, or one or more short chain heteroatomic or heterocyclic intemucleoside linkages. These include those having morpholino linkages (formed in part from the sugar portion of a nucleoside); siloxane backbones; sulfide, sulfoxide and sulfone backbones; formacetyl and thioformacetyl backbones; methylene formacetyl and thioformacetyl backbones; alkene containing backbones; sulfamate backbones; methyleneimino and methylenehydrazino backbones; sulfonate and sulfonamide backbones; amide backbones; others having mixed N, O, S and CH2 component parts, and oligonucleosides with heteroatom backbones, and in particular — CH2— NH— CH2— , — CH2— N(CH3)—O—CH2— [known as a methylene (methylimino) or MMI backbone], — CH2— 0--N(CH3)— CH2-, — CH2— N(CH3)— N(CH3)— CH2— and -N(CH3)-CH2-CH2-[wherein the native phosphodiester backbone is represented as — O— P— O— CH2— ] .

[0190] In other nucleic acid mimetics, both the sugar and the intemucleoside linkage, i.e., the backbone, of the nucleotide units are replaced with novel groups. The base units are maintained for hybridization with an appropriate nucleic acid target compound. One such oligomeric compound, an RNA mimetic that has been shown to have excellent hybridization properties, is referred to as a peptide nucleic acid (PNA). In PNA compounds, the sugar backbone of an RNA is replaced with an amide containing backbone, in particular an aminoethylglycine backbone. The nucleobases areretained and are bound directly or indirectly to aza nitrogen atoms of the amide portion of the backbone.

[0191] The nucleic acid can also be modified to include one or more locked nucleic acids (LNA). A locked nucleic acid is a nucleotide having a modified ribose moiety in which the ribose moiety comprises an extra bridge connecting the 2' and 4' carbons. This structure effectively "locks" the ribose in the 3'-endo structural conformation. The addition of locked nucleic acids to siRNAs has been shown to increase siRNA stability in serum, and to reduce off-target effects (Elmen, J. et al., (2005) Nucleic Acids Research 33(l):439-447; Mook, OR. et al., (2007) Mol. Cane. Ther. 6(3):833-843; Grunweller, A. et al., (2003) Nucleic Acids Research 31(12):3185-3193).

[0192] Modified nucleic acids can also contain one or more substituted sugar moieties. The nucleic acids described herein can include one of the following at the 2' position: OH; F; O-, S-, or N- alkyl; O-, S-, or N-alkenyl; O-, S- or N-alkynyl; or O-alkyl-O-alkyl, wherein the alkyl, alkenyl and alkynyl may be substituted or unsubstituted Cl to CIO alkyl or C2 to CIO alkenyl and alkynyl. Exemplary suitable modifications include O[(CH2)nO] mCH3, O(CH2)nOCH3, O(CH2)nNH2, O(CH2) nCH3, O(CH2)nONH2, and O(CH2)nON[(CH2)nCH3)]2, where n and m are from 1 to about 10. In some embodiments of any of the aspects, nucleic acids include one of the following at the 2' position: Cl to CIO lower alkyl, substituted lower alkyl, alkaryl, aralkyl, O-alkaryl or O-aralkyl, SH, SCH3, OCN, Cl, Br, CN, CF3, OCF3, SOCH3, SO2CH3, ONO2, NO2, N3, NH2, heterocycloalkyl, heterocycloalkaryl, aminoalkylamino, polyalkylamino, substituted silyl, an RNA cleaving group, a reporter group, an intercalator, a group for improving the pharmacokinetic properties of a nucleic acid, or a group for improving the pharmacodynamic properties of a nucleic acid, and other substituents having similar properties. In some embodiments of any of the aspects, the modification includes a 2' methoxyethoxy (2'-O— CH2CH2OCH3, also known as 2'-O-(2- methoxyethyl) or 2'-M0E) (Martin et al., Helv. Chim. Acta, 1995, 78:486-504) i.e., an alkoxy-alkoxy group. Another exemplary modification is 2'-dimethylaminooxyethoxy, i.e., a O(CH2)2ON(CH3)2 group, also known as 2'-DMAOE, as described in examples herein below, and 2'- dimethylaminoethoxyethoxy (also known in the art as 2'-O-dimethylaminoethoxyethyl or 2'- DMAEOE), i.e., 2'-O— CH2— O— CH2— N(CH2)2, also described in examples herein below.

[0193] Other modifications include 2'-methoxy (2'-OCH3), 2'-aminopropoxy (2'- OCH2CH2CH2NH2) and 2'-fluoro (2'-F). Similar modifications can also be made at other positions on the nucleic acid, particularly the 3' position of the sugar on the 3' terminal nucleotide or in 2'-5' linked dsRNAs and the 5' position of 5' terminal nucleotide. Nucleic acids may also have sugar mimetics such as cyclobutyl moieties in place of the pentofiiranosyl sugar.

[0194] A nucleic acid can also include nucleobase (often referred to in the art simply as “base”) modifications or substitutions. As used herein, “unmodified” or “natural” or “canonical” nucleobases include the purine bases adenine (A) and guanine (G), and the pyrimidine bases thymine (T), cytosine(C) and uracil (U). Modified or “non-canonical” nucleobases can include other synthetic and natural nucleobases including but not limited to as inosine, isocytosine, isoguanine, 5 -methylcytosine (5-me- C), 5 -hydroxymethyl cytosine, xanthine, hypoxanthine, 2-aminoadenine, 6-methyl and other alkyl derivatives of adenine and guanine, 2-propyl and other alkyl derivatives of adenine and guanine, 2- thiouracil, 2-thiothymine and 2-thiocytosine, 5-halouracil and cytosine, 5-propynyl uracil and cytosine, 6-azo uracil, cytosine and thymine, 5-uracil (pseudouracil), 4-thiouracil, 8-halo, 8-amino, 8- thiol, 8-thioalkyl, 8-hydroxyl anal other 8-substituted adenines and guanines, 5-halo, particularly 5- bromo, 5 -trifluoromethyl and other 5 -substituted uracils and cytosines, 7-methylguanine and 7- methyladenine, 8-azaguanine and 8-azaadenine, 7-deazaguanine and 7-daazaadenine and 3- deazaguanine and 3 -deazaadenine. Certain of these nucleobases are particularly useful for increasing the binding affinity of the inhibitory nucleic acids featured in the invention. These include 5- substituted pyrimidines, 6-azapyrimidines and N-2, N-6 and 0-6 substituted purines, including 2- aminopropyladenine, 5-propynyluracil and 5-propynylcytosine. 5 -methylcytosine substitutions have been shown to increase nucleic acid duplex stability by 0.6-1.2°C (Sanghvi, Y. S., Crooke, S. T. and Lebleu, B., Eds., dsRNA Research and Applications, CRC Press, Boca Raton, 1993, pp. 276-278) and are exemplary base substitutions, even more particularly when combined with 2'-O-methoxyethyl sugar modifications. In some embodiments of any of the aspects, modified nucleobases can include d5SICS and dNAM, which are a non-limiting example of unnatural nucleobases that can be used separately or together as basepairs (see e.g., Leconte et. al. J. Am. Chem. Soc.2008, 130, 7, 2336- 2343; Malyshev et. al. PNAS. 2012. 109 (30) 12005-12010). In some embodiments of any of the aspects, the nucleic acid comprises any modified nucleobases known in the art, i.e., any nucleobase that is modified from an unmodified and / or natural nucleobase.

[0195] The preparation of the modified nucleic acids, backbones, and nucleobases described above are well known in the art.

[0196] Another modification of a nucleic acid featured in the invention involves chemically linking to the nucleic acid to one or more ligands, moieties or conjugates that enhance the activity, cellular distribution, pharmacokinetic properties, or cellular uptake of the nucleic acid. Such moieties include but are not limited to lipid moieties such as a cholesterol moiety (Letsinger et al., Proc. Natl. Acid. Sci. USA, 1989, 86: 6553-6556), cholic acid (Manoharan et al., Biorg. Med. Chem. Let., 1994, 4: 1053-1060), a thioether, e.g., beryl-S-tritylthiol (Manoharan et al., Ann. N.Y. Acad. Sci., 1992, 660:306-309; Manoharan et al., Biorg. Med. Chem. Let., 1993, 3:2765-2770), a thiocholesterol (Oberhauser et al., Nucl. Acids Res., 1992, 20:533-538), an aliphatic chain, e.g., dodecandiol or undecyl residues (Saison-Behmoaras et al., EMBO J, 1991, 10: 1111-1118; Kabanov et al., LEBS Lett., 1990, 259:327-330; Svinarchuk et al., Biochimie, 1993, 75:49-54), a phospholipid, e.g., dihexadecyl -rac-glycerol or triethyl -ammonium l,2-di-O-hexadecyl-rac-glycero-3 -phosphonate (Manoharan et al., Tetrahedron Lett., 1995, 36:3651-3654; Shea et al., Nucl. Acids Res., 1990,18:3777-3783), a polyamine or a polyethylene glycol chain (Manoharan et al., Nucleosides & Nucleotides, 1995, 14:969-973), or adamantane acetic acid (Manoharan et al., Tetrahedron Lett., 1995, 36:3651-3654), a palmityl moiety (Mishra et al., Biochim. Biophys. Acta, 1995, 1264:229-237), or an octadecylamine or hexylamino-carbonyloxycholesterol moiety (Crooke et al., J. Pharmacol. Exp. Then, 1996, 277:923-937).Combinations, Cells, and Compositions

[0197] In multiple aspects, described herein are combinations of RNA molecules and target proteins. For example, in one aspect, described herein is a combination comprising: (a) an RNA molecule comprising at least one ARES region that comprises an MS2 aptamer, and (b) MCP. In one aspect, described herein is a combination comprising: (a) an RNA molecule comprising at least one ARES region that comprises an PP7 aptamer, and (b) PCP. In one aspect, described herein is a combination comprising: (a) an RNA molecule comprising at least one ARES region that comprises a BIV Tar aptamer, and (b) BIV Tat protein. In one aspect, described herein is a combination comprising: (a) an RNA molecule comprising at least one ARES region that comprises an P22 aptamer, and (b) a P22 N protein. In embodiments where the RNA molecule comprises a plurality of ARES regions, each with a different associated target protein, the combination can thus comprise at least one of the associated target proteins (see e.g., Table 8). In some embodiments, the RNA molecule in such a combination is an saRNA as described herein.

[0198] In some embodiments, the target protein is linked (e.g., covalently, with or with a linker peptide, such as a glycine -serine linker peptide) to a polypeptide of interest. In some embodiments, the polypeptide of interest increases the steric hindrance of the target protein when it specifically binds to the aptamer, e.g., to increase inhibition of the function of a nearby ribozyme (e.g., to decrease the self-cleaving function of a nearby ribozyme in the ARES region). In some embodiments, the polypeptide of interest is an inert polypeptide, e.g., it is not an enzyme, or does not exhibit a function other than its steric hindrance. In some embodiments, the polypeptide of interest (e.g., linked to the target protein) comprises Maltose Binding Peptide (MBP). For example, in some embodiments, the polypeptide of interest linked to the target protein comprises MBP-MCP, MBP-PCP, MBP-BIV tat, or MBP-P22N. In some embodiments, the polypeptide of interest (e.g., linked to the target protein) comprises adenosine deaminase acting on RNA (ADAR). For example, in some embodiments, the polypeptide of interest linked to the target protein comprises ADAR-MCP, ADAR-PCP, ADAR-BIV tat, or ADAR-P22N.

[0199] In some embodiments, any polypeptide known or to be discovered can be linked to the target protein. In some embodiments, the polypeptide of interest, which is linked to the target protein, is an enzyme, a structural protein, or an immune protein. Further non-limiting examples of such a polypeptide of interest, which is linked to the target protein, include: a) a detectable marker (e.g., afluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS- CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anti-claudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti -cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti-glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL- 12, OX40L, IL-23); d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a site-specific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like); h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon-like peptide-1, insulin); or i) an oncogene (e.g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF).

[0200] In some embodiments, RNA molecules, target proteins, and combinations thereof, described herein can be comprised by cells, such as eukaryotic cells. In some embodiments, the RNA molecule in such a cell is an saRNA as described herein. The RNA molecules, target proteins, and combinations thereof, or cells comprising such RNA molecules, target proteins, and combinations thereof, can be comprised by compositions, such as pharmaceutical compositions, as described further herein. In some embodiments, the RNA molecule in such a composition is an saRNA as described herein.

[0201] In one aspect described herein is a pharmaceutical composition comprising an RNA molecule as described herein and a pharmaceutically acceptable carrier. In one aspect described herein is a pharmaceutical composition comprising an RNA molecule as described herein, a target protein as described herein, and a pharmaceutically acceptable carrier. In one aspect described herein is a pharmaceutical composition comprising a nucleic acid or vector comprising or expressing an RNA molecule as described herein and a pharmaceutically acceptable carrier. In one aspect described herein is a pharmaceutical composition comprising a cell comprising or expressing an RNA molecule as described herein and a pharmaceutically acceptable carrier. In some embodiments, the RNA molecule in such a pharmaceutical composition is an saRNA as described herein. In some embodiments, a pharmaceutical composition comprising a target protein as described herein is provided in a separate administration than the pharmaceutical composition comprising an RNA molecule as described herein; the two pharmaceutical compositions can be provided contemporaneously or at different times.Formulations

[0202] In some embodiments, the technology described herein relates to a pharmaceutical composition comprising an RNA molecule as described herein, and optionally a pharmaceutically acceptable carrier. In some embodiments, the active ingredients of the pharmaceutical composition comprise an RNA molecule as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of an RNA molecule as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of an RNA molecule as described herein.

[0203] In some embodiments, the technology described herein relates to a pharmaceutical composition comprising a target protein as described herein, and optionally a pharmaceutically acceptable carrier. In some embodiments, the active ingredients of the pharmaceutical composition comprise a target protein as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist essentially of a target protein as described herein. In some embodiments, the active ingredients of the pharmaceutical composition consist of a target protein as described herein.

[0204] Pharmaceutically acceptable carriers and diluents include saline, aqueous buffer solutions, solvents and / or dispersion media. The use of such carriers and diluents is well known in the art. Some non-limiting examples of materials which can serve as pharmaceutically-acceptable carriers include: (1) sugars, such as lactose, glucose and sucrose; (2) starches, such as com starch and potato starch; (3) cellulose, and its derivatives, such as sodium carboxymethyl cellulose, methylcellulose, ethyl cellulose, microcrystalline cellulose and cellulose acetate; (4) powdered tragacanth; (5) malt; (6) gelatin; (7) lubricating agents, such as magnesium stearate, sodium lauryl sulfate and talc; (8) excipients, such as cocoa butter and suppository waxes; (9) oils, such as peanut oil, cottonseed oil, safflower oil, sesame oil, olive oil, com oil and soybean oil; (10) glycols, such as propylene glycol; (11) polyols, such as glycerin, sorbitol, mannitol and polyethylene glycol (PEG); (12) esters, such as ethyl oleate and ethyl laurate; (13) agar; (14) buffering agents, such as magnesium hydroxide and aluminum hydroxide; (15) alginic acid; (16) pyrogen-free water; (17) isotonic saline; (18) Ringer's solution; (19) ethyl alcohol; (20) pH buffered solutions; (21) polyesters, polycarbonates and / or polyanhydrides; (22) bulking agents, such as polypeptides and amino acids; (23) serum component, such as serum albumin, HDL and LDL; (24) C2-C12 alcohols; and (25) other non-toxic compatible substances employed in pharmaceutical formulations. Wetting agents, coloring agents, release agents, coating agents, sweetening agents, flavoring agents, perfuming agents, preservative and antioxidants can also be present in the formulation. The terms such as "excipient", "carrier", "pharmaceutically acceptable carrier" or the like are used interchangeably herein. In some embodiments, the carrier inhibits the degradation of the active agent, e.g. RNA molecules and / or target proteins as described herein.

[0205] In some embodiments, the pharmaceutical composition comprising RNA molecules and / or target proteins as described herein can be a parenteral dose form (i.e., administered or occurring elsewhere in the body than the mouth and alimentary canal). Since administration of parenteral dosage forms typically bypasses the patient's natural defenses against contaminants, parenteral dosage forms are preferably sterile or capable of being sterilized prior to administration to a patient. Examples of parenteral dosage forms include, but are not limited to, solutions ready for injection, dry products ready to be dissolved or suspended in a pharmaceutically acceptable vehicle for injection, suspensions ready for injection, and emulsions.

[0206] Suitable vehicles that can be used to provide parenteral dosage forms of RNA molecules and / or target proteins as disclosed within are well known to those skilled in the art. Non-limiting examples include, without limitation: sterile water; water for injection USP; saline solution; glucose solution; aqueous vehicles such as but not limited to, sodium chloride injection, Ringer's injection, dextrose injection, dextrose and sodium chloride injection, and lactated Ringer's injection; water- miscible vehicles such as, but not limited to, ethyl alcohol, polyethylene glycol, and propylene glycol; and non-aqueous vehicles such as, but not limited to, com oil, cottonseed oil, peanut oil, sesame oil, ethyl oleate, isopropyl myristate, and benzyl benzoate.

[0207] Pharmaceutical compositions comprising RNA molecules and / or target proteins as described herein can also be formulated to be suitable for oral administration, for example as discrete dosage forms, such as, but not limited to, tablets (including without limitation scored or coated tablets), pills, caplets, capsules, chewable tablets, powder packets, cachets, troches, wafers, aerosol sprays, or liquids, such as but not limited to, syrups, elixirs, solutions or suspensions in an aqueous liquid, a nonaqueous liquid, an oil-in-water emulsion, or a water-in-oil emulsion. Such compositions contain a predetermined amount of the pharmaceutically acceptable salt of the disclosed compounds, and may be prepared by methods of pharmacy well known to those skilled in the art. See generally, Remington: The Science and Practice of Pharmacy, 21st Ed., Lippincott, Williams, and Wilkins, Philadelphia PA. (2005).

[0208] In some embodiments of any of the aspects, the RNA molecule and / or target protein as described herein is formulated as lipid nanoparticles (LNP). In some embodiments of any of the aspects, the lipid nanoparticle comprises a targeting moiety, specific for a cell or tissue of interest. As a non-limiting example, the LNP can be conjugated to an antibody. In some embodiments, the LNPs are formulated with a lipid: oligonucleotide weight ratio of about 10: 1. In some embodiments, lipids in the LNPs comprise ionizable lipids, cholesterol, phospholipids, and / or polyethylene glycol lipids, further non-limiting examples of lipids for use in LNP formulations include SM-102, DMG-PEG2K, DOPE, and cholesterol.Dosing

[0209] In some embodiments, the methods described herein comprise administering an effective amount of compositions described herein, e.g. comprising the RNA molecule and / or target protein as described herein, to a subject in order to alleviate a symptom of a disease or disorder. As used herein, "alleviating a symptom of a disease or disorder" is ameliorating any condition or symptom associated with the disease or disorder. As compared with an equivalent untreated control, such reduction is by at least 5%, 10%, 20%, 40%, 50%, 60%, 80%, 90%, 95%, 99% or more as measured by any standard technique. A variety of means for administering the compositions described herein to subjects are known to those of skill in the art.

