Methods of improving stress tolerance
Mutating the CNGC15 gene in plants enhances heat stress tolerance and maintains fertility by protecting meiotic pathways, addressing the negative effects of heat stress on plant growth and reproduction.
Patent Information
- Application Number
- PCT/EP2025/063553
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2024-05-17
- Filing Date
- 2025-05-16
- Publication Date
- 2025-11-20
AI Technical Summary
Heat stress negatively affects plant health and fertility, leading to growth retardation, wilted architecture, low pollen viability, abnormal fertilization, and reduced seed production, exacerbated by global climate change.
Introduce mutations in the conserved motif of the nuclear localized cyclic nucleotide-gated ion channel (CNGC) gene, particularly CNGC15, to enhance heat stress tolerance and maintain fertility during fertilization.
The mutations improve heat stress tolerance and maintain fertility by protecting meiotic pathways, ensuring seed development and viability under heat stress conditions.
Smart Images

Figure EP2025063553_20112025_PF_FP_ABST
Abstract
Description
[0001] Methods of improving stress tolerance
[0002] FIELD OF THE INVENTION
[0003] The present invention relates to methods of improving stress tolerance, and specifically, maintaining the fertility of plants under stress, and in particular heat stress. Such methods comprise introducing one or more mutations into at least one nuclear localized cyclic nucleotide-gated ion channel (CNGC) gene.
[0004] BACKGROUND OF THE INVENTION
[0005] Heat stress, both chronic and short-term, is known to have a detrimental effect on the health and seed production of plants. Heat stress-induced plant phenotypes include, growth retardation, wilted plant architecture, low pollen viability, abnormal fertilization, and poor grain filling and seed setting.
[0006] Heat stress has been demonstrated to negatively affect the female reproductive structure by causing irreversible anatomical and physiological changes, leading to a reduction in the number of ovules. The reduction in the number of ovules has been found to be related to disruption in the normal development of the ovary (Shi et al., 2022). Similarly, male reproductive development is sensitive to spikes in temperature, with direct consequences on fertility and seed productivity, likely due to metabolic and physiological changes triggered by heat stress.
[0007] As a consequence of global climate change, the frequency, severity, and duration of heat stress is increasing, which consequently impacts plant growth, development, and fertility. There is therefore a need to develop methods of increasing stress tolerance, and in particular, heat stress tolerance in plants. The present invention addresses this need.
[0008] SUMMARY OF THE INVENTION
[0009] In one aspect of the invention, there is provided a method of improving abiotic stress tolerance in a plant, wherein said method comprises introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), wherein the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX, and wherein the abiotic stress tolerance is heat stress. In one embodiment, abiotic stress tolerance - or heat stress tolerance - is improved during fertilisation.
[0010] In another aspect of the invention there is provided a method of maintaining plant fertility under stress, wherein said method comprises introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), wherein the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX.
[0011] According to the invention, the cyclic nucleotide-gated ion channel (CNGC) may be CNGC15.
[0012] In one embodiment, the CNCG gene encodes an amino acid sequence as defined in any one of SEQ ID NOs 1 to 42, 232 to 236, 247, 248 or 253 or a functional variant or homologue thereof.
[0013] In one embodiment, the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX, preferably XDPL, more preferably VDPL. Preferably the at least one mutation is at least one substitution at one more positions in VDPL, wherein preferably the substitution is a P for L or S and / or a L for F. The mutation may be a gain of function mutation - and is referred to herein as cngc15GoF.
[0014] In another aspect of the invention, there is provided a method of improving abiotic stress tolerance in a plant, wherein said method comprises introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a nuclear-localised cyclic nucleotide-gated ion channel (CNGC) amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation in at least one conserved motif, wherein the motif comprises the residues XDPX, preferably XDPL, more preferably VDPL; and wherein the abiotic stress is heat stress. In one embodiment, abiotic stress tolerance - or heat stress tolerance - is improved during fertilisation.
[0015] In another aspect of the invention, there is provided a method of maintaining plant fertility under stress, wherein said method comprises introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a nuclear-localised cyclic nucleotide-gated ion channel (CNGC) amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation in at least one conserved motif, wherein the motif comprises the residues XDPX, preferably XDPL, more preferably VDPL.
[0016] The cyclic nucleotide-gated ion channel (CNGC) may be CNGC15.
[0017] In one embodiment, the nucleic acid sequence encodes a CNGC polypeptide as defined in one of SEQ ID NOs 85 to 231, 242 to 246, 251, 252, 255 or a functional variant thereof.
[0018] The method may also maintain plant fertility when the plant is grown under low fertiliser conditions or in the absence of fertiliser.