[0210] In some embodiments of any of the aspects, the RNA molecule is formulated at a dose of about 10 pg to about 1000 pg, about 10 pg to about 100 pg, about 10 pg to about 20 pg, about 20 pg to about 30 pg, about 30 pg to about 40 pg, about 40 pg to about 50 pg, about 50 pg to about 60 pg, about 60 pg to about 70 pg, about 70 pg to about 80 pg, about 80 pg to about 90 pg, about 90 pg to about 100 pg, about 100 pg to about 1000 pg, about 100 pg to about 200 pg, about 200 pg to about 300 pg, about 300 pg to about 400 pg, about 400 pg to about 500 pg, about 500 pg to about 600 pg, about 600 pg to about 700 pg, about 700 pg to about 800 pg, about 800 pg to about 900 pg, or about 900 pg to about 1000 pg; see e.g., Qin et al. “mRNA-based therapeutics: powerful and versatile tools to combat diseases.” Signal Transduct Target Ther. 7(1): 166 (2022). In some embodiments of any of the aspects, the target protein, e.g., if administered to a subject as a non-endogenous protein, is formulated at a dose of about 2x the molar concentration of RNA molecule.

[0211] The term “effective amount" as used herein refers to the amount of RNA molecule and / or target protein needed to alleviate at least one or more symptom of the disease or disorder, and relates to a sufficient amount of pharmacological composition to provide the desired effect. The term "therapeutically effective amount" therefore refers to an amount of RNA molecule and / or target protein that is sufficient to provide a particular alleviating effect when administered to a typical subject. An effective amount as used herein, in various contexts, would also include an amount sufficient to delay the development of a symptom of the disease, alter the course of a symptom disease (for example but not limited to, slowing the progression of a symptom of the disease), or reverse a symptom of the disease. Thus, it is not generally practicable to specify an exact “effective amount". However, for any given case, an appropriate “effective amount" can be determined by one of ordinary skill in the art using only routine experimentation.

[0212] Effective amounts, toxicity, and therapeutic efficacy can be determined by standard pharmaceutical procedures in cell cultures or experimental animals, e.g., for the ED50 (the dose therapeutically effective in 50% of the population). The dosage can vary depending upon the dosage form employed and the route of administration utilized. A therapeutically effective dose can be estimated initially from cell culture assays. Also, a dose can be formulated in animal models to achieve a circulating plasma concentration range that includes the IC50 (z.e., the concentration ofRNA molecule and / or target protein, which achieves a half-maximal inhibition of symptoms) as determined in cell culture, or in an appropriate animal model. Levels in plasma can be measured, for example, by high performance liquid chromatography. The effects of any particular dosage can be monitored by a suitable bioassay. The dosage can be determined by a physician and adjusted, as necessary, to suit observed effects of the treatment.

[0213] The dosage ranges for the administration of RNA molecule and / or target protein, according to the methods described herein depend upon, for example, the form of RNA molecule and / or target protein, its potency, and the extent to which symptoms, markers, or indicators of a disease or disorder are desired to be reduced. The dosage should not be so large as to cause adverse side effects. Generally, the dosage will vary with the age, condition, and sex of the patient and can be determined by one of skill in the art. The dosage can also be adjusted by the individual physician in the event of any complication.

[0214] The efficacy of RNA molecule and / or target protein in, e.g. the treatment of a disease or disorder can be determined by the skilled clinician. However, a treatment is considered “effective treatment," as the term is used herein, if one or more of the signs or symptoms of a disease or disorder are altered in a beneficial manner, other clinically accepted symptoms are improved, or even ameliorated, or a desired response is induced e.g., by at least 10% following treatment according to the methods described herein. Efficacy can be assessed, for example, by measuring a marker, indicator, symptom, and / or the incidence of a disease or disorder treated or any other measurable parameter appropriate. Efficacy can also be measured by a failure of an individual to worsen as assessed by hospitalization, or need for medical interventions (i.e., progression of the disease is halted). Methods of measuring these indicators are known to those of skill in the art and / or are described herein. Treatment includes any treatment of a disease in an individual or an animal (some non-limiting examples include a human or an animal) and includes: (1) inhibiting the disease, e.g., preventing a worsening of symptoms (e.g. pain or inflammation); or (2) relieving the severity of the disease, e.g., causing regression of symptoms. An effective amount for the treatment of a disease means that amount which, when administered to a subject in need thereof, is sufficient to result in effective treatment as that term is defined herein, forthat disease. Efficacy of an agent can be determined by assessing physical indicators of a condition or desired response. It is well within the ability of one skilled in the art to monitor efficacy of administration and / or treatment by measuring any one of such parameters, or any combination of parameters. Efficacy can be assessed in animal models of a disease or disorder. When using an experimental animal model, efficacy of treatment is evidenced when a statistically significant change in a marker is observed.

[0215] With respect to duration and frequency of treatment, it is typical for skilled clinicians to monitor subjects in order to determine when the treatment is providing therapeutic benefit, and todetermine whether to increase or decrease dosage, increase or decrease administration frequency, discontinue treatment, resume treatment, or make other alterations to the treatment regimen.

[0216] In certain embodiments, an effective dose of a composition comprising an RNA molecule and / or target protein as described herein can be administered to a patient once. In certain embodiments, an effective dose of a composition comprising an RNA molecule and / or target protein as described herein can be administered to a patient repeatedly.

[0217] The dosing schedule can vary from once a week to daily depending on a number of clinical factors, such as the subject's sensitivity to the RNA molecule and / or target protein as described herein. The desired dose or amount can be administered at one time or divided into subdoses, e.g., 2-4 subdoses and administered over a period of time, e.g., at appropriate intervals through the day or other appropriate schedule. In some embodiments, administration can be one or more doses and / or treatments daily over a period of weeks or months. Examples of dosing and / or treatment schedules are administration daily, twice daily, three times daily or four or more times daily over a period of 1 week, 2 weeks, 3 weeks, 4 weeks, 1 month, 2 months, 3 months, 4 months, 5 months, or 6 months, or more. A composition comprising an RNA molecule and / or target protein as described herein can be administered over a period of time, such as over a 5 minute, 10 minute, 15 minute, 20 minute, or 25 minute period.

[0218] In some embodiments, after an initial treatment regimen, the treatments can be administered on a less frequent basis. For example, after treatment biweekly for three months, treatment can be repeated once per month, for six months or a year or longer.Administration

[0219] A variety of means for administering the compositions described herein to subjects are known to those of skill in the art. Such methods can include, but are not limited to oral, parenteral, intravenous (IV), intramuscular (IM), subcutaneous (SC), transdermal, airway (aerosol), pulmonary, cutaneous, topical, injection, intraosseous (IO), intraperitoneal (IP), intrarectal, intravaginal, intraarticular (IA), or intratumoral administration. Administration can be local or systemic.

[0220] In some embodiments of any of the aspects, an RNA molecule and / or target protein as described herein is administered as a monotherapy, e.g., another treatment for the disease or disorder is not administered to the subject.

[0221] In some embodiments of any of the aspects, the methods described herein can further comprise administering a second agent and / or treatment to the subject, e.g. as part of a combinatorial therapy. Non-limiting examples of a second agent and / or treatment can include a cancer therapy selected from the group consisting of: radiation therapy, surgery, gemcitabine, cisplatin, paclitaxel, carboplatin, bortezomib, AMG479, vorinostat, rituximab, temozolomide, rapamycin, ABT-737, PI- 103; alkylating agents such as thiotepa and CYTOXAN® cyclophosphamide; alkyl sulfonates such asbusulfan, improsulfan and piposulfan; aziridines such as benzodopa, carboquone, meturedopa, and uredopa; ethylenimines and methylmelamines including altretamine, triethylenemelamine, trietylenephosphoramide, triethylenethiophosphoramide and trimethylol melamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analogue topotecan); bryostatin; callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogues); cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin; duocarmycin (including the synthetic analogues, KW-2189 and CB1-TM1); eleutherobin; pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlomaphazine, cholophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimustine; antibiotics such as the enediyne antibiotics (e.g., calicheamicin, especially calicheamicin gammall and calicheamicin omegall (see, e.g., Agnew, Chem. Inti. Ed. Engl., 33: 183-186 (1994)); dynemicin, including dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomycins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, caminomycin, carzinophilin, chromomycins, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo- L-norleucine, ADRIAMYCIN® doxorubicin (including morpholino-doxorubicin, cyanomorpholinodoxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, potfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5 -fluorouracil (5-FU); folic acid analogues such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone; aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil; bisantrene; edatraxate; defofamine; demecolcine; diaziquone; elformithine; elliptinium acetate; an epothilone; etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol; nitraerine; pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide; procarbazine; PSK® polysaccharide complex (JHS Natural Products, Eugene, Oreg.); razoxane; rhizoxin; sizofuran; spirogermanium; tenuazonic acid; triaziquone; 2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol; mitolactol; pipobroman; gacytosine; arabinoside ("Ara-C");cyclophosphamide; thiotepa; taxoids, e.g., TAXOL® paclitaxel (Bristol-Myers Squibb Oncology, Princeton, N.J.), ABRAXANE® Cremophor-free, albumin-engineered nanoparticle formulation of paclitaxel (American Pharmaceutical Partners, Schaumberg, Ill.), and TAXOTERE® doxetaxel (Rhone-Poulenc Rorer, Antony, France); chloranbucil; GEMZAR® gemcitabine; 6-thioguanine; mercaptopurine; methotrexate; platinum analogs such as cisplatin, oxaliplatin and carboplatin; vinblastine; platinum; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine; NAVELBINE® vinorelbine; novantrone; teniposide; edatrexate; daunomycin; aminopterin; xeloda; ibandronate; irinotecan (Camptosar, CPT-11) (including the treatment regimen of irinotecan with 5-FU and leucovorin); topoisomerase inhibitor RFS 2000; difluoromethylomithine (DMFO); retinoids such as retinoic acid; capecitabine; combretastatin; leucovorin (LV); oxaliplatin, including the oxaliplatin treatment regimen (FOLFOX); lapatinib (Tykerb®); inhibitors of PKC -alpha, Raf, H-Ras, EGFR (e.g., erlotinib (Tarceva®)) and VEGF-A that reduce cell proliferation (e.g., pazopanib, sunitinib, sorafenib, regorafenib, cabozantinib, lenvatinib, ponatinib, ziv-aflibercept, axitinib, tivozanib, vandetanib, ramucirumab); and pharmaceutically acceptable salts, acids or derivatives of any of the above.

[0222] In some embodiments of any of the aspects, the cancer treatment method further comprises administering an immune checkpoint inhibitor. In some embodiments of any of the aspects, the immune checkpoint inhibitor comprises an immune checkpoint inhibitor antibody. In some embodiments of any of the aspects, the checkpoint inhibitor immunotherapy is an inhibitor of a checkpoint molecule selected from the group consisting of: programmed cell death 1 (PD-1), programmed death-ligand 1 (PD-L1), cytotoxic T-lymphocyte-associated protein 4 (CTLA-4), Adenosine A2A receptor (A2AR), CD276, CD39, CD73, B7 family immune checkpoint molecules, V-set domain-containing T-cell activation inhibitor 1 (B7H4), B and T Lymphocyte Attenuator (BTLA), Indoleamine 2,3 -dioxygenase (IDO), Killer-cell Immunoglobulin-like Receptor (KIR), Lymphocyte Activation Gene-3 (LAG-3), nicotinamide adenine dinucleotide phosphate NADPH oxidase isoform 2 (NOX2), T-cell Immunoglobulin domain and Mucin domain 3 (TIM-3), T cell immunoreceptor with Ig and ITIM domains (TIGIT), V-domain Ig suppressor of T cell activation (VISTA), and Sialic acid-binding immunoglobulin-type lectin 7 (SIGLEC7).

[0223] Non-limiting examples of immune checkpoint inhibitors (ICIs) include: pembrolizumab (Keytruda®), nivolumab (Opdivo®), cemiplimab (Libtayo®), spartalizumab, camrelizumab (AiRuiKa™), sintilimab (TYVYT®), tislelizumab, toripalimab (Tuoyi™), dostarlimab (JEMPERLI), INCMGA00012, AMP -224, AMP-514 (MEDI0608), atezolizumab (Tecentriq®), avelumab (Bavencio®), envafolimab (KN035), cosibelimab (CK-301), AUNP12, CA-170, BMS-986189, BMS- 936559 (MDX-1105), durvalumab (IMFINZI®), tremelimumab, and ipilimumab (Yervoy®). See e.g., US Patents US5811097, US5855887, US6051227, US6682736, US6984720, US7595048, US7605238, US7943743, US8008449, US8217149, US8354509, US8383796, US8728474,US8735553, US8779105, US8779108, US8907053, US8900587, US8952136, US9067999, US9073994, US9683048, US9987500, US10160736, US10316089, US10441655, US10590199, US11225522, US Patent Publication US2014341917; Storz et al., MAbs. 2016 Jan; 8(1): 10-26; the contents of each of which are incorporated herein by reference in their entireties.

[0224] One of skill in the art can readily identify a chemotherapeutic agent of use (e.g. seePhysicians' Cancer Chemotherapy Drug Manual 2014, Edward Chu, Vincent T. DeVita Jr., Jones & Bartlett Learning; Principles of Cancer Therapy, Chapter 85 in Harrison's Principles of Internal Medicine, 18th edition; Therapeutic Targeting of Cancer Cells: Era of Molecularly Targeted Agents and Cancer Pharmacology, Chs. 28-29 in Abeloff s Clinical Oncology, 2013 Elsevier; and Fischer D S (ed): The Cancer Chemotherapy Handbook, 4th ed. St. Louis, Mosby-Year Book, 2003).

[0225] In addition, the methods of treatment can further include the use of radiation or radiation therapy. Further, the methods of treatment can further include the use of surgical treatments.

[0226] The methods described herein can further comprise administering a second agent and / or treatment to the subject, e.g. as part of a combinatorial therapy. By way of non-limiting example, if a subject is to be treated for pain or inflammation according to the methods described herein, the subject can also be administered a second agent and / or treatment known to be beneficial for subjects suffering from pain or inflammation. Examples of such agents and / or treatments include, but are not limited to, non-steroidal anti-inflammatory drugs (NSAIDs - such as aspirin, ibuprofen, or naproxen); corticosteroids, including glucocorticoids (e.g. cortisol, prednisone, prednisolone, methylprednisolone, dexamethasone, betamethasone, triamcinolone, and beclometasone); methotrexate; sulfasalazine; leflunomide; anti-TNF medications; cyclophosphamide; pro-resolving drugs; my cophenolate; or opiates (e.g. endorphins, enkephalins, and dynorphin), steroids, analgesics, barbiturates, oxycodone, morphine, lidocaine, and the like.Uses

[0227] In multiple aspects, described herein are uses of the RNA molecules described herein. For example, described herein are methods of modulating the translation of at least one cargo polypeptide. In some embodiments, the method comprises contacting a cell with an RNA molecule as described herein. In some embodiments, the method comprises contacting a cell with an saRNA as described herein. In some embodiments, the method comprises contacting a cell with a polynucleotide as described herein. In some embodiments, the method comprises contacting a cell with a vector as described herein. In some embodiments, the method comprises contacting a cell with a combination (e.g. of an RNA molecule and an associated target protein) as described herein. In some embodiments, the method comprises contacting a cell with a pharmaceutical composition as described herein.

[0228] In some embodiments, the method further comprises contacting the cell with at least one target protein (e.g., each associated with the at least one aptamer in the at least one ARES region of the RNA molecule).

[0229] In some embodiments, the cell already expresses at least one target protein (e.g., the RNA molecule can help to sense the presence in the cell of the at least one target protein which is associated with the at least one aptamer in the at least one ARES region of the RNA molecule).

[0230] In additional aspects, described herein are method of modulating the translation of at least one cargo polypeptide in a subject in need thereof. For example, the translation of the at least one cargo polypeptide can treat an associated disease or disorder in the subject. In some embodiments, the method comprises administering to the subject an effective amount of an RNA molecule as described herein. In some embodiments, the method comprises administering to the subject an effective amount of an saRNA as described herein. In some embodiments, the method comprises administering to the subject an effective amount of a polynucleotide as described herein. In some embodiments, the method comprises administering to the subject an effective amount of a vector as described herein. In some embodiments, the method comprises administering to the subject an effective amount of a combination (e.g. of an RNA molecule and an associated target protein) as described herein. In some embodiments, the method comprises administering to the subject an effective amount of a cell as described herein. In some embodiments, the method comprises administering to the subject an effective amount of a pharmaceutical composition as described herein.

[0231] In some embodiments, the method further comprises administering to the subject an effective amount of at least one target protein (e.g., each associated with the at least one aptamer in the at least one ARES region of the RNA molecule).

[0232] In some embodiments, a target cell in the subject expresses at least one target protein (e.g., the RNA molecule can help to sense the presence in the target cell of the subject the at least one target protein, which is associated with the at least one aptamer in the at least one ARES region of the RNA molecule).

[0233] In some embodiments, the RNA molecule provided in the method comprises at least one ON-switch ARES region as described herein. In some embodiments, with an RNA molecule comprising an ON-switch ARES region, in the presence of the target protein, the at least one cargo polypeptide encoded by the provided RNA molecule is translated (ON). In some embodiments, with an RNA molecule comprising an ON-switch ARES region, in the absence of the target protein, the at least one cargo polypeptide encoded by the provided RNA molecule is not translated (OFF).

[0234] In some embodiments, the RNA molecule provided in the method comprises at least one stabilization / degradation ARES region as described herein. In some embodiments, the RNA molecule provided in the method comprises at least one OFF-switch ARES region. In some embodiments, with an RNA molecule comprising a stabilization / degradation ARES region or an OFF-switch ARESregion, in the presence of the target protein, the at least one cargo polypeptide encoded by the provided RNA molecule is not translated (OFF). In some embodiments, with an RNA molecule comprising a stabilization / degradation ARES region or an OFF-switch ARES region, in the absence of the target protein, the at least one cargo polypeptide encoded by the provided RNA molecule is translated (ON).

[0235] Exemplary uses and applications of RNA molecules comprising at least ARES region as described herein, include but are not limited to the following: therapeutics (e.g., targeted protein therapy, engineered immune cells (e.g., to treat cancer), personalized medicine, temporal control (e.g., kill switch)); synthetic biology (e.g., metabolic engineering, cellular logic systems); diagnostics (e.g., biosensors; in vitro or in vivo),- vaccines; conditional expression systems (e.g., tools for studying gene function).

[0236] Exemplary uses in therapeutic gene regulation include targeted protein therapy and personalized medicine. In targeted protein therapy, RNA molecules described herein (e.g., comprising at least one ARES region described herein) permit precise control over therapeutic gene expression in response to disease-related proteins. For example, if a tumor marker protein is detected in cancer, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can activate or repress a therapeutic gene, delivering drugs or immune -modulatory proteins directly to the site of the tumor. In personalized medicine, by tailoring an RNA molecule described herein (e.g., comprising at least one ARES region described herein) to detect specific biomarkers (proteins), treatments can be customized for individual patients, offering highly personalized therapeutic strategies that respond to their unique biomolecular profiles.

[0237] Exemplary uses in cell-based therapies include engineered immune cells. In immunotherapy, particularly CAR-T cell therapy, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) permit engineered immune cells to activate or suppress certain functions based on the presence of target proteins on tumor cells. This would allow for more precise targeting of cancer cells and minimize off-target effects.

[0238] Exemplary uses in synthetic biology include metabolic engineering and cellular logic systems. In metabolic engineering, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can regulate the production of specific metabolites or biofuels in response to the detection of certain proteins. With cellular logic systems, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can be used to build logic gates that control cellular behavior based on multiple protein inputs. This could allow the creation of sophisticated biosensors or "smart" cells that make decisions based on protein signals, permitting complex biological systems for applications like biosensing or advanced diagnostics.

[0239] Exemplary uses in diagnostics include biosensors. An RNA molecule described herein (e.g., comprising at least one ARES region described herein) can serve as highly sensitive biosensormRNAs for detecting disease-associated proteins (e.g., viral or bacterial markers). When these proteins are present, the RNA molecule described herein (e.g., comprising at least one ARES region described herein) would activate a reporter gene, signaling the presence of the target protein. In some embodiments, following detection by the biosensor mRNA of a disease-associated protein, a disease- associated treatment can be administered (e.g., by the biosensor mRNA itself as the at least encoded cargo polypeptide; e.g., by a clinical following detection of a positive signal from the biosensor mRNA).

[0240] Exemplary uses in gene expression control in vaccines include protein-based vaccine modulation and therapeutic vaccines. In protein-based vaccine modulation, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can help regulate the expression of antigens or immune modulators in vaccines, triggering the production of these proteins only in response to specific proteins that indicate a pathogen is present in the body. This ensures more precise immune system activation. With therapeutic vaccines, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can be used to create mRNA-based therapeutic vaccines where the expression of the therapeutic protein (such as an antibody) is activated only in the presence of certain disease-related proteins.

[0241] Exemplary uses in protein replacement therapy inducible protein production. For inducible protein production, in patients with genetic diseases caused by protein deficiencies (e.g., cystic fibrosis or certain metabolic disorders), an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can be used to regulate the expression of missing or malfunctioning proteins in the patient. The switch could activate protein production when a disease- related protein is present, ensuring controlled expression and minimizing side effects.

[0242] Exemplary uses in gene silencing and activation include regulated gene knockdown and conditional expression systems. In regulated gene knockdown, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can be used to regulate gene expression in research or therapy by silencing genes in response to specific proteins. This could help in studies of gene function or in therapeutic strategies to silence disease-causing genes, such as oncogenes. For conditional expression systems, an RNA molecule described herein (e.g., comprising at least one ARES region described herein) can permit conditional expression of genes in cell culture or animal models, providing tools for studying gene function in a controlled manner. For example, researchers could use an RNA molecule described herein (e.g., comprising at least one ARES region described herein) to express a protein only when a specific protein in the environment is present.Definitions

[0243] For convenience, the meaning of some terms and phrases used in the specification, examples, and appended claims, are provided below. Unless stated otherwise, or implicit fromcontext, the following terms and phrases include the meanings provided below. The definitions are provided to aid in describing particular embodiments, and are not intended to limit the claimed invention, because the scope of the invention is limited only by the claims. Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belongs. If there is an apparent discrepancy between the usage of a term in the art and its definition provided herein, the definition provided within the specification shall prevail.

[0244] The terms “decrease”, “reduced”, “reduction”, or “inhibit” are all used herein to mean a decrease by a statistically significant amount. In some embodiments, “reduce,” “reduction" or “decrease" or “inhibit” typically means a decrease by at least 10% as compared to a reference level (e.g. the absence of a given treatment or agent) and can include, for example, a decrease by at least about 10%, at least about 20%, at least about 25%, at least about 30%, at least about 35%, at least about 40%, at least about 45%, at least about 50%, at least about 55%, at least about 60%, at least about 65%, at least about 70%, at least about 75%, at least about 80%, at least about 85%, at least about 90%, at least about 95%, at least about 98%, at least about 99% , or more. As used herein, “reduction” or “inhibition” does not encompass a complete inhibition or reduction as compared to a reference level. “Complete inhibition” is a 100% inhibition as compared to a reference level. A decrease can be preferably down to a level accepted as within the range of normal, e.g., for an individual without a given disorder.

[0245] The terms “increased”, “increase”, “enhance”, or “activate” are all used herein to mean an increase by a statistically significant amount. In some embodiments, the terms “increased”, “increase”, “enhance”, or “activate” can mean an increase of at least 10% as compared to a reference level, for example an increase of at least about 20%, or at least about 30%, or at least about 40%, or at least about 50%, or at least about 60%, or at least about 70%, or at least about 80%, or at least about 90% or up to and including a 100% increase or any increase between 10-100% as compared to a reference level, or at least about a 2-fold, or at least about a 3 -fold, or at least about a 4-fold, or at least about a 5-fold or at least about a 10-fold increase, or any increase between 2-fold and 10-fold or greater as compared to a reference level. In the context of a marker or symptom, an “increase” is a statistically significant increase in such level.

[0246] As used herein, a "subject" means a human or animal. Usually the animal is a vertebrate such as a primate, rodent, domestic animal or game animal. Primates include chimpanzees, cynomolgus monkeys, spider monkeys, and macaques, e.g., Rhesus. Rodents include mice, rats, woodchucks, ferrets, rabbits and hamsters. Domestic and game animals include cows, horses, pigs, deer, bison, buffalo, feline species, e.g., domestic cat, canine species, e.g., dog, fox, wolf, avian species, e.g., chicken, emu, ostrich, and fish, e.g., trout, catfish and salmon. In some embodiments,the subject is a mammal, e.g., a primate, e.g., a human. The terms, “individual,” “patient” and “subject” are used interchangeably herein.

[0247] Preferably, the subject is a mammal. The mammal can be a human, non-human primate, mouse, rat, dog, cat, horse, or cow, but is not limited to these examples. Mammals other than humans can be advantageously used as subjects that represent animal models of a disease or disorder. A subject can be male or female.

[0248] A subject can be one who has been previously diagnosed with or identified as suffering from or having a condition in need of treatment or one or more complications related to such a condition, and optionally, have already undergone treatment for the condition or the one or more complications related to the condition. Alternatively, a subject can also be one who has not been previously diagnosed as having the condition or one or more complications related to the condition. For example, a subject can be one who exhibits one or more risk factors for the condition or one or more complications related to the condition or a subject who does not exhibit risk factors.

[0249] A “subject in need” of treatment for a particular condition can be a subject having that condition, diagnosed as having that condition, or at risk of developing that condition.

[0250] As used herein, the terms “protein" and “polypeptide" are used interchangeably to designate a series of amino acid residues, connected to each other by peptide bonds between the alpha-amino and carboxy groups of adjacent residues. The terms "protein", and "polypeptide" refer to a polymer of amino acids, including modified amino acids (e.g., phosphorylated, glycated, glycosylated, etc.) and amino acid analogs, regardless of its size or function. "Protein" and “polypeptide” are often used in reference to relatively large polypeptides, whereas the term "peptide" is often used in reference to small polypeptides, but usage of these terms in the art overlaps. The terms "protein" and "polypeptide" are used interchangeably herein when referring to a gene product and fragments thereof. Thus, exemplary polypeptides or proteins include gene products, naturally occurring proteins, homologs, orthologs, paralogs, fragments and other equivalents, variants, fragments, and analogs of the foregoing.

[0251] In the various embodiments described herein, it is further contemplated that variants (naturally occurring or otherwise), alleles, homologs, conservatively modified variants, and / or conservative substitution variants of any of the particular polypeptides described are encompassed. As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters a single amino acid or a small percentage of amino acids in the encoded sequence is a “conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid and retains the desired activity of the polypeptide. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles consistent with the disclosure.

[0252] A given amino acid can be replaced by a residue having similar physiochemical characteristics, e.g., substituting one aliphatic residue for another (such as He, Vai, Leu, or Ala for one another), or substitution of one polar residue for another (such as between Lys and Arg; Glu and Asp; or Gin and Asn). Other such conservative substitutions, e.g., substitutions of entire regions having similar hydrophobicity characteristics, are well known. Polypeptides comprising conservative amino acid substitutions can be tested to confirm that a desired activity of a native or reference polypeptide is retained.

[0253] Amino acids can be grouped according to similarities in the properties of their side chains (in A. L. Lehninger, in Biochemistry, second ed., pp. 73-75, Worth Publishers, New York (1975)): (1) non-polar: Ala (A), Vai (V), Leu (L), He (I), Pro (P), Phe (F), Trp (W), Met (M); (2) uncharged polar: Gly (G), Ser (S), Thr (T), Cys (C), Tyr (Y), Asn (N), Gin (Q); (3) acidic: Asp (D), Glu (E); (4) basic: Lys (K), Arg (R), His (H). Alternatively, naturally occurring residues can be divided into groups based on common side-chain properties: (1) hydrophobic: Norleucine, Met, Ala, Vai, Leu, He; (2) neutral hydrophilic: Cys, Ser, Thr, Asn, Gin; (3) acidic: Asp, Glu; (4) basic: His, Lys, Arg; (5) residues that influence chain orientation: Gly, Pro; (6) aromatic: Trp, Tyr, Phe. Non-conservative substitutions will entail exchanging a member of one of these classes for another class. Particular conservative substitutions include, for example; Ala into Gly or into Ser; Arg into Lys; Asn into Gin or into His; Asp into Glu; Cys into Ser; Gin into Asn; Glu into Asp; Gly into Ala or into Pro; His into Asn or into Gin; He into Leu or into Vai; Leu into He or into Vai; Lys into Arg, into Gin or into Glu; Met into Leu, into Tyr or into He; Phe into Met, into Leu or into Tyr; Ser into Thr; Thr into Ser; Trp into Tyr; Tyr into Trp; and / or Phe into Vai, into He or into Leu.

[0254] In some embodiments, the nucleic acids described herein (e.g., an aptamer and / or ribozyme) can be a functional fragment of one of the full-length (e.g., wild-type or reference) nucleic acids (e.g., an aptamer and / or ribozyme) described herein. The functional fragment can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the nucleotide sequence of the full-length (e.g., wildtype or reference) nucleic acid. As used herein, a “functional fragment” is a fragment or segment of a nucleic acid which retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the full-length (e.g., wild-type or reference) nucleic acid’s activity. For example, a functional fragment of an aptamer sequence described herein retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the full-length (e.g., wildtype or reference) aptamer’s ability to specifically bind a target protein. As another example , a functional fragment of a ribozyme sequence described herein retains at least 50%, at least 60%, atleast 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the full-length (e.g., wild-type or reference) ribozyme’s enzymatic function (e.g., ability to cleave itself if a self-cleaving ribozyme). A functional fragment can comprise conservative substitutions of the nucleic acid sequences disclosed herein.

[0255] In some embodiments, the polypeptide described herein (or a nucleic acid encoding such a polypeptide) can be a functional fragment of one of the full-length (e.g., wild-type or reference) amino acid sequences described herein. The functional fragment can comprise at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the amino acid sequence of the full-length (e.g., wild-type or reference) polypeptide. As used herein, a “functional fragment” is a fragment or segment of a polypeptide which retains at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more of the full-length (e.g., wild-type or reference) polypeptide’s activity. A functional fragment can comprise conservative substitutions of the sequences disclosed herein.

[0256] In some embodiments, the polypeptide described herein can be a variant of a polypeptide sequence described herein. In some embodiments, the variant is a conservatively modified variant. Conservative substitution variants can be obtained by mutations of native nucleotide sequences, for example. A “variant," as referred to herein, is a polypeptide substantially homologous to a native or reference polypeptide, but which has an amino acid sequence different from that of the native or reference polypeptide because of one or a plurality of deletions, insertions or substitutions. Variant polypeptide-encoding DNA sequences encompass sequences that comprise one or more additions, deletions, or substitutions of nucleotides when compared to a native or reference DNA sequence, but that encode a protein or fragment thereof that retains activity of the native or reference polypeptide. A wide variety of, for example, PCR-based, site-specific mutagenesis approaches are known in the art and can be applied by the ordinarily skilled artisan to generate and test artificial variants.

[0257] A variant amino acid or DNA sequence can be at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, identical to a native or reference sequence. The degree of homology (percent identity) between a native and a mutant sequence can be determined, for example, by comparing the two sequences using freely available computer programs commonly employed for this purpose on the world wide web (e.g. BLASTp or BLASTn with default settings).

[0258] A variant amino acid sequence can be at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more, similar to a native or reference sequence. As usedherein, “similarity” refers to an identical amino acid or a conservatively substituted amino acid, as described herein. Accordingly, the percentage of “sequence similarity” is the percentage of amino acids which is either identical or conservatively changed; e.g., “sequence similarity” = (% sequence identity)+(% conservative changes). It should be understood that a sequence that has a specified percent similarity to a reference sequence necessarily encompasses a sequence with the same specified percent identity to that reference sequence. The skilled person will be aware of various computer programs, using different mathematical algorithms, that are available to determine the identity or similarity between two sequences. For instance, use can be made of a computer program employing the Needleman and Wunsch algorithm (Needleman et al. (1970)); the GAP program in the Accelrys GCG software package (Accelerys Inc., San Diego U.S.A.); the algorithm of E. Meyers and W. Miller (Meyers et al. (1989)) which has been incorporated into the ALIGN program (version 2.0); or more preferably the BLAST (Basic Local Alignment Tool using default parameters); see e.g., US Patent 10,023,890, the content of which is incorporated by reference herein in its entirety.

[0259] Alterations of the native amino acid sequence can be accomplished by any of a number of techniques known to one of skill in the art. Mutations can be introduced, for example, at particular loci by synthesizing oligonucleotides containing a mutant sequence, flanked by restriction sites enabling ligation to fragments of the native sequence. Following ligation, the resulting reconstructed sequence encodes an analog having the desired amino acid insertion, substitution, or deletion. Alternatively, oligonucleotide-directed site-specific mutagenesis procedures can be employed to provide an altered nucleotide sequence having particular codons altered according to the substitution, deletion, or insertion required. A wide variety of, site-specific mutagenesis approaches, e.g., Kunkel’s method, cassette mutagenesis, PCR site-directed mutagenesis (e.g., traditional PCR, primer extension, or inverse PCR), whole plasmid mutagenesis, in vivo site-directed mutagenesis, CRISPR / Cas-guided mutagenesis, are known in the art and can be applied by the ordinarily skilled artisan to introduce mutations into specific nucleic acid loci. Techniques for making such alterations are very well established and include, for example, those disclosed by Walder et al. (Gene 42: 133, 1986); Bauer et al. (Gene 37:73, 1985); Craik (BioTechniques, January 1985, 12-19); Smith et al. (Genetic Engineering: Principles and Methods, Plenum Press, 1981); Braman, Jeff, ed. (2002) In Vitro Mutagenesis Protocols, Methods in Molecular Biology, Vol. 182 (2nd ed.); Khudyakov and Fields (2002), Artificial DNA: Methods and Applications, CRC Press; Hsu et al. (2014), Cell 157 (6): 1262- 78; Cerchione et al. (2020) PLOS ONE 15 (4): e0231716; and U.S. Pat. Nos. 4,518,584 and 4,737,462, which are herein incorporated by reference in their entireties. Any cysteine residue not involved in maintaining the proper conformation of the polypeptide also can be substituted, generally with serine, to improve the oxidative stability of the molecule and prevent aberrant crosslinking. Conversely, cysteine bond(s) can be added to the polypeptide to improve its stability or facilitate oligomerization.

[0260] As used herein, the term “nucleic acid” or “nucleic acid sequence” refers to any molecule, preferably a polymeric molecule, incorporating units of ribonucleic acid, deoxyribonucleic acid or an analog thereof. The nucleic acid can be either single -stranded or double-stranded. A single-stranded nucleic acid can be one nucleic acid strand of a denatured double- stranded DNA. Alternatively, it can be a single-stranded nucleic acid not derived from any double -stranded DNA. In one aspect, the nucleic acid can be DNA. In another aspect, the nucleic acid can be RNA. Suitable DNA can include, e.g., genomic DNA, vector DNA, or cDNA. Suitable RNA can include, e.g., mRNA, saRNA.

[0261] As used herein, the term “hybridize” refers to the process by which single strands of polynucleotides form a double-stranded structure through hydrogen bonding between the constituent bases. It is understood herein that the two polynucleotides that can hybridize to each other can be in separate nucleic acid molecules or can be in separate regions of a single nucleic acid molecule. The ability of two polynucleotides to hybridize with each other is based on the degree of complementarity of the two polynucleotides, which in turn is based on the fraction of matched complementary nucleotide pairs. In some embodiments, the two polynucleotides that can hybridize to each other comprise at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, or more matched complementary nucleotide pairs. The more nucleotides in a given polynucleotide that are complementary to another polynucleotide, the more stringent the conditions can be for hybridization and the more specific will be the binding between the two polynucleotides. Increased stringency may be achieved by elevating the temperature, increasing the ratio of co-solvents, lowering the salt concentration, and combinations thereof.

[0262] As used herein, the terms “complementary,” “complement,” and “complementary nucleic acid sequence” refer to the nucleic acid strand that is related to the base sequence in another nucleic acid strand by the Watson-Crick base-pairing rules. In general, two polynucleotides are complementary when one polynucleotide can bind another polynucleotide in an anti-parallel sense wherein the 3 '-end of each polynucleotide binds to or is aligned with the 5 '-end of the other polynucleotide and each A, T(U), G, and C of one polynucleotide is then aligned with a T(U), A, C, and G, respectively, of the other polynucleotide. Polynucleotides that comprise RNA bases can also include complementary G / U or U / G basepairs. Two complementary strands may comprise complementary regions comprising all or one or more portions of one or both strands.

[0263] The term "expression" refers to the cellular processes involved in producing RNA and proteins and as appropriate, secreting proteins, including where applicable, but not limited to, for example, transcription, transcript processing, translation and protein folding, modification and processing. Expression can refer to the transcription and stable accumulation of sense (e.g., mRNA) or antisense RNA derived from a nucleic acid fragment or fragments and / or to the translation of mRNA into a polypeptide.

[0264] "Expression products" include RNA transcribed from a gene, and polypeptides obtained by translation of mRNA transcribed from a gene. The term "gene" refers to the nucleic acid sequence which is transcribed (DNA) to RNA in vitro or in vivo when operably linked to appropriate regulatory sequences. The gene may or may not include regions preceding and following a coding region, e.g. 5’ untranslated (5’ UTR) or "leader" sequences and 3’ UTR or "trailer" sequences, as well as intervening sequences (introns) between individual coding segments (exons).

[0265] In some embodiments of any of the aspects, a polypeptide, nucleic acid (e.g., an RNA molecule), or cell as described herein can be engineered. As used herein, “engineered" refers to the aspect of having been manipulated by the hand of man. For example, a nucleic acid (e.g., an RNA molecule) is considered to be “engineered" when at least one aspect of the nucleic acid, e.g., its sequence, has been manipulated by the hand of man to differ from the aspect as it exists in nature. As another example, a polypeptide is considered to be “engineered" when at least one aspect of the polypeptide, e.g., its sequence, has been manipulated by the hand of man to differ from the aspect as it exists in nature. As is common practice and is understood by those in the art, progeny of an engineered cell are typically still referred to as “engineered" even though the actual manipulation was performed on a prior entity.

[0266] In some embodiments of any of the aspects, the RNA molecule and / or target protein described herein is exogenous. In some embodiments of any of the aspects, the RNA molecule and / or target protein described herein is ectopic. In some embodiments of any of the aspects, the RNA molecule and / or target protein described herein is not endogenous.

[0267] The term "exogenous" refers to a substance present in a cell other than its native source. The term "exogenous" when used herein can refer to a nucleic acid (e.g. an RNA molecule as described herein) or a polypeptide that has been introduced by a process involving the hand of man into a biological system such as a cell or organism in which it is not normally found and one wishes to introduce the nucleic acid or polypeptide into such a cell or organism. Alternatively, “exogenous” can refer to a nucleic acid or a polypeptide that has been introduced by a process involving the hand of man into a biological system such as a cell or organism in which it is found in relatively low amounts and one wishes to increase the amount of the nucleic acid or polypeptide in the cell or organism, e.g., to create ectopic expression or levels. In contrast, the term "endogenous" refers to a substance that is native to the biological system or cell. As used herein, “ectopic” refers to a substance that is found in an unusual location and / or amount. An ectopic substance can be one that is normally found in a given cell, but at a much lower amount and / or at a different time. Ectopic also includes a substance, such as a polypeptide or nucleic acid that is not naturally found or expressed in a given cell in its natural environment.

[0268] As used herein, the terms "treat,” "treatment," "treating,” or “amelioration” refer to therapeutic treatments, wherein the object is to reverse, alleviate, ameliorate, inhibit, slow down orstop the progression or severity of a condition associated with a disease or disorder. The term “treating" includes reducing or alleviating at least one adverse effect or symptom of a condition, disease or disorder. Treatment is generally “effective" if one or more symptoms or clinical markers are reduced. Alternatively, treatment is “effective" if the progression of a disease is reduced or halted. That is, “treatment" includes not just the improvement of symptoms or markers, but also a cessation of, or at least slowing of, progress or worsening of symptoms compared to what would be expected in the absence of treatment. Beneficial or desired clinical results include, but are not limited to, alleviation of one or more symptom(s), diminishment of extent of disease, stabilized (z.e., not worsening) state of disease, delay or slowing of disease progression, amelioration or palliation of the disease state, remission (whether partial or total), and / or decreased mortality, whether detectable or undetectable. The term "treatment" of a disease also includes providing relief from the symptoms or side-effects of the disease (including palliative treatment).

[0269] As used herein, the term “pharmaceutical composition” refers to the active agent in combination with a pharmaceutically acceptable carrier e.g. a carrier commonly used in the pharmaceutical industry. The phrase "pharmaceutically acceptable" is employed herein to refer to those compounds, materials, compositions, and / or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be a carrier other than water. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be a cream, emulsion, gel, liposome, nanoparticle, and / or ointment. In some embodiments of any of the aspects, a pharmaceutically acceptable carrier can be an artificial or engineered carrier, e.g., a carrier that the active ingredient would not be found to occur in or within nature.

[0270] As used herein, the term "administering," refers to the placement of a composition or compound as disclosed herein into a subject by a method or route which results in at least partial delivery of the composition, compound, or metabolite thereof at a desired site. Pharmaceutical compositions comprising the compounds disclosed herein can be administered by any appropriate route which results in an effective treatment in the subject. In some embodiments, administration comprises physical human activity, e.g., an injection, act of ingestion, an act of application, and / or manipulation of a delivery device or machine. Such activity can be performed, e.g., by a medical professional and / or the subject being treated.

[0271] As used herein, “contacting" refers to any suitable means for delivering, or exposing, an agent to at least one cell. Exemplary delivery methods include, but are not limited to, direct delivery to cell culture medium, transfection, transduction, perfusion, injection, or other delivery method known to one skilled in the art. In some embodiments, contacting comprises physical human activity,e.g., an injection; an act of dispensing, mixing, and / or decanting; and / or manipulation of a delivery device or machine. “Contacting” of a cell can be performed in vitro, ex vivo, or in vivo.

[0272] In some embodiments of any of the aspects, the cells can be maintained in culture. As used herein, “maintaining” refers to continuing the viability of a cell or population of cells. A maintained population of cells will have at least a subpopulation of metabolically active cells.

[0273] As used herein, the term “specific binding” or “specifically binds” refers to a chemical or physical interaction between two molecules, compounds, cells and / or particles wherein the first entity binds to the second, target entity (e.g., the aptamer and its associated target protein) with greater specificity and affinity than it binds to a third entity which is a non-target. In some embodiments, specific binding can refer to an affinity of the first entity for the second target entity which is at least 10 times, at least 50 times, at least 100 times, at least 500 times, at least 1000 times or greater than the affinity for the third non-target entity.

[0274] The term “statistically significant" or “significantly" refers to statistical significance and generally means a two standard deviation (2SD) or greater difference or a p-value of less than 0.05.

[0275] Other than in the operating examples, or where otherwise indicated, all numbers expressing quantities of ingredients or reaction conditions used herein should be understood as modified in all instances by the term “about.” The term “about” when used in connection with percentages can mean ±1%.

[0276] As used herein, the term “comprising” means that other elements can also be present in addition to the defined elements presented. The use of “comprising” indicates inclusion rather than limitation.

[0277] The term "consisting of refers to compositions, methods, and respective components thereof as described herein, which are exclusive of any element not recited in that description of the embodiment.

[0278] As used herein the term "consisting essentially of refers to those elements required for a given embodiment. The term permits the presence of additional elements that do not materially affect the basic and novel or functional characteristic(s) of that embodiment of the invention.

[0279] As used herein, the term “corresponding to” refers to an amino acid or nucleotide at the enumerated position in a first polypeptide or nucleic acid, or an amino acid or nucleotide that is equivalent to an enumerated amino acid or nucleotide in a second polypeptide or nucleic acid. Equivalent enumerated amino acids or nucleotides can be determined by alignment of candidate sequences using degree of homology programs known in the art, e.g., BLAST.

[0280] The singular terms "a," "an," and "the" include plural referents unless context clearly indicates otherwise. Similarly, the word "or" is intended to include "and" unless the context clearly indicates otherwise. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of this disclosure, suitable methods and materials are describedbelow. The abbreviation, "e.g." is derived from the Latin exempli gratia, and is used herein to indicate a non-limiting example. Thus, the abbreviation "e.g." is synonymous with the term "for example."

[0281] Groupings of alternative elements or embodiments of the invention disclosed herein are not to be construed as limitations. Each group member can be referred to and claimed individually or in any combination with other members of the group or other elements found herein. One or more members of a group can be included in, or deleted from, a group for reasons of convenience and / or patentability. When any such inclusion or deletion occurs, the specification is herein deemed to contain the group as modified thus fulfilling the written description of all Markush groups used in the appended claims.

[0282] Unless otherwise defined herein, scientific and technical terms used in connection with the present application shall have the meanings that are commonly understood by those of ordinary skill in the art to which this disclosure belongs. It should be understood that this invention is not limited to the particular methodology, protocols, and reagents, etc., described herein and as such can vary. The terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention, which is defined solely by the claims. Definitions of common terms in cell biology, immunology, and molecular biology can be found in The Merck Manual of Diagnosis and Therapy, 20th Edition, published by Merck Sharp & Dohme Corp., 2018 (ISBN 0911910190, 978-0911910421); Robert S. Porter et al. (eds.), The Encyclopedia of Molecular Cell Biology and Molecular Medicine, published by Blackwell Science Ltd., 1999-2012 (ISBN 9783527600908); and Robert A. Meyers (ed.), Molecular Biology and Biotechnology: a Comprehensive Desk Reference, published by VCH Publishers, Inc., 1995 (ISBN 1-56081-569-8); Immunology by Werner Luttmann, published by Elsevier, 2006; Janeway's Immunobiology, Kenneth Murphy, Allan Mowat, Casey Weaver (eds.), W. W. Norton & Company, 2016 (ISBN 0815345054, 978-0815345053); Lewin's Genes XI, published by Jones & Bartlett Publishers, 2014 (ISBN- 1449659055); Michael Richard Green and Joseph Sambrook, Molecular Cloning: A Laboratory Manual, 4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., USA (2012) (ISBN 1936113414); Davis et al., Basic Methods in Molecular Biology, Elsevier Science Publishing, Inc., New York, USA (2012) (ISBN 044460149X); Laboratory Methods in Enzymology: DNA, Jon Lorsch (ed.) Elsevier, 2013 (ISBN 0124199542); Current Protocols in Molecular Biology (CPMB), Frederick M. Ausubel (ed.), John Wiley and Sons, 2014 (ISBN 047150338X, 9780471503385), Current Protocols in Protein Science (CPPS), John E. Coligan (ed.), John Wiley and Sons, Inc., 2005; and Current Protocols in Immunology (CPI) (John E. Coligan, ADA M Kruisbeek, David H Margulies, Ethan M Shevach, Warren Strobe, (eds.) John Wiley and Sons, Inc., 2003 (ISBN 0471142735, 9780471142737), the contents of which are all incorporated by reference herein in their entireties.

[0283] Other terms are defined herein within the description of the various aspects of the invention.

[0284] All patents and other publications; including literature references, issued patents, published patent applications, and co-pending patent applications; cited throughout this application are expressly incorporated herein by reference for the purpose of describing and disclosing, for example, the methodologies described in such publications that might be used in connection with the technology described herein. These publications are provided solely for their disclosure prior to the filing date of the present application. Nothing in this regard should be construed as an admission that the inventors are not entitled to antedate such disclosure by virtue of prior invention or for any other reason. All statements as to the date or representation as to the contents of these documents is based on the information available to the applicants and does not constitute any admission as to the correctness of the dates or contents of these documents.

[0285] The description of embodiments of the disclosure is not intended to be exhaustive or to limit the disclosure to the precise form disclosed. While specific embodiments of, and examples for, the disclosure are described herein for illustrative purposes, various equivalent modifications are possible within the scope of the disclosure, as those skilled in the relevant art will recognize. For example, while method steps or functions are presented in a given order, alternative embodiments may perform functions in a different order, or functions may be performed substantially concurrently. The teachings of the disclosure provided herein can be applied to other procedures or methods as appropriate. The various embodiments described herein can be combined to provide further embodiments. Aspects of the disclosure can be modified, if necessary, to employ the compositions, functions and concepts of the above references and application to provide yet further embodiments of the disclosure. Moreover, due to biological functional equivalency considerations, some changes can be made in protein structure without affecting the biological or chemical action in kind or amount. These and other changes can be made to the disclosure in light of the detailed description. All such modifications are intended to be included within the scope of the appended claims.

[0286] Specific elements of any of the foregoing embodiments can be combined or substituted for elements in other embodiments. Furthermore, while advantages associated with certain embodiments of the disclosure have been described in the context of these embodiments, other embodiments may also exhibit such advantages, and not all embodiments need necessarily exhibit such advantages to fall within the scope of the disclosure.

[0287] Some embodiments of the technology described herein can be defined according to any of the following numbered paragraphs:1. An RNA molecule comprising: a) an open reading frame (ORF) encoding at least one cargo polypeptide; and b) at least one untranslated region (UTR) comprising at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region, which comprises: i) a protein-binding aptamer that specifically binds to a target protein; andii) a ribozyme.2. The RNA molecule of paragraph 1, wherein the aptamer is selected from the group consisting of: a MS2 aptamer, a PP7 aptamer, a bovine immunodeficiency virus (BIV) transactivation response (Tar) aptamer, and a P22 aptamer.3. The RNA molecule of paragraph 1 or 2, wherein the target protein is selected from: a) MS2 coat protein (MCP), which specifically binds to the MS2 aptamer; b) PP7 coat protein (PCP), which specifically binds to the PP7 aptamer; c) BIV trans-activator of transcription (Tat), which specifically binds to the BIV Tar aptamer; d) a P22 N protein, which specifically binds to the P22 aptamer.4. The RNA molecule of any one of paragraphs 1-3, wherein the ribozyme is a self-cleaving ribozyme.5. The RNA molecule of paragraph 4, wherein the self-cleaving ribozyme is selected from the group consisting of: hammerhead ribozyme (HHR), hepatitis delta virus (HDV) ribozyme, hairpin ribozyme, Varkud satellite (VS) ribozyme, glmS ribozyme, twister ribozyme, twister sister ribozyme, Pistol ribozyme, Hatchet ribozyme, and Hovlinc ribozyme.6. The RNA molecule of any one of paragraphs 1-5, wherein the aptamer is 5' of the ribozyme in the ARES region.7. The RNA molecule of any one of paragraphs 1-6, wherein the aptamer is 3' of the ribozyme in the ARES region.8. The RNA molecule of any one of paragraphs 1-7, wherein the at least one ARES region is located in the UTR 5' of the ORF (5' UTR).9. The RNA molecule of any one of paragraphs 1-8, wherein the at least one ARES region is located in the UTR 3' of the ORF (3' UTR).10. The RNA molecule of any one of paragraphs 1-9, wherein at least one ARES region is located in 5' UTR, and at least one ARES region is located the 3' UTR.11. The RNA molecule of any one of paragraphs 1-10, wherein the at least one ARES region modulates the stability of the RNA molecule and / or modulates translation of the at least one cargo polypeptide encoded by the ORF.12. The RNA molecule of any one of paragraphs 1-11, wherein the at least one ARES region is an ON-switch ARES region structured such that either the aptamer or the ribozyme, but not both, can form at one time in the RNA molecule.13. The RNA molecule of paragraph 12, wherein in an RNA molecule comprising an ON-switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, and the ORF can be translated (ON); and / orb) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF).14. The RNA molecule of paragraph 12 or 13, wherein the ON-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a complementary (b*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region in the ribozyme; and b) the ribozyme comprising: i) the secondary second (b2) region and the complementary (b*) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region.15. The RNA molecule of paragraph 14, wherein the ON-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the complementary (b*) region that can hybridize to the primary second (bl) region in the aptamer or to a secondary second (b2) region in the ribozyme; e) the third (c) region; f) the complementary (c*) region that can hybridize to the third (c) region; and g) the secondary second (b2) region.16. The RNA molecule of paragraph 14, wherein the ON-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (c) region; d) the complementary (b*) region that can hybridize to the secondary second (b2) region in the ribozyme or to a primary second (bl) region in the aptamer; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; and g) the primary second (bl) region.17. The RNA molecule of any one of paragraphs 1-16, which further comprises at least one stabilization domain.The RNA molecule of any one of paragraphs 1-17, which further comprises at least one degradation domain. The RNA molecule of any one of paragraphs 1-18, wherein the at least one ARES region is a stabilization / degradation ARES region, which comprises in the 3' UTR, from 5' to 3': a) a stabilization domain; b) the ON-switch ARES region of any one of paragraphs 12-16; and c) a degradation domain. The RNA molecule of paragraph 19, wherein in an RNA molecule comprising a stabilization / degradation ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, the degradation domain is retained, the RNA molecule is degraded, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, the degradation domain is not retained, the stabilization domain protects the RNA molecule from degradation, and the ORF can be translated (ON). The RNA molecule of any one of paragraphs 1-20, wherein the at least one ARES region is an OFF-switch ARES region structured such that either both the aptamer and the ribozyme, or at least one stabilization stem, can form at one time in the RNA molecule. The RNA molecule of paragraph 21, wherein in an RNA molecule comprising an OFF-switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme can form, the at least one stabilization stem cannot form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme cannot form, the at least one stabilization stem can form, the RNA molecule is not cleaved, and the ORF can be translated (ON). The RNA molecule of paragraph 21 or 22, wherein the OFF-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; andii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; and c) the at least one stabilization stem comprising: i) a fourth (d) region and a complementary (d*) region that can hybridize to the fourth (d) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer. The RNA molecule of paragraph 23, wherein the OFF-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the secondary second (b2) region; h) the third (c) region; i) the complementary (c*) region that can hybridize to the third (c) region; and j) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region. The RNA molecule of paragraph 23, wherein the OFF-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (a) region; d) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region or to a primary second (bl) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the primary second (bl) region; h) the first (a) region; i) the complementary (a*) region that can hybridize to the first (a) region; and j) the primary complementary (bl*) region that can hybridize to the primary second (bl) region.The RNA molecule of paragraph 21 or 22, wherein the OFF-switch ARES region comprises 2 stabilization stems. The RNA molecule of paragraph 26, wherein the OFF-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the aptamer and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region. The RNA molecule of paragraph 27, wherein the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region;g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; l) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region. The RNA molecule of paragraph 26, wherein the OFF-switch ARES region comprises: a) the ribozyme comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the aptamer comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the aptamer and the primary complementary (bl*) region of the ribozyme; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the ribozyme and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region. The RNA molecule of paragraph 29, wherein the OFF-switch ARES region comprises from 5' to 3':a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; l) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region. The RNA molecule of any one of paragraphs 1-30, wherein the at least cargo polypeptide is selected from: a) a detectable marker (e.g., a fluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anticlaudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti -cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti-glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL-12, OX40L, IL-23); d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a site-specific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like);h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon- like peptide- 1, insulin); or i) an oncogene (e g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF). The RNA molecule of any one of paragraphs 1-31, which is a messenger RNA (mRNA), further comprising a 5' cap and a 3' polyA tail. A self-amplifying RNA (saRNA) comprising the RNA molecule of any one of paragraphs 1- 32, which further comprises a second open reading frame encoding an RNA-dependent RNA polymerase. A self-amplifying RNA (saRNA) comprising from 5' to 3': a) a 5' conserved sequence element (CSE); b) a first open reading frame (ORF) encoding an RNA-dependent RNA polymerase (RdRP), operably linked to a promoter in the 5' CSE; c) a subgenomic promoter (SGP); d) a second ORF encoding at least one cargo polypeptide, operably linked to the SGP; and e) a 3' CSE; and wherein the 5' CSE, a region between the first and second ORFs, and / or the 3' CSE further comprises at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region in a sense or anti-sense orientation, wherein the ARES region comprises: i) a protein-aptamer that specifically binds to a target protein; and ii) a ribozyme. The saRNA of paragraph 33 or 34, wherein when the ARES region is in the sense orientation, the ARES region is functional in the saRNA. The saRNA of paragraph 33 or 34, wherein when the ARES region is in the anti-sense orientation, the ARES region is functional when the saRNA is delivered to a cell, the RdRP is translated from the saRNA, and the RdRP synthesizes a reverse complementary negative strand of the saRNA. A polynucleotide comprising the RNA molecule of any one of paragraphs 1-32 or the saRNA of any one of paragraphs 33-36. A vector comprising the polynucleotide of paragraph 37. A combination comprising: a) the RNA molecule of any one of paragraphs 1-32 or the saRNA of any one of paragraphs 33-36; and b) a target protein.The combination of paragraph 39, wherein the target protein is linked to a polypeptide of interest. A cell comprising the RNA molecule of any one of paragraphs 1-32, the saRNA of any one of paragraphs 33-36, the polynucleotide of paragraph 37, the vector of paragraph 38, and / or the combination of paragraph 39 or 40. A pharmaceutical composition comprising the RNA molecule of any one of paragraphs 1-32, the saRNA of any one of paragraphs 33-36, the polynucleotide of paragraph 37, the vector of paragraph 38, the combination of paragraph 39 or 40, or the cell of paragraph 41. A method of modulating the translation of at least one cargo polypeptide, the method comprising contacting a cell with the RNA molecule of any one of paragraphs 1-32, the saRNA of any one of paragraphs 33-36, the polynucleotide of paragraph 37, the vector of paragraph 38, the combination of paragraph 39 or 40, or the pharmaceutical composition of paragraph 42. The method of paragraph 43, further comprising contacting the cell with the target protein. The method of paragraph 43 or 44, wherein the cell expresses the target protein. A method of modulating the translation of at least one cargo polypeptide in a subject in need thereof, the method comprising administering to the subject an effective amount of the RNA molecule of any one of paragraphs 1-32, the saRNA of any one of paragraphs 33-36, the polynucleotide of paragraph 37, the vector of paragraph 38, the combination of paragraph 39 or 40, the cell of paragraph 41, or the pharmaceutical composition of paragraph 42. The method of paragraph 46, further comprising administering to the subject an effective amount of the target protein. The method of paragraph 46 or 47, wherein a target cell in the subject expresses the target protein. The method of any one of paragraphs 43-48, wherein the RNA molecule comprises the ON- switch ARES region of any one of paragraphs 12-16. The method of paragraph 49, wherein in an RNA molecule comprising an ON-switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is translated (ON); and / or b) in the absence of the target protein, the at least one cargo polypeptide is not translated (OFF). The method of any one of paragraphs 43-50, wherein the RNA molecule comprises the stabilization / degradation ARES region of any one of paragraphs 19-20. The method of any one of paragraphs 43-51, wherein the RNA molecule comprises the OFF- switch ARES region of any one of paragraphs 21-30.53. The method of paragraph 51 or 52, wherein in an RNA molecule comprising a stabilization / degradation ARES region or an OFF-switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is not translated (OFF); and / or b) in the absence of the target protein, the at least one cargo polypeptide is translated (ON).

[0288] The technology described herein is further illustrated by the following examples which in no way should be construed as being further limiting.EXAMPLESExample 1: Aptamer and Ribozyme Equilibrium Shifting (ARES) RNA Circuits for Cell-Specific Targeting and Temporal Control of mRNA Therapeutics

[0289] RNA therapeutics hold immense promise for the future of healthcare, potentially revolutionizing treatments for various diseases, including genetic disorders and cancers.1,2However, there is a critical need to develop systems that provide precise spatial and temporal control over these therapies to maximize their efficacy and minimize potential side effects. Current site-specific control methods such as lipid nanoparticles (LNPs) are used for targeted drug delivery, but they lack highly specific cell types and tissue targeting.3,4Methods to control mRNA lifespan, the addition of cap structures, polyadenylation, and degradation tags, exist but do not provide adaptable control over the system, resulting in highly variable lifespans for the therapeutics.5To fully realize the potential of RNA therapeutics, the focus must now shift to pioneering novel solutions that refine targeting accuracy and control mRNA life span.

[0290] To address these challenges, described herein is the development of RNA switches designed to regulate mRNA life span in response to proteins present in the environment. These switches leverage a previously optimized hammerhead ribozyme (HHR) and RNA binding proteins (RBPs). The HHR possesses self-cleaving properties that can cause mRNA to be degraded. RBPs, on the other hand, can specifically bind to RNA aptamers and affect the cleavage activity of the HHR.6,7Without wishing to be bound by theory, it is hypothesized that by combining HHR and RBP aptamers into an aptamer ribozyme equilibrium shifting (ARES) RNA circuit, generalizable mRNA stabilizing and destabilizing switches can be achieved and controlled with RBPs. If successful, this approach would provide more precise spatial and temporal control over RNA therapeutics, leading to enhanced efficacy and minimized side effects. Additionally, the versatility of the proposed RNA switches would facilitate their widespread application in healthcare.

[0291] Section 1: Attain cell-specific and temporal control of translation through mRNA stabilizing switch triggered by RBPs. Thus far, several exogenous RBP-aptamer pairs have been designed and screened through to identify mRNA stabilizing switches. In these switches mRNA structures remain stable when an RBP is present, allowing for normal translation. However, in the absence of the RBP, an HHR in proximity to the aptamer is thermodynamically favored to form and will self-cleavage. This leads to the degradation of the mRNA before translation. Several exogenous RBPs and their aptamers have proved successful including BIV Tat, P22N, and MCP. To further validate these systems cell-specific control and temporal control will be tested. This will be accomplished with stable cell lines that produce the RBPs on a constitutively active prompter and an inducible promoter. Furthermore, to demonstrate disease-specific applications, an ON switch utilizing an aptamer corresponding to an RBP relevant to pancreatic cancer will be developed. Subsequently, it will be demonstrated that this switch facilitates translation solely in pancreatic cancer cells, underscoring its potential for targeted therapeutic interventions.

[0292] Section 2: Achieve cell-specific and temporal control of translation by utilizing an mRNA destabilizing switch triggered by RBPs. A translational OFF switch has been achieved with the BIV Tat RBP where translation occurs normally without the RBP, but when the RBP is present, an HHR is thermodynamically favored to form, destabilizing the mRNA, and leading to decreased translational levels. To build on this, the library of OFF switches and their corresponding RBPs will be expanded. The switches will then be tested for cell-specific and temporal control using stable cell lines that produce the RBPs on a constitutively active prompter and an inducible promoter.

[0293] Section 3: Demonstrate increased control of translation using stabilizing and destabilizing switches with logic gates. This section will showcase higher-order logic by implementing an AND gate, requiring the presence of two or more RBPs for translation to occur with the use of two or more stabilizing switches. Moreover, higher-order logic will be implemented in the form of a NOR gate, requiring the presence of one or more RBPs to halt translation with the use of two or more destabilizing switches. Stabilizing and destabilizing switches will then be combined to demonstrate A AND NOT B logic.Strategy

[0294] mRNA has gained significant attention over the past decade for its vast potential in disease prevention and treatment.1,2The development of mRNA COVID vaccines has been a pivotal breakthrough, saving countless lives and highlighting one of mRNA's practical applications.8Beyond vaccines, ongoing research explores many other mRNA applications, from protein replacement therapies to disease treatments. The appeal of mRNA lies in its numerous advantages, including rapid development, efficacy, potent immune response, safety profile, and versatility.9However, while mRNA holds promise for disease treatments, these applications often present greater challenges thanvaccines, as they may cause more pronounced side effects, including systemic reactions and immune responses.10Enhanced precision in treatment localization and temporal regulation of mRNA therapies could mitigate many of these potential side effects, underscoring the need for advanced delivery systems and regulatory mechanisms.

[0295] In mRNA therapies, controlling the lifespan of mRNA is crucial for optimizing therapeutic outcomes and ensuring safety. Currently, mRNA stability is regulated through modifications such as the addition of cap structures and polyadenylation, which help protect mRNA from degradation and prolong its lifespan within cells. However, these mechanisms provide limited control over mRNA stability, necessitating the development of more precise regulatory strategies.5Introducing proteins that act as termination switches or stabilizers offers a means to exert tighter control over mRNA lifespan, permitting researchers to modulate protein expression levels with greater accuracy. This enhanced control is essential for managing potential safety risks associated with the overexpression of therapeutic proteins, ensuring controlled responses to treatment, and providing flexibility in therapy design.11 12By fine-tuning mRNA stability through the incorporation of regulatory proteins, researchers can advance the development of mRNA-based therapies and expand their clinical applicability across various diseases.

[0296] In addition to controlling mRNA stability, leveraging proteins for cell-specific delivery of mRNA therapies is crucial for optimizing therapeutic efficacy and minimizing off-target effects. Currently, targeted delivery of mRNA therapies is being achieved through various strategies such as lipid nanoparticles, cell-penetrating peptides, or antibody-mediated targeting.3’413 14However, these approaches may still suffer from limitations such as off-target effects and inefficient delivery to specific cell types. Targeting specific cell types or tissues can enhance the precision of treatment, ensuring that therapeutic proteins are delivered directly to the intended site of action. By harnessing proteins such as biomarker proteins for cell-specific delivery, researchers can enhance the therapeutic index of mRNA therapies, improve patient outcomes, and reduce the potential for adverse events, ultimately advancing the clinical utility of this promising therapeutic modality.15 16

[0297] To regulate mRNA stability, whether through proteins or alternative methods, a means of modulating stability must first be established. Hammerhead ribozymes (HHR) can aid with this modularity. HHR are RNA sequences capable of forming distinct secondary and tertiary structures. When combined with the appropriate magnesium levels, these structures trigger a self-cleavage reaction.17 18 19There are many forms of self-cleaving ribozymes, but previous works have optimized the type III HHR for fast cleavage kinetics.6A typical mRNA strand possesses several key features, including a 3’ polyadenylate (poly-A) tail, shielding it from degradation in the cytoplasm. Placing an HHR downstream of the encoded gene but before the poly-A tail enables it to cleave the poly-A tail from the mRNA strand, initiating its degradation before translation (Figure 2). In essence, HHR cleavage destabilizes the mRNA strand, halting translation.6

[0298] To regulate mRNA with proteins, a connection between them is essential, a role fulfilled by RNA binding proteins (RBPs). RBPs are proteins or peptides capable of binding to specific RNA structures known as aptamers.7RBPs can occur naturally, exemplified by viral peptides like BIV Tat, P22N, and MCP.20,21,22’23Alternatively, RNA aptamers can be selected for particular proteins using techniques like Systematic Evolution of Ligands by Exponential enrichment (SELEX).24This versatility allows RBPs involved in mRNA stability regulation to be either exogenous or biomarker proteins specific to diseases or cell types. Depending on the placement of aptamers within mRNA strands, RBPs can also disrupt nearby RNA structures.9Described herein is the strategically positioning of Hammerhead ribozymes (HHR) and RNA aptamers in the 3 ’ UTR of mRNA strands, which can regulate mRNA stability and consequently translation. By integrating HHR and RBP aptamers into an aptamer ribozyme equilibrium shifting (ARES) RNA circuit, one can achieve generalizable switches for mRNA stabilization and destabilization, controlled by RBPs.Approach

[0299] Described herein is the development of several RNA stabilizing switches that act as translational ON switches. These ON switches are placed in the 3’ UTR of a gene before the poly-A tail and can be turned on with the presence of the corresponding RBP. All the switches that have been developed and tested follow the same general mRNA design pattern that capitalizes on an aptamer ribozyme equilibrium shift (ARES) (Figure 3). In these designs, the ARES region comprises an aptamer upstream followed directly by an HHR. Part of the base stem of the aptamer and the base stem of the ribozyme share the same domain (domain “b”). This means that the downstream end of the aptamer base stem is the same as the upstream HHR base stem. By sharing this region both structures are likely to form, however, at any moment only the aptamer or the HHR can be fully formed. There is an additional domain at the top of the aptamer base stem (domain “a”) that can be shortened or lengthened or its sequence composition modified (e.g., change the GC content without modifying the length) to increase the thermodynamic likelihood that the aptamer is formed compared to the HHR. These additional paired bases also serve as a toehold to shift the mRNA structure into the aptamer formation. This means that the base pairing in domain “a” increases the probability of the rest of the aptamer base stem forming with domain “b” as it brings the paired bases in stem “b” closer together and makes their pairing more favorable. Similar to domain “a”, there is also domain “c” which is found at the top of the HHR base stem which provides the HHR with a toehold and, depending on its length, or sequence composition, or combination of length and sequence composition, serves to increase or decrease the probability of the HHR being formed over the aptamer structure. When the corresponding RBP to the aptamer is present, it can bind the aptamer structure, shifting the equilibrium of the ARES system away from the HHR and allowing for normal translationto occur. When the RBP is not present and the HHR is formed, a self-cleavage reaction occurs separating the poly- A tail from the mRNA strand, leading to the degradation of the mRNA stand.

[0300] When first designing the ARES switches the optimal lengths of domain “a”, “b”, and “c” were unknown. Furthermore, it was not understood how much the aptamer or HHR structure should be favored over the other. To gain a better idea of how these domains would affect the equilibrium shifting mechanism and which ones might be the most optimal ON switch, the programs MATLAB and NUPACK were used to generate models of RNA strands that varied the three domains with the aptamer BIV Tar that corresponds to the RBP BIV Tat (BT). The “a” and “c” domains ranged from 0- 4 nucleotides (nt) and the “b” domain ranged from 5-7 nt. These lengths were chosen so that the overall stem length (“a” and “b” or “b” and “c”) was short enough to allow the equilibrium shifting between the two formations to be fast. Furthermore, the lengths of “a” and “c” were chosen to give a slight advantage to their corresponding structures but not so overpowering that only one structure would form. The model output showed a range of structures, some of which favored the HHR forming, the aptamer forming, or an intermediate structure (Figure 4). From these models, it is hypothesized that switches favoring the HHR formation would result in cleavage and RNA degradation before the aptamer could form and be stabilized by the RBP. On the other side, designs that favored the aptamer forming would allow for translation without the RBP present as the HHR would struggle to form and cleave the RNA. Therefore, an intermediate design would give the best chances for a functional ON switch.

[0301] To test the modeling and predicted outcomes, 46 of the designs that ranged in predicted structure formation were then cloned into the 3 ’ UTR of a GFP gene after the stop codon and before the poly-A tail. Additionally, the RBP BIV Tat was linked to a larger protein, maltose binding protein (MBP), using a G4SG4 linker where MBP was on the N terminus. This was to provide the system with more steric hindrance. They were then tested in HEK293T cells using transient DNA plasmid transfection. A second plasmid containing the corresponding RBP was co-transfected with the ARES designs to evaluate the ON signal from the designs. To evaluate the OFF signal the second plasmid only contained the MBP. The fluorescents expression was analyzed using flow cytometry and a third plasmid containing mCherry was used as a transfection and normalizing marker.

[0302] The results showed ON / OFF ratios between 1.04 and 2.38 (Figure 5A). When comparing the ON / OFF ratios to the model two statistics were used, the Gibbs free energy of the HHR forming and the Gibbs free energy of the aptamer forming. These two statistics describe how likely the RNA is to form the HHR or aptamer structure given that the HHR or aptamer structure is the target structure. The correlation between the two statistics and the ON / OFF ratio was not very strong, but a general trend can still be observed showing that as the probability of the HHR forming increases the ON / OFF ratio decreases (Figure 5B, 5C). This general trend was expected as well as another trend between the percent leakage of each switch and the Gibbs free energy of the HHR forming. Here 100% leakagerepresents the full MFI GFP signal and 0% represents no GFP signal, with no RBP present. This correlation showed that as the likelihood of the HHR forming decreases, the leakage of the circuit increases (Figure 5D). This makes sense as the HHR needs to form and cleave before the ribosome starts translation, but if the HHR formation is hindered by a stronger aptamer formation there will be some translational leakage.

[0303] The library of RBPs was expanded to include P22N and MCP with their corresponding aptamers P22 boxB and MS2. The design of these switches considered the trends found with the BT switches. 48 switches were cloned into the 3’ UTR of the GFP gene for P22N and 12 for MCP. They were then tested in the same manner as the BT switches including the linkage of MBP to P22N. These switches showed similar ON / OFF ratios as the BT switches with P22N ranging from 0.96 to 2.06 and MCP ranging from 1.26 to 2.04 (Figure 6A, 6B). The amount of successful P22N designs was significantly less than the BT designs likely owing to P22N’s increased Kd value (230 pM) compared to BT (60 pM).7

[0304] After finding successful switches for all three RBPs, the next focus went to optimizing the triggers. The largest concern with the switches at this point is the amount of leakage when there are no RBPs present. For most applications of the ON switches very minimal to no leakage is required. In these ON switches the leakage amount is consistently higher than 6% with some leaking as much as 20%. One way to minimize the leakage in these designs would be to add more opportunities for the HHR to form and cleave the mRNA. To do this in a way that does not compromise the RBP’s ability to prevent cleavage and allow translation is to concatenate several of the ARES switches together in the 3’ UTR (Figure 7A). By doing this concatenation just once (meaning there are two ARES switch units in the same 3’ UTR), leakage was minimized by 11% while maintaining a similar ON / OFF ratio for one of the BT switches (Figure 7B). Similar results were seen with P22N and MCP switches. The decrease in leakage was highly dependent on the switch itself with some showing no change in leakage level after concatenation. By concatenating 3 or more switches together, the leakage level will likely drop even further.

[0305] An ARES OFF switch was also produced (Figure 8). This switch is also placed in the 3’ UTR after the stop codon and before the poly-A tail. When the RBP of interest is present it causes the mRNA to be degraded, preventing further translation. This OFF switch is another form of the ARES design, but unlike the ON switch, there is an additional stem loop structure involved. For these designs, the aptamer is still furthest upstream followed by the new step loop structure and lastly by the HHR. The base of the stem loop structure is made up of domain “b” This domain is also shared with the base stem of the aptamer and the HHR. Domain “b” is what will allow either both the aptamer and the HHR to be fully formed at one time or the middle stem loop structure will be fully formed. There is still domain “a” at the top of the base stem structure for the aptamer and domain “c” at the top of the base stem structure for the HHR. The stem loop also has a domain “d” at the top of its stem toprovide a toehold and to shift the likelihood of the stem forming versus the aptamer and HHR. When there is no RBP present both the stem loop structure and the aptamer and HHR structures can be formed however there will be constant equilibrium shifts between these two phases that will prevent the HHR from being formed long enough to have a self-cleavage reaction, meaning translation can occur normally. When the RBP of interest is introduced then it can bind the aptamer structure making it more difficult for the stem loop structure to pull on the aptamer and HHR structures. This will allow enough time for the HHR to form and cleave the poly-A tail off. Once the mRNA strand is without the poly-A tail it will be degraded, and no more translation will occur.

[0306] To determine the most optimal lengths for domains “a”, “b”, “c”, and “d” designs were first modeled in MATLAB with NUPACK using the BT aptamer. This time domains “a”, “c”, and “d” ranged from 0-4 nt and domain “b” varied from 5-7 nt. The results of the model included designs that favored the stem loop structure, the aptamer and HHR structures, and intermediates (Figure 9A). 83 of these designs were cloned into the 3 ’ UTR of GFP and then the DNA was transiently transfected into HEK293T cells. They were co-transfected with a second plasmid containing either BT linked to the MBP or just the MBP as well as a third plasmid containing mCherry for a transfection marker. The fluorescent expression was analyzed using flow cytometry. The ON / OFF ratios ranged from 0.29 TO 1.93 with most worked as poor ON switches (Figure 9B, 9C). Here ON represents the GFP signal when no RBP is present. However, 7 designs showed an ON / OFF ratio above 1.40. Because only a small number of designs showed a good ON / OFF ratio it was difficult to determine any trends that would help predict good OFF stitch designs.Section 1 : Attain cell-specific and temporal control of translation through mRNA stabilizing switch triggered by RBPs.

[0307] This section will deliver an optimized translational ON switch. These switches will control the translation by stabilizing mRNA when a certain RBP of interest is present but destabilizing the mRNA when it is not. Thus far, the ARES ON switches have been successfully developed with three RBP triggers. To complete this section further optimization of the switches is required. Furthermore, the switches will be tested for cell-specific translation and temporal control. Additionally, an ARES ON switch will be developed with aptamers that are specific to proteins upregulated in pancreatic cancer cells.

[0308] Section 1.1 - Develop translational ON switch with exogenous RBPs.

[0309] Preliminary results have achieved several working translational ON switches that can be triggered by three different RBPs, BT, P22N, and MCP. The final task for this sub section is to optimize the switches for real-world applications meaning the leakage level needs to be reduced. Work has been done to decrease the level of leakage in the switches by concatenating two switches together. To continue to build off this initial optimization, different combinations of switches, alltriggered by the same RBP, will be tried and additional concatenations will also be tested. A threshold of 2% leak is ideal as this is a benchmark set in previous works that use the HHR.6

[0310] Section 1.2 - Demonstrate cell-specific translation.

[0311] To show cell-specific translation by the ON switch stable cell lines using HEK293T cells will be made to express BT-MBP or MCP-MBP. These cell lines will be made with Lentivirus and correct integration selected for puromycin resistance. Then using DNA transient transfection switches containing the BT aptamer will be transfected into HEK293T cells and HEK293T cells expressing BT. The same will be repeated with MCP -expressing cells and MS2 aptamer switches. A successful cell-specificity test will show a higher fluorescence signal in cells expressing the RBP compared to cells without the RBP (Figure 10). If this trend is not seen it could be due to a low expression of the RBPs or not enough switch was transfected. Solutions to these pitfalls can include changing the promoter on the RBP to increase production in the cells and to increase the amount of switch transfected into the cells.

[0312] Section 1.3 - Demonstrate temporal control.

[0313] Temporal control will be demonstrated using inducible expression of the RBP. A stable cell line that expresses BT-MBP or MCP-MBP upon tetracycline induction will be developed with lentivirus and correct integration selected for puromycin resistance. Then, using DNA transient transfection switches will be transfected into HEK293T cells and HEK293T cells that express the corresponding RBP under tetracycline induction. A group of the cells will be induced with tetracycline and after some time cells will be tested for fluorescence. Once fluorescence is higher in cells with tetracycline induction, the tetracycline will be removed from the system and the RBP will stop being produced by the cell. When this occurs, the mRNA will destabilize again, and translation will turn ON. This section will be successful if there is an increased fluorescent signal in cells induced to produce the RBP and then a decrease in fluorescence after the removal of tetracycline (Figure 11). For this to work a degradation tag will also have to be introduced on GFP and the RBP. Potential pitfalls include low expression of the RBPs and not enough of the switch being transfected. To solve these problems the RBPs can be transiently transfected with an inducible promoter to increase the amount produced. Furthermore, the amount of switch DNA being transfected can be optimized.

[0314] 1.4 - Develop pancreatic cancer-specific ARES ON switch.

[0315] An ARES ON switch will be developed with aptamers that are specific to proteins upregulated in pancreatic cancer cells. There are several candidates from previous works to choose from.26’27’28’29These will go through the same process as the existing ON switches where they will first be modeled in MATLAB and NUPACK. These switches will then be tested against pancreatic cancer cell lines with DNA transient transfection to show that they can provide cell-specific translation. This section will be established once the ON shows a higher fluorescent signal in pancreatic cancer cells than in normal pancreatic cells. The largest pitfail facing this section is if the ON switch is still turnedon in regular pancreatic cells meaning before upregulation in cancer cells, the targeted protein was in a high enough concentration to stabilize the ON switch. To address this, multiple RBPs with known aptamers specific to pancreatic cancer will be tested.

[0316] As a non-limiting example, the Iron responsive protein (IRP) and its aptamer the Iron responsive element (IRE) will be tested in a pancreatic cancer-specific ARES ON switch. The IRP responds to iron levels in the cell. This pair is specific to pancreatic cancer because iron is at a higher concentration in pancreatic cancer cells than healthy pancreatic cell. The IRE / IRP pair for ARES can also be used in other diseases that have an increase in iron concentration, including but not limited to ovarian cancer, lung cancer, or Chronic Obstructive Pulmonary Disease (COPD).Section 2: Achieve cell-specific and temporal control of translation by utilizing an mRNA destabilizing switch triggered by RBPs.

[0317] This section will deliver a translational OFF switch by destabilizing the mRNA that has the switch with a specific RBP. To date a translational OFF switch that uses BT as the trigger RBP has been successfully developed. To complete this section the library of switches will be expanded to encompass more RBPs including MCP. Furthermore, cell-specific translation and temporal control will also be demonstrated.

[0318] Section 2.1 - Develop translational OFF switch.

[0319] With only a single translational OFF switch developed, at least one more will be produced to complete this sub-section. To accomplish this MATLAB and NUPACK will be used to model an ARES OFF switch that utilizes the MS2 aptamer. A selection of these designs will be cloned into the 3’ UTR of the GFP gene and tested with DNA transient transfection in HEK293T cells. Functional switches will show a decreased GFP signal in cells transfected with the MCP compared to cells with only the switch. As no trends were seen with the functional BT switches tested a large range of designs will be tested here. If no successful designs are found a second round of modeling will be done with different domain lengths for domains “a”, “b”, “c”, and “d” and then tested. If there are still no successful designs other aptamers and RBPs can be tried including P22N.

[0320] Section 2.2 - Demonstrate cell-specific translation.

[0321] Cell-specific translation will be demonstrated with HEK293T cells that stably express BT. The BT translational OFF switch will be transfected into cells that produce BT and cells that do not. A successful experiment will show a higher fluorescent signal in cells without BT compared to cells that produce BT (Figure 12). If this trend is not seen it could be due to a low expression of the RBPs. Solutions to these pitfalls can include changing the promoter on the RBP to increase production in the cells and to increase the amount of switch transfected into the cells.

[0322] Section 2.3 - Demonstrate temporal control.

[0323] Temporal control will be demonstrated with HEK293T cells that produce BT when induced with tetracycline. The developed BT OFF switch will be transfected into these cells then select groups of cells will then be induced with tetracycline to produce BT. A successful result will show that cells before being induced show a fluorescent signal. After being induced, the fluorescent signal will decrease (Figure 13). To see this decrease in fluorescence the GFP protein being expressed will also be linked to a degradation tag so a better signal corresponding to mRNA stability can be observed. Potential pitfalls include low expression of the RBPs and not enough of the switch being transfected. To solve these problems the RBPs can be transiently transfected with an inducible promoter to increase the amount produced.Section 3: Demonstrate increased control of translation using stabilizing and destabilizing switches with logic gates.

[0324] Section Three will show the plug-and-play options of the ARES ON and OFF switches by developing logic gates to gain further control over mRNA stability. These gates will consist of AND, OR, and A AND NOT B and will be developed using previously established stabilizing and destabilizing switches.

[0325] Section 3.1 - Increase switch complexity with AND logic gate.

[0326] To increase the amount of control over translation AND gates will be developed. These gates will require two or more RBPs to be present to turn translation ON. This will be accomplished by concatenating ARES switches together that have aptamers corresponding to different trigger RBPs (Figure 14). These AND gate switches will then be transfected into HEK293T cells along with no RBPs, one of the RBPs, or both RBPs. A successful AND switch will only show increased fluorescence in cells that have both RBPs. The largest challenge will be to find the best switch combinations so multiple BT, P22N, and MCP switches will be tested.

[0327] Section 3.2 - Increase switch complexity with NOR logic gate.

[0328] To increase the user’s ability to turn OFF translation a NOR logic gate will be developed with the ARES OFF switches. This will be done in the same fashion as the AND logic gate where two or more ARES OFF stitches corresponding to different RBPs will be concatenated together (Figure 15). Then only one of the RBPs needs to be present to destabilize the mRNA, stopping translation. This will be tested by transfecting the NOR gates into HEK293T cells along with no RBPs, one of the RBPs, or both RBPs. A successful NOR switch will show lower fluorescence in cells that have one or both RBPs. The largest challenge will be to find the best switch combinations so multiple BT and MCP switches will be tried and in multiple orders of concatenation.

[0329] Section 3.3 - Increase switch complexity with A AND NOT B logic gate.

[0330] Another layer of control can be developed with an A AND NOT B gate. This will be done by concatenating an ARES ON switch with an ARES OFF switch (Figure 16). Once these gates aredeveloped, they will be transfected into HEK293T cells along with no RBP, one of the RBPs, or both RBPs. The fluorescence signal will be high when only the RBP corresponding to the ARES ON switch is present. If neither RBP is present or the RBP corresponding to the ARES OFF switch is present, then there will be no fluorescence. Just with the OR and AND gates, the largest challenge will be to find the best switch combinations so multiple ARES ON and OFF switches will be tried. Both orders of ARES ON and ARES OFF switches will be tested as well.References

[0331] 1. Qin, S., Tang, X., Chen, Y. et al. mRNA-based therapeutics: powerful and versatile tools to combat diseases. Sig Transduct Target Ther 7, 166 (2022).

[0332] 2. Chehelgerdi, M., Chehelgerdi, M. The use of RNA-based treatments in the field of cancer immunotherapy. Mol Cancer 22, 106 (2023).

[0333] 3. Fenton, Owen S et al. “Synthesis and Biological Evaluation of Ionizable LipidMaterials for the In Vivo Delivery of Messenger RNA to B Lymphocytes.” Advanced materials (Deerfield Beach, Fla.) vol. 29,33 (2017): 10.1002 / adma.201606944.

[0334] 4. Geall, Andrew J et al. “Nonviral delivery of self-amplifying RNA vaccines.”Proceedings of the National Academy of Sciences of the United States of America vol. 109,36 (2012): 14604-9.

[0335] 5. Wiedermannova, Jana et al. “The expanding field of non-canonical RNA capping: new enzymes and mechanisms.” Royal Society open science vol. 8,5 201979. 19 May. 2021.

[0336] 6. Zhong, G., Wang, H., He, W. et al. A reversible RNA on-switch that controls gene expression of AAV-delivered therapeutics in vivo. Nat Biotechnol 38, 169-175 (2020).

[0337] 7. Bayer, Travis S et al. “Arginine -rich motifs present multiple interfaces for specific binding by RNA.” RNA (New York, N.Y.) vol. 11,12 (2005): 1848-57.

[0338] 8. Hinder, Ahmet et al. “Making the Next Generation of Therapeutics: mRNA MeetsSynthetic Biology.” ACS synthetic biology vol. 12,9 (2023): 2505-2515.

[0339] 9. Wroblewska, L., Kitada, T., Endo, K. et al. Mammalian synthetic circuits with RNA binding proteins for RNA-only delivery. Nat Biotechnol 33, 839-841 (2015).

[0340] 10. Wang, YS., Kumari, M., Chen, GH. et al. mRNA-based vaccines and therapeutics: an in-depth survey of current and upcoming clinical applications. J Biomed Sci 30, 84 (2023).

[0341] 11. Rossignoli, Filippo et al. “Developing and characterizing a two-layered safety switch for cell therapies.” Cancer biology & therapy vol. 24,1 (2023): 2232146.

[0342] 12. Bashor, C.J., Hilton, I.B., Bandukwala, H. et al. Engineering the next generation of cell-based therapeutics. Nat Rev Drug Discov 21, 655-675 (2022).

[0343] 13. Kim, Yelee et al. “The Potential of Cell-Penetrating Peptides for mRNA Delivery toCancer Cells.” Pharmaceutics vol. 14,6 1271. 15 Jun. 2022.

[0344] 14. Van Hoecke, L., Roose, K. How mRNA therapeutics are entering the monoclonal antibody field. J Transl Med 17, 54 (2019).

[0345] 15. Li, Y., TAM, W.W., Yu, Y. et al. The application of Aptamer in biomarker discovery.Biomark Res 11, 70 (2023).

[0346] 16. Jiang, L., Lin, X., Chen, F. et al. Current research status of tumor cell biomarker detection. Microsyst Nanoeng 9, 123 (2023).

[0347] 17. Scott, William G et al. “The hammerhead ribozyme: structure, catalysis, and gene regulation.” Progress in molecular biology and translational science vol. 120 (2013): 1-23.

[0348] 18. Xiang, J.S., Kaplan, M., Dykstra, P. et al. Massively parallel RNA device engineering in mammalian cells with RNA-Seq. Nat Commun 10, 4327 (2019).

[0349] 19. Jacobs, J., Ciccaglione, K., Tournier, V. et al. Implementation of the CRISPR-Cas9 system in fission yeast. Nat Commun 5, 5344 (2014).

[0350] 20. Athanassiou, Zafiria et al. “Structural mimicry of retroviral tat proteins by constrained beta-hairpin peptidomimetics: ligands with high affinity and selectivity for viral TAR RNA regulatory elements.” Journal of the American Chemical Society vol. 126,22 (2004): 6906-13.

[0351] 21. Cocozaki, Alexis I et al. “The RNA-binding domain of bacteriophage P22 N protein is highly mutable, and a single mutation relaxes specificity toward lambda.” Journal of bacteriology vol. 190,23 (2008): 7699-708.

[0352] 22. Johansson, H E et al. “A thermodynamic analysis of the sequence-specific binding ofRNA by bacteriophage MS2 coat protein.” Proceedings of the National Academy of Sciences of the United States of America vol. 95,16 (1998): 9244-9.

[0353] 23. Sachdeva, Gairik et al. “In vivo co-localization of enzymes on RNA scaffolds increases metabolic production in a geometrically dependent manner.” Nucleic acids research vol. 42,14 (2014): 9493-503.

[0354] 24. Chai, Chenglin et al. “SELEX (Systematic Evolution of Ligands by ExponentialEnrichment), as a powerful tool for deciphering the protein-DNA interaction space.” Methods in molecular biology (Clifton, N.J.) vol. 754 (2011): 249-58.

[0355] 25. Zadeh, J.N., Steenberg, C.D et al. “NUPACK: Analysis and design of nucleic acid systems.” J. Comput. Chem., 32 (2011): 170-173.

[0356] 26. Yoon, Sorah et al. “Targeted Delivery of C / EBPa-saRNA by RNA Aptamers ShowsAnti-tumor Effects in a Mouse Model of Advanced PDAC.” Molecular therapy. Nucleic acids vol. 18 (2019): 142-154.

[0357] 27. Yoon, Sorah et al. “Blind SELEX Approach Identifies RNA Aptamers That RegulateEMT and Inhibit Metastasis.” Molecular cancer research : MCR vol. 15,7 (2017): 811-820.

[0358] 28. Xiang, Q., Tan, G., Jiang, X. et al. Suppression of FOXM1 Transcriptional Activities via a Single-Stranded DNA Aptamer Generated by SELEX. Sci Rep 7, 45377 (2017).

[0359] 29. Varshney, Akhil et al. “Identification of an RNA aptamer binding hTERT-derived peptide and inhibiting telomerase activity in MCF7 cells.” Molecular and cellular biochemistry vol. 427,1-2 (2017).Example 2: Aptamer and Ribozyme Equilibrium Shifting (ARES) RNA Circuits for Protein Sensing

[0360] Smart mRNAs that can sense proteins and respond by translating or inhibiting translation of its payload has transformative potential across medicine, synthetic biology, and biotechnology1 2. In therapeutics, such systems permit targeted protein therapy, allowing precise delivery of treatments only when a specific disease-associated protein is present, minimizing off-target effects. In engineered immune cells for cancer therapy, mRNA circuits can enhance T-cell responses by activating only in the presence of tumor markers.3,4Personalized medicine benefits from these responsive mRNA systems by tailoring treatments to an individual's protein expression profile.5Additionally, conditional expression systems allow for temporal control, such as a safety switch that prevents unintended persistence of delivered mRNA, improving safety in clinical applications.6

[0361] In synthetic biology, protein-sensing mRNAs serve as key components of cellular logic systems, permitting complex decision-making within cells based on protein levels. Metabolic engineering applications leverage these systems to fine-tune enzyme production for optimized biosynthesis pathways7,8. Diagnostics and biosensors use protein-responsive mRNAs to detect disease markers, offering real-time monitoring of health conditions both in vitro and in vivo.9In vaccines, mRNA-based strategies that sense immune signals can optimize antigen expression dynamically.1Moreover, these tools enhance the ability to study gene function by controlling protein expression in response to cellular conditions.10Altogether, protein-sensing mRNA expands the frontiers of biotechnology, improving therapeutic precision, research capabilities, and bioengineering strategies.

[0362] Proteins offer several advantages over RNA or small molecule sensing for controlling gene expression in therapeutic and synthetic biology applications. One key benefit is their higher specificity11. Proteins have well-defined three-dimensional structures and distinct binding sites that permit precise molecular recognition. This allows engineered mRNA circuits to distinguish between closely related molecules, reducing off-target effects compared to small molecules, which often interact with multiple cellular pathways. Additionally, proteins can serve as highly selective biomarkers for diseases, making them ideal for targeted therapies, diagnostics, and biosensors.12, 13Unlike RNA sensing, which may be confounded by sequence similarities, proteins provide a broader range of structural and functional diversity for designing responsive systems.

[0363] A particularly powerful advantage of protein-based sensing is the ability to detect single point mutations. By engineering RNA aptamers that specifically recognize mutated proteins ofinterest but ignore wild-type proteins, mRNA circuits can selectively respond to disease-associated mutations.13By targeting mutated proteins, rather than mutated transcripts, such systems can take advantage of the increased copy numbers of proteins in the cell and do not need to compete for target binding with ribosomes, RNA polymerases, and other RNA-binding proteins. This is especially useful in cancer therapy, genetic disorders, and personalized medicine, where distinguishing between normal and aberrant proteins is crucial. Such precision permits highly selective therapies that activate only in the presence of pathogenic mutations, minimizing damage to healthy tissues. Compared to other gene expression control methods including transcriptional regulation or chemically inducible promoters, protein-sensing mRNA provides a rapid, tunable, and mutation-sensitive approach, making it an invaluable tool for dynamic and context-dependent cellular control.14

[0364] To develop an mRNA sensor capable of responding to proteins, or their absence, a mechanism for modulating mRNA stability was first established. Hammerhead ribozymes (HHR) provide a valuable tool for this purpose. HHR are RNA sequences that can fold into distinct secondary and tertiary structures, which, in the presence of appropriate magnesium levels, trigger a self-cleavage reaction.15 16While various types of self-cleaving ribozymes exist, previous research has optimized type III HHR for rapid cleavage kinetics.17

[0365] A typical mRNA strand contains several key features, including a 3’ polyadenylate (poly- A) tail, which protects it from cytoplasmic degradation. By positioning an HHR downstream of the encoded gene but upstream of the poly-A tail, the ribozyme can cleave the tail from the mRNA strand, initiating degradation before translation occurs. Similarly, HHR-mediated destabilization can also be achieved in the 5 ’ untranslated region (5 ’ UTR) by placing the HHR between the protective 5 ’ cap and the start codon. In both cases, HHR cleavage disrupts mRNA stability, effectively preventing translation (Figure 17A, 17B).17

[0366] For mRNA to sense proteins, a connection between them is essential, a role fulfilled by RNA binding proteins (RBPs). RBPs are proteins or peptides capable of binding to specific RNA structures known as aptamers. RBPs can occur naturally, exemplified by viral peptides like BIV Tat, MCP, and PCP that bind specifically to their aptamers BIV Tar, MS2, and PP7 (Figure 17C).18, 19> 20Alternatively, RNA aptamers can be selected for particular proteins using techniques like Systematic Evolution of Ligands by Exponential enrichment (SELEX). This versatility allows RBPs involved in mRNA stability regulation to be either exogenous or biomarker proteins specific to diseases or cell types.21Depending on the placement of aptamers within mRNA strands, RBPs can also disrupt nearby RNA structures.22

[0367] In this technology, Hammerhead ribozymes (HHR) and RNA aptamers were strategically positioned in the 3 ’ UTR of mRNA strands to regulate mRNA stability and, consequently, translation in response to proteins. This approach, referred to herein as Aptamer Ribozyme Equilibrium Shifting (ARES) RNA circuits, is highly generalizable and can be applied across various protein-sensing contexts. It was also demonstrated that ARES elements can be inserted in the 5’ UTR mRNA region for protein sensing.Results

[0368] To develop the ARES switch, previously identified and well-characterized aptamer structures and their corresponding RNA-binding proteins (RBPs), including BIV Tat (BT), MCP, and PP7, were selected. In the mRNA strand, the aptamer is positioned upstream of a Hammerhead ribozyme (HHR), with both structures sharing a common nucleotide sequence at their base stems, referred to as domain “b”. This is the 3’ end for the aptamer and the 5’ end for the HHR. Due to this shared domain, only one structure can be fully formed at a given time (Figure 18A).

[0369] Additional domains fine-tune this equilibrium. Domain “a”, at the top of the aptamer base stem, is a toehold for the aptamer and can be adjusted in length to favor aptamer formation. Conversely, domain “c”, at the top of the HHR base stem, is a toehold for the HHR and influences the stability of the HHR structure. When the corresponding RBP binds the aptamer, it shifts the equilibrium away from the HHR, preventing self-cleavage and stabilizing the mRNA. In the absence of the RBP, the HHR forms and undergoes self-cleavage, removing the poly-A tail (if in the 3 ’ UTR) or 5’ cap (if in the 5’ UTR), leading to mRNA degradation.

[0370] In developing the ARES switches, the optimal domain lengths for effective switching was first determined. Using NUPACK, ARES switch sequences were generated with varying lengths of domain “a” and domain “c”, 0 to 4 nucleotides, and domain “b”, 5 to 7 nucleotides, for aptamers corresponding to the RBPs BT, PCP, and MCP.23Although these ARES switches featured “a” and “c” domain lengths of 0 to 4 nucleotides, the lengths of these domains could range from 0 to 8 nucleotides in general. Additionally, the “b” domain lengths could range from 2 to 12 nucleotides in general. To evaluate functionality, mCherry reporters were constructed containing a library of switches in the 3’ UTR, and they were transiently transfected into HEK293T cells alongside a separate plasmid expressing either the inert Maltose Binding Peptide (MBP) or the corresponding RBP.

[0371] Initial screening revealed minimal expression changes upon RBP co-transfection. To enhance activation, the RBPs were fused to MBP using a GS linker, increasing steric hindrance to better inhibit HHR self-cleavage. With this modification, the ARES switches demonstrated a broad range of functionality across all three RBPs, indicating improved responsiveness and tunability.

[0372] To determine the key factors contributing to optimal switch function, the defect levels and Gibbs free energy of both HHR and aptamer formation were analyzed for each switch. These metrics showed varying degrees of correlation with switch leakage levels and ON / OFF ratios (Table 10). Examining the PP7 aptamer ARES library, trends were identified that can guide the design of ARES switches with different aptamers. Notably, the Gibbs free energy of aptamer formationexhibited a strong linear correlation with the ON / OFF ratio, with an R-squared value of 0.72 (Figure 18B). Additionally, the defect level of the HHR correlated with switch leakage, following a hill function trend, with an R-squared value of 0.56 (Figure 18C).

[0373] Table 10: Spearman correlation values

[0374] These findings indicate that to develop a strong switch, it is crucial to maximize the Gibbs free energy of the aptamer (reducing its likelihood of forming) while minimizing the defect level of the HHR (increasing its stability). The best-performing switches for BT, PP7, and MS2 aptamers achieved ON / OFF ratios of 2.42, 5.10, and 8.39 in the 3’ UTR, with MS2 aptamers demonstrating the highest dynamic range (Figure 18D). Furthermore, when MCP protein was expressed in HEK293T cells alongside the ARES switch, expression levels closely matched those of positive controls, confirming effective switch activation.

[0375] These switches were also evaluated in the 5’ UTR, where placing the HHR upstream leads to stronger suppression of unwanted translation (Figure 19A). When HHR cleavage removes the 5’ cap, the translation initiation complex cannot form, completely blocking translation. In contrast, in the 3’ UTR, translation can continue until the mRNA is degraded after cleavage. Multiple MS2 and PP7 ARES switches were tested in the 5’ UTR, demonstrating that in the absence of the corresponding RBP, very few cells exhibited mCherry reporter signal. However, when the RBP was introduced, a marked increase in fluorescence was observed, confirming switch activation and robust control over translation (Figure 19B).

[0376] In addition to the original ARES switch design, a flipped design was tested for the MS2 and PP7 aptamer switches, where the HHR was placed upstream of the aptamer while still sharing domain “b” (Figure 19C). In this configuration, the HHR forms first during transcription,increasing the likelihood of cleavage before the aptamer can fold and establish equilibrium between the two structures. This design resulted in significantly lower leakage levels when the RBP was absent, improving baseline suppression. When the RBP was present, the flipped switches still demonstrated an increase in mCherry expression, confirming they retained functionality (Figure 19D). However, the maximum signal output was noticeably lower compared to the original designs, indicating that while the flipped design enhances repression, it may reduce overall dynamic range.

[0377] An additional approach to reducing ARES switch leakage in the 3’ UTR is by concatenating multiple ARES switches within the region (Figure 20A). This can involve placing multiple switches with the same aptamer in the 3’ UTR, which reduces leakage compared to a single ARES switch, while still allowing for activation when the RBP is present (Figure 20B, 20C). Additionally, concatenating ARES switches with different aptamers in the 3’ UTR can produce a digital-to-analog effect, where discrete input levels generate a range of output payload expression (Figure 20d). When both RBPs are present, the maximum expression of the payload is achieved, but if only the RBP corresponding to the upstream ARES switch is present, only about half the maximum signal is observed.

[0378] This analog-to-digital effect can also be seen when one ARES switch is placed in the 3’ UTR and another in the 5’ UTR (Figure 20E). In this case, when only the RBP for the 5’ UTR switch is present, approximately half the maximum signal is observed, demonstrating the versatility of concatenated ARES switches fortuning gene expression in a controlled, modular manner.

[0379] In addition to the ARES ON switch, two variations of an ARES OFF switch were developed. The first OFF switch design closely resembles the ON switch but includes an additional middle stem-loop structure, referred to as the stabilization stem, composed of domains “d” and “b”, positioned between an upstream aptamer and a downstream HHR (Figure 21 A). The upstream “b” domain is shared with the aptamer, while the downstream “b” domain is shared with the HHR, creating an equilibrium-shifting effect where either the aptamer and HHR forms or the stabilization stem. To optimize function, domain lengths for “a”, “b”, and “c” were kept consistent with the ON switch, while domain “d” was varied from 0 to 4 nt. Using the BT aptamer, the bestperforming switch showed that 25% of cells expressed GFP (the reporter) in the absence of BT, while only 8.3% expressed GFP when BT was present, confirming functional repression (Figure 21B)

[0380] The second OFF switch design introduced an additional upstream stabilization stem, creating a more balanced structure (Figure 21C). This upstream stabilization stem was formed by domains “d” and “b”, while the middle ON stem consisted of a separate “di” domain and the same “b” domain as the upstream stem. This design used the MS2 aptamer, with domain lengths optimized similarly to the first OFF switch. The best-performing switch showed a 12% decrease in mCherry expression when MCP was present (Figure 21D).

[0381] While the OFF switches did not perform as strongly as the ON switches, further domain length optimization can improve their function. Similarly to the ON switches the lengths of the “a” and “c” domains could range from 0 to 8 nucleotides, the “b” domain lengths could range from 2 to 12 nucleotides, and the “d” domain could range from 0 to 12 nucleotides in general.

[0382] Additionally, these tests were performed using transient DNA transfection, meaning mRNA was continuously transcribed. Testing the OFF switches as direct mRNA or self-amplifying RNA (saRNA) could enhance performance, as mRNA destabilization upon RBP binding would lead to a more immediate reduction in translation, potentially yielding more pronounced repression effects.Discussion and Conclusions

[0383] This study presents the development and characterization of Aptamer Ribozyme Equilibrium Shifting (ARES) RNA circuits as a novel mechanism for protein-responsive mRNA translation control. These findings demonstrate that ARES switches effectively regulate mRNA stability and translation through the interplay of RNA-binding proteins (RBPs), RNA aptamers, and Hammerhead ribozymes (HHR). The ability of these circuits to modulate gene expression dynamically in response to specific proteins has broad implications for therapeutic applications, synthetic biology, and biotechnology.

[0384] Through systematic variation of domain lengths and computational modeling, key parameters were identified influencing ARES switch performance. The Gibbs free energy of aptamer formation strongly correlated with the ON / OFF ratio, indicating that increasing aptamer stability reduces background leakage and enhances switch activation. Similarly, minimizing the defect level of the HHR structure improved switch repression, highlighting the importance of ribozyme stability in achieving robust control over mRNA degradation.

[0385] Multiple variations of the ARES switch were tested. First, placing the HHR in the 5’ UTR significantly reduced background expression, as cleavage of the 5’ cap completely blocked translation initiation. Second, a flipped switch configuration was investigated where the HHR was positioned upstream of the aptamer. This arrangement lowered leakage by promoting HHR cleavage early in transcription, though at the cost of reduced maximum activation. Finally, concatenating multiple ARES switches within the 3 ’ UTR decreased leakage while retaining activation in response to RBP binding, providing a modular approach for tuning gene expression.

[0386] In addition to ON switches, two ARES OFF switch designs were developed that repress translation in response to RBPs. The first OFF switch featured an equilibrium-shifting on stem between the aptamer and HHR, reducing translation upon RBP binding. The second design incorporated an additional upstream on stem, creating a more balanced structural equilibrium. Further optimization of domain lengths and testing in direct mRNA or self-amplifying RNA (saRNA) contexts could enhance repression efficiency.

[0387] The modular and programmable nature of ARES switches opens new avenues for applications in medicine and synthetic biology. In therapeutics, ARES circuits permit targeted mRNA therapies that activate only in the presence of disease-specific proteins, reducing off-target effects. Engineered immune cells could leverage these switches for precise activation in response to tumor markers, enhancing cancer immunotherapy. Additionally, ARES switches could be integrated into biosensors for real-time monitoring of protein biomarkers, improving diagnostic capabilities.

[0388] In summary, ARES RNA circuits provide a versatile and efficient approach to protein- responsive gene regulation. By leveraging aptamer-ribozyme interactions, these switches offer precise, tunable, and programmable control over mRNA translation, with significant potential for advancing biomedical and biotechnological applications.ARES OFF switch: Version 3

[0389] To enhance the functionality of the ARES OFF switch, described herein is a third variation that leverages ARES ON switches in combination with 3’ UTR stabilizing and destabilizing domains.24In this design, a stabilizing domain is placed immediately after the stop codon of the payload, followed by the ARES ON switch, and then a destabilizing domain positioned before the poly-A tail (Figure 22).

[0390] Under normal conditions, the presence of the destabilizing domain signals the transcript for degradation before translation can occur. When the RBP is present, it prevents HHR cleavage, ensuring that the degradation domain remains attached to the transcript, thereby maintaining its instability and preventing translation. Conversely, in the absence of the RBP, the HHR cleaves the degradation domain off the transcript. In this scenario, the stabilizing domain compensates for the loss of the poly-A tail, preventing further degradation and allowing translation of the payload to proceed.

[0391] This design aims to improve the effectiveness of the ARES OFF switch by introducing a more precise mechanism for regulating mRNA stability and translation in response to protein signals.Self-Amplifying RNA (saRNA)

[0392] To further expand the functionality of ARES technology, the switches are tested in selfamplifying RNA (saRNA). saRNA presents a promising application for ARES due to its potential to reduce dosage requirements and minimize the need for multiple injections in mRNA-based therapies.25Additionally, a key limitation of current ARES technology is the challenge of preventing HHR cleavage before the RNA reaches its intended sensing location. The unique replication cycle of saRNA offers an advantageous mechanism for delivering ARES switches (Figure 23A).

[0393] In the saRNA replication cycle, non-structural proteins (nsPs) are first translated to produce the RNA-dependent RNA polymerase (RdRp). The RdRp synthesizes a complementary negative -sense strand from the delivered saRNA. From this negative -sense strand, the RdRp generates both a full-length positive-sense saRNA strand and a positive-sense subgenomic strand. Translation ofthe payload occurs only from the subgenomic strand.25,26By integrating the ARES switch into the negative -sense strand, precise control can be gained over the timing and localization of payload expression while hindering the HHR activity during delivery.

[0394] For example, in the case of an ARES ON switch, the presence of the corresponding RBP would stabilize the negative-sense strand, allowing for the replication of the positive -sense strand and subsequent payload expression. Conversely, in the absence of the RBP, the HHR would cleave the negative strand, preventing the transcription of the positive strand and effectively blocking payload translation.

[0395] To implement this approach, the optimal placement of the HHR within the saRNA system is first determined. Four locations are being evaluated: (1) within the 5’ UTR before the 5’ conserved sequence element (CSE), (2) between the sub-genomic promoter and the payload, (3) between the payload and the 3’ (CSE), and (4) between the 3’ CSE and the poly-A tail (Figure 23B). Once the most effective location is identified, the top-performing ARES ON switches will be tested in this context to assess their functionality and regulatory efficiency.

[0396] Modified NTPs and / or proteins can be utilized in the initial in vitro transcription reaction to create the saRNA strand to prevent ribozyme cleavage until delivery to a cell. Chemical modifications (e.g., modified bases) can be introduced into the saRNA containing the ARES region(s) (e.g., in the sense direction) such that the modification disrupts the function of the ribozyme and ensures the complete saRNA is delivered into the cell without any ribozyme cleavage. As the saRNA is replicated in the cell, the RdRp will eventually synthesize positive sense saRNA copies that do not comprise chemical modifications (e.g., modified bases) and contain an active ribozyme so that the ARES regulatory functions are activated. Non-limiting examples of such modified bases include 5- hydroxymethylcytidine, 5 -methylcytidine, and / or 5 -methyluridine. Without wishing to be bound by theory, it is expected that at least the cytidine modifications (e.g., 5 -hydroxymethylcytidine and / or 5- methylcytidine) can disrupt function since the ribozyme self-cleavage site is immediately 3' of a cytosine.REFERENCES1. Qin, S., Tang, X., Chen, Y., Chen, K., Fan, N., Xiao, W., Zheng, Q., Li, G., Teng, Y., Wu, M., & Song, X. (2022). mRNA-based therapeutics: powerful and versatile tools to combat diseases. Signal transduction and targeted therapy, 7(1), 166.2. Ohner, E., Yang, R., Foo, K.S., Goedel, A., Chien, K.R (2022). Unlocking the promise of mRNA therapeutics. Nat Biotechnol 40, 1586-1600.3. Wroblewska, L., Kitada, T., Endo, K. et al. Mammalian synthetic circuits with RNA binding proteins for RNA-only delivery. Nat Biotechnol 33, 839-841 (2015). https : / / doi . org / 10.1038 / nbt .33014. Fesnak, A. D., June, C. H., & Levine, B. L. (2016). Engineered T cells: the promise and challenges of cancer immunotherapy. Nature reviews. Cancer, 16(9), 566-581.5. Molla, G., & Bitew, M. (2024). Revolutionizing Personalized Medicine: Synergy with Multi-Omics Data Generation, Main Hurdles, and Future Perspectives. Biomedicines, 12(12), 2750.6. Saw, P. E., & Song, E. (2024). Advancements in clinical RNA therapeutics: Present developments and prospective outlooks. Cell reports. Medicine, 5(5), 101555.7. Tinafar, A., Jaenes, K., & Pardee, K. (2019). Synthetic Biology Goes Cell-Free. BMC biology, 17(1), 64.8. Ono, H., & Saito, H. (2023). Sensing intracellular signatures with synthetic mRNAs. RNA biology, 20(1), 588-602.9. Flynn, C. D., Chang, D., Mahmud, A., Yousefi, H., Das, J., Riordan, K. T., Sargent, E. H., & Kelley, S. O. (2023). Biomolecular sensors for advanced physiological monitoring. Nature reviews bioengineering, 1-16. Advance online publication.10. Karagyaur, M., Primak, A., Efimenko, A., Skryabina, M., & Tkachuk, V. (2022). The Power of Gene Technologies: 1001 Ways to Create a Cell Model. Cells, 11(20), 3235.11. Dykstra, P. B., Kaplan, M., & Smolke, C. D. (2022). Engineering synthetic RNA devices for cell control. Nature reviews. Genetics, 23(4), 215-228.12. Zhu, W. S., Wheeler, B. D., & Ansel, K. M. (2023). RNA circuits and RNA-binding proteins in T cells. Trends in immunology, 44(10), 792-806.13. Jiang, H., Xi, H., Juhas, M., & Zhang, Y. (2021). Biosensors for Point Mutation Detection. Frontiers in bioengineering and biotechnology, 9, 797831.14. Self, W. K., Schoch, K. M., Alex, J., Barthelemy, N., Bollinger, J. G., Sato, C., Cole, T., Kordasiewicz, H. B., Swayze, E., Bateman, R. J., & Miller, T. M. (2018). Protein production is an early biomarker for RNA-targeted therapies. Annals of clinical and translational neurology, 5(12), 1492-1504.15. Bashor, C. J., Hilton, I. B., Bandukwala, H., Smith, D. M., & Veiseh, O. (2022).Engineering the next generation of cell-based therapeutics. Nature reviews. Drug discovery, 21(9), 655-675.16. Vlatkovic I. (2021). Non-Immunotherapy Application of LNP-mRNA: Maximizing Efficacy and Safety. Biomedicines, 9(5), 530.17. Bayer, T. S., Booth, L. N., Knudsen, S. M., & Ellington, A. D. (2005). Arginine-rich motifs present multiple interfaces for specific binding by RNA. RNA (New York, N.Y.), 77(12), 1848— 1857.18. Johansson, H. E., Dertinger, D., LeCuyer, K. A., Behlen, L. S., Greef, C. H., & Uhlenbeck, O. C. (1998). A thermodynamic analysis of the sequence-specific binding of RNA bybacteriophage MS2 coat protein. Proceedings of the National Academy of Sciences of the United States of America, 95(16), 9244-9249.19. Sachdeva, G., Garg, A., Godding, D., Way, J. C., & Silver, P. A. (2014). In vivo colocalization of enzymes on RNA scaffolds increases metabolic production in a geometrically dependent manner. Nucleic acids research, 42(14), 9493-9503.20. Athanassiou, Z., Dias, R. L., Moehle, K., Dobson, N., Varani, G., & Robinson, J. A. (2004). Structural mimicry of retroviral tat proteins by constrained beta-hairpin peptidomimetics: ligands with high affinity and selectivity for viral TAR RNA regulatory elements. Journal of the American Chemical Society, 126(22), 6906-6913.21. Chai, C., Xie, Z., & Grotewold, E. (2011). SELEX (Systematic Evolution of Ligands by Exponential Enrichment), as a powerful tool for deciphering the protein-DNA interaction space. Methods in molecular biology (Clifton, N.J.), 754, 249-258.22. Wroblewska, L., Kitada, T., Endo, K. et al. Mammalian synthetic circuits with RNA binding proteins for RNA-only delivery. Nat Biotechnol 33, 839-841 (2015).23. Zadeh, J. N., Steenberg, C. D., Bois, J. S., Wolfe, B. R., Pierce, M. B., Khan, A. R., Dirks, R. M., & Pierce, N. A. (2011). NUPACK: Analysis and design of nucleic acid systems. Journal of computational chemistry, 32(1), 170-173.24. Wroblewska, L., Kitada, T., Endo, K., Siciliano, V., Stillo, B., Saito, H., & Weiss, R. (2015). Mammalian synthetic circuits with RNA binding proteins for RNA-only delivery. Nature biotechnology, 33(8), 839-841.25. Silva-Pilipich, N., Beloki, U., Salaberry, L., & Smerdou, C. (2024). Self-Amplifying RNA: A Second Revolution of mRNA Vaccines against COVID-19. Vaccines, 12(3), 318.26. Bloom, K., van den Berg, F., & Arbuthnot, P. (2021). Self-amplifying RNA vaccines for infectious diseases. Gene therapy, 28(3-4), 117-129.Example 3: Exemplary Sequences

[0397] Tables 1-7 and 11 below contain exemplary ARES region sequences.

[0398] Table 1: Exemplary MS2 ON switches

[0399] Table 2: Exemplary MS2 OFF switches (with 2 stabilization stems)

[0400] Table 3: Exemplary PP7 ON switches

[0401] Table 4: Exemplary BIV Tar ON switches

[0402] Table 5: Exemplary BIV Tar OFF switches (with 1 stabilization stem)Ill

[0403] Table 6: Exemplary P22N ON switches

[0404] Table 7: Exemplary High-Performing ON and OFF switches

[0405] Table 11: Exemplary saRNA sequences

Claims

CLAIMSWhat is claimed herein is:

1. An RNA molecule comprising: a) an open reading frame (ORF) encoding at least one cargo polypeptide; and b) at least one untranslated region (UTR) comprising at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region, which comprises: i) a protein-binding aptamer that specifically binds to a target protein; and ii) a ribozyme.

2. The RNA molecule of claim 1, wherein the aptamer is selected from the group consisting of: a MS2 aptamer, a PP7 aptamer, a bovine immunodeficiency virus (BIV) transactivation response (Tar) aptamer, and a P22 aptamer.

3. The RNA molecule of claim 1 or 2, wherein the target protein is selected from: a) MS2 coat protein (MCP), which specifically binds to the MS2 aptamer; b) PP7 coat protein (PCP), which specifically binds to the PP7 aptamer; c) BIV trans-activator of transcription (Tat), which specifically binds to the BIV Tar aptamer; d) a P22 N protein, which specifically binds to the P22 aptamer.

4. The RNA molecule of any one of claims 1-3, wherein the ribozyme is a self-cleaving ribozyme.

5. The RNA molecule of claim 4, wherein the self-cleaving ribozyme is selected from the group consisting of: hammerhead ribozyme (HHR), hepatitis delta virus (HDV) ribozyme, hairpin ribozyme, Varkud satellite (VS) ribozyme, glmS ribozyme, twister ribozyme, twister sister ribozyme, Pistol ribozyme, Hatchet ribozyme, and Hovlinc ribozyme.

6. The RNA molecule of any one of claims 1-5, wherein the aptamer is 5' of the ribozyme in the ARES region.

7. The RNA molecule of any one of claims 1-6, wherein the aptamer is 3' of the ribozyme in the ARES region.

8. The RNA molecule of any one of claims 1-7, wherein the at least one ARES region is located in the UTR 5' of the ORF (5' UTR).

9. The RNA molecule of any one of claims 1-8, wherein the at least one ARES region is located in the UTR 3' of the ORF (3' UTR).

10. The RNA molecule of any one of claims 1-9, wherein at least one ARES region is located in 5' UTR, and at least one ARES region is located the 3' UTR.

11. The RNA molecule of any one of claims 1-10, wherein the at least one ARES region modulates the stability of the RNA molecule and / or modulates translation of the at least one cargo polypeptide encoded by the ORF.

12. The RNA molecule of any one of claims 1-11, wherein the at least one ARES region is an ON-switch ARES region structured such that either the aptamer or the ribozyme, but not both, can form at one time in the RNA molecule.

13. The RNA molecule of claim 12, wherein in an RNA molecule comprising an ON-switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, and the ORF can be translated (ON); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF).

14. The RNA molecule of claim 12 or 13, wherein the ON-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a complementary (b*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region in the ribozyme; and b) the ribozyme comprising: i) the secondary second (b2) region and the complementary (b*) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region.

15. The RNA molecule of claim 14, wherein the ON-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the complementary (b*) region that can hybridize to the primary second (bl) region in the aptamer or to a secondary second (b2) region in the ribozyme; e) the third (c) region; f) the complementary (c*) region that can hybridize to the third (c) region; and g) the secondary second (b2) region.

16. The RNA molecule of claim 14, wherein the ON-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region;b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (c) region; d) the complementary (b*) region that can hybridize to the secondary second (b2) region in the ribozyme or to a primary second (bl) region in the aptamer; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; and g) the primary second (bl) region.

17. The RNA molecule of any one of claims 1-16, which further comprises at least one stabilization domain.

18. The RNA molecule of any one of claims 1-17, which further comprises at least one degradation domain.

19. The RNA molecule of any one of claims 1-18, wherein the at least one ARES region is a stabilization / degradation ARES region, which comprises in the 3' UTR, from 5' to 3': a) a stabilization domain; b) the ON-switch ARES region of any one of claims 12-16; and c) a degradation domain.

20. The RNA molecule of claim 19, wherein in an RNA molecule comprising a stabilization / degradation ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme cannot form, the RNA molecule is not cleaved, the degradation domain is retained, the RNA molecule is degraded, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme can form, the RNA molecule is cleaved, the degradation domain is not retained, the stabilization domain protects the RNA molecule from degradation, and the ORF can be translated (ON).

21. The RNA molecule of any one of claims 1-20, wherein the at least one ARES region is an OFF-switch ARES region structured such that either both the aptamer and the ribozyme, or at least one stabilization stem, can form at one time in the RNA molecule.

22. The RNA molecule of claim 21, wherein in an RNA molecule comprising an OFF-switch ARES region: a) in the presence of the target protein, the aptamer is stabilized, the ribozyme can form, the at least one stabilization stem cannot form, the RNA molecule is cleaved, and the ORF cannot be translated (OFF); and / or b) in the absence of the target protein, the aptamer is not stabilized, the ribozyme cannot form, the at least one stabilization stem can form, the RNA molecule is not cleaved, and the ORF can be translated (ON).

23. The RNA molecule of claim 21 or 22, wherein the OFF-switch ARES region comprises:a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; and c) the at least one stabilization stem comprising: i) a fourth (d) region and a complementary (d*) region that can hybridize to the fourth (d) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer.

24. The RNA molecule of claim 23, wherein the OFF-switch ARES region comprises from 5' to 3': a) the primary second (bl) region; b) the first (a) region; c) the complementary (a*) region that can hybridize to the first (a) region; d) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the secondary second (b2) region; h) the third (c) region; i) the complementary (c*) region that can hybridize to the third (c) region; and j) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

25. The RNA molecule of claim 23, wherein the OFF-switch ARES region comprises from 5' to 3': a) the secondary second (b2) region; b) the third (c) region; c) the complementary (c*) region that can hybridize to the third (a) region;d) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region or to a primary second (bl) region; e) the fourth (d) region; f) the complementary (d*) region that can hybridize to the fourth (d) region; g) the primary second (bl) region; h) the first (a) region; i) the complementary (a*) region that can hybridize to the first (a) region; and j) the primary complementary (bl*) region that can hybridize to the primary second (bl) region.

26. The RNA molecule of claim 21 or 22, wherein the OFF-switch ARES region comprises 2 stabilization stems.

27. The RNA molecule of claim 26, wherein the OFF-switch ARES region comprises: a) the aptamer comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the ribozyme comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the ribozyme and the primary complementary (bl*) region of the aptamer; and d) a second stabilization stem comprising: i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the aptamer and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region.

28. The RNA molecule of claim 27, wherein the OFF-switch ARES region comprises from 5' to 3':a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; l) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

29. The RNA molecule of claim 26, wherein the OFF-switch ARES region comprises: a) the ribozyme comprising: i) a first (a) region and a complementary (a*) region that can hybridize to the first (a) region; and ii) a primary second (bl) region and a primary complementary (bl*) region that can hybridize to the primary second (bl) region or to a secondary second (b2) region; b) the aptamer comprising: i) the secondary second (b2) region and a secondary complementary (b2*) region that can hybridize to the secondary second (b2) region; and ii) a third (c) region and a complementary (c*) region that can hybridize to the third (c) region; c) a first stabilization stem comprising: i) a primary fourth (dl) region and a complementary (dl*) region that can hybridize to the primary fourth (dl) region; and ii) the secondary second (b2) region of the aptamer and the primary complementary (bl*) region of the ribozyme; and d) a second stabilization stem comprising:i) a secondary fourth (d2) region and a complementary (d2*) region that can hybridize to the secondary fourth (d2) region; and ii) the primary second (bl) region of the ribozyme and a tertiary complementary (b3*) region that can hybridize to the primary second (bl) region.

30. The RNA molecule of claim 29, wherein the OFF-switch ARES region comprises from 5' to 3': a) the tertiary complementary (b3*) region that can hybridize to the primary second (bl) region; b) the complementary (d2*) region that can hybridize to the secondary fourth (d2) region; c) the secondary fourth (d2) region; d) the primary second (bl) region; e) the first (a) region; f) the complementary (a*) region that can hybridize to the first (a) region; g) the primary complementary (bl*) region that can hybridize to the primary second (bl) region or to the secondary second (b2) region; h) the primary fourth (dl) region; i) the complementary (dl*) region that can hybridize to the primary fourth (dl) region; j) the secondary second (b2) region; k) the third (c) region; l) the complementary (c*) region that can hybridize to the third (c) region; and m) the secondary complementary (b2*) region that can hybridize to the secondary second (b2) region.

31. The RNA molecule of any one of claims 1-30, wherein the at least cargo polypeptide is selected from: a) a detectable marker (e.g., a fluorescent polypeptide); b) an antigen (e.g., severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) spike gene, respiratory syncytial virus (RSV) F protein, influenza hemagglutinin, a tumor associated antigen (e.g., New York esophageal squamous cell carcinoma 1 for melanoma, kallikrein-2 for prostate cancer); an antibody (e.g., a monoclonal antibody; e.g.., an anticlaudin 18 isoform 2 (anti-CLDN18.2, which is specific for tumors) antibody, anti -cytotoxic T-lymphocyte-associated protein 4 (anti-CTLA-4) or anti-glucocorticoid-induced tumor necrosis factor receptor (TNFR)-related protein (anti-GITR) antibodies, which are specific for melanoma); c) a cytokine (e.g., IL-2, IL-7, IL-12, OX40L, IL-23);d) a cell therapy protein (e.g., claudin-6 (CLDN6), a chimeric antigen receptor (CAR) protein, a T cell receptor); e) a tumor suppressor protein (e.g., tumor protein 53 (p53), breast cancer gene 1 (BRCA1), breast cancer gene 2 (BRCA2)); f) a programmed cell death protein (e.g., Bax, a caspase); g) a site-specific nuclease (e.g., Cas9; a prime editing enzyme (e.g., PE2, PE3, PE4, PE5, PE2max, PE3max, and the like); h) a therapeutic protein (e.g., vascular endothelial growth factor (VEGF), Glucagon- like peptide- 1, insulin); or i) an oncogene (e.g., mutant forms of KRAS, HRAS, EGFR, HER2, PDGFR, MYC, BRCA1, BRCA2, ABL1, VEGF).

32. The RNA molecule of any one of claims 1-31, which is a messenger RNA (mRNA), further comprising a 5' cap and a 3' polyA tail.

33. A self-amplifying RNA (saRNA) comprising the RNA molecule of any one of claims 1-32, which further comprises a second open reading frame encoding an RNA-dependent RNA polymerase.

34. A self-amplifying RNA (saRNA) comprising from 5' to 3': a) a 5' conserved sequence element (CSE); b) a first open reading frame (ORF) encoding an RNA-dependent RNA polymerase (RdRP), operably linked to a promoter in the 5' CSE; c) a subgenomic promoter (SGP); d) a second ORF encoding at least one cargo polypeptide, operably linked to the SGP; and e) a 3' CSE; and wherein the 5' CSE, a region between the first and second ORFs, and / or the 3' CSE further comprises at least one Aptamer and Ribozyme Equilibrium Shifting (ARES) region in a sense or anti-sense orientation, wherein the ARES region comprises: i) a protein-aptamer that specifically binds to a target protein; and ii) a ribozyme.

35. The saRNA of claim 33 or 34, wherein when the ARES region is in the sense orientation, the ARES region is functional in the saRNA.

36. The saRNA of claim 33 or 34, wherein when the ARES region is in the anti-sense orientation, the ARES region is functional when the saRNA is delivered to a cell, the RdRP is translated from the saRNA, and the RdRP synthesizes a reverse complementary negative strand of the saRNA.

37. A polynucleotide comprising the RNA molecule of any one of claims 1-32 or the saRNA of any one of claims 33-36.

38. A vector comprising the polynucleotide of claim 37.

39. A combination comprising: a) the RNA molecule of any one of claims 1-32 or the saRNA of any one of claims 33-36; and b) a target protein.

40. The combination of claim 39, wherein the target protein is linked to a polypeptide of interest.

41. A cell comprising the RNA molecule of any one of claims 1-32, the saRNA of any one of claims 33-36, the polynucleotide of claim 37, the vector of claim 38, and / or the combination of claim 39 or 40.

42. A pharmaceutical composition comprising the RNA molecule of any one of claims 1-32, the saRNA of any one of claims 33-36, the polynucleotide of claim 37, the vector of claim 38, the combination of claim 39 or 40, or the cell of claim 41.

43. A method of modulating the translation of at least one cargo polypeptide, the method comprising contacting a cell with the RNA molecule of any one of claims 1-32, the saRNA of any one of claims 33-36, the polynucleotide of claim 37, the vector of claim 38, the combination of claim 39 or 40, or the pharmaceutical composition of claim 42.

44. The method of claim 43, further comprising contacting the cell with the target protein.

45. The method of claim 43 or 44, wherein the cell expresses the target protein.

46. A method of modulating the translation of at least one cargo polypeptide in a subject in need thereof, the method comprising administering to the subject an effective amount of the RNA molecule of any one of claims 1-32, the saRNA of any one of claims 33-36, the polynucleotide of claim 37, the vector of claim 38, the combination of claim 39 or 40, the cell of claim 41, or the pharmaceutical composition of claim 42.

47. The method of claim 46, further comprising administering to the subject an effective amount of the target protein.

48. The method of claim 46 or 47, wherein a target cell in the subject expresses the target protein.

49. The method of any one of claims 43-48, wherein the RNA molecule comprises the ON-switch ARES region of any one of claims 12-16.

50. The method of claim 49, wherein in an RNA molecule comprising an ON-switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is translated (ON); and / or b) in the absence of the target protein, the at least one cargo polypeptide is not translated (OFF).

51. The method of any one of claims 43-50, wherein the RNA molecule comprises the stabilization / degradation ARES region of any one of claims 19-20.

52. The method of any one of claims 43-51, wherein the RNA molecule comprises the OFF- switch ARES region of any one of claims 21-30.

53. The method of claim 51 or 52, wherein in an RNA molecule comprising a stabilization / degradation ARES region or an OFF-switch ARES region: a) in the presence of the target protein, the at least one cargo polypeptide is not translated (OFF); and / or b) in the absence of the target protein, the at least one cargo polypeptide is translated(ON).

Citation Information

Patent Citations

  • Post-Transcriptional Regulation Of RNA-Related Processes Using Encoded Protein-Binding RNA Aptamers

    US20110245326A1