[0019] In another aspect of the invention there is provided a method for identifying and / or selecting a plant that has improved abiotic stress tolerance in a plant the method comprising screening a population of plants, parts thereof or plant cells and detecting in the plant or plant germplasm at least one polymorphism in at least one conserved domain of a cyclic nucleotide-gated ion channel (CNGC) gene, preferably a polymorphism in a VDPL motif; and selecting said plant.
[0020] In another aspect of the invention, there is provided a method for identifying and / or selecting a plant that will maintain its fertility under stress conditions, the method comprising screening a population of plants, parts thereof or plant cells and detecting in the plant or plant germplasm at least one polymorphism in at least one conserved domain of a cyclic nucleotide-gated ion channel (CNGC) gene, preferably a polymorphism in a VDPL motif; and selecting said plant. In one embodiment, of any of the above aspects, the plant is selected from wheat, rice, maize, soybean, tomato, barley, sugar cane, sorghum, sunflower, sugar beet, rye, cotton, potato, peanut, flax (common flax or linseed), strawberry, oilseed rape and any leguminous plant.
[0021] In one embodiment, of any of the above aspects, the stress is heat stress.
[0022] DESCRIPTION OF THE FIGURES
[0023] The invention is described in the following non-limiting figures:
[0024] Figure 1. CNGC15GoFconfers heat stress resistance during the fertilisation process in A.thaliana. Figure 1A shows a picture of representative siliques on A.thaliana inflorescence grown under heat stress. Figure 1B shows representative pictures of the silique in figure 1A dissected to observe seed set. Only the cngc15KO / CNGC15GoFlines present developed seeds. The scale bar represents 1cm.
[0025] Figure 2. Representative pictures of the inflorescence with developed siliques under heat stress conditions. The grey bar represents 1cm.
[0026] DETAILED DESCRIPTION OF THE INVENTION
[0027] The present invention will now be further described. In the following passages, different aspects of the invention are defined in more detail. Each aspect so defined may be combined with any other aspect or aspects unless clearly indicated to the contrary. In particular, any feature indicated as being preferred or advantageous may be combined with any other feature or features indicated as being preferred or advantageous.
[0028] As used herein, the words "nucleic acid", "nucleic acid sequence", "nucleotide", "nucleic acid molecule" or "polynucleotide" are intended to include DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), natural occurring, mutated, synthetic DNA or RNA molecules, and analogs of the DNA or RNA generated using nucleotide analogs. It can be single-stranded or double-stranded. Such nucleic acids or polynucleotides include, but are not limited to, coding sequences of structural genes, anti-sense sequences, and non-coding regulatory sequences that do not encode mRNAs or protein products. These terms also encompass a gene. The term "gene" or “gene sequence" is used broadly to refer to a DNA nucleic acid associated with a biological function. Thus, genes may include introns and exons as in the genomic sequence, or may comprise only a coding sequence as in cDNAs, and / or may include cDNAs in combination with regulatory sequences.
[0029] The terms "polypeptide" and "protein" are used interchangeably herein and refer to amino acids in a polymeric form of any length, linked together by peptide bonds.
[0030] Cyclic nucleotide-gated ion channels or CNGCs are calcium permeable cation transport channels. Plant CNGCs are tetrameric and have six transmembrane domains, with a cytosolic N-terminal (NT) and C-terminal (CT) region per subunit. Members of the CNGC15 family are localized to the nuclear envelope, where they participate in nuclear Ca2+oscillations, which are crucial for root growth and symbiosis establishment. In one embodiment, the CNGC is selected from one or more of the CNGC15 sub-family / sub-type.
[0031] For the purposes of the invention, a “genetically altered plant” is a plant that has been genetically altered compared to the naturally occurring wild-type (WT) plant. In one embodiment, a genetically altered plant is a plant that has been altered compared to the naturally occurring wild type (WT) plant using a mutagenesis method, such as targeted genome modification or genome editing. In one embodiment, the plant genome has been altered compared to the wild-type using a mutagenesis method. Such plants have an altered phenotype as described herein, such as maintained plant fertility under heat stress. Therefore, in this example, these phenotypes are conferred by the presence of an altered plant genome, for example the mutation of at least one gene encoding a CNCG15 gene. In particular, the aspects of the invention involve recombination DNA technology and exclude embodiments that are solely based on generating plants by traditional breeding methods.
[0032] The invention relates to methods of improving or enhancing abiotic stress tolerance in plants. The stress is preferably abiotic stress and may be selected from drought, salinity, freezing (caused by temperatures below 0°C), chilling (caused by low temperatures over 0°C) and heat stress (caused by high temperatures). Preferably, the stress is heat stress. The stress may be severe or preferably moderate stress. In particular, the plant may show improved or enhanced stress tolerance during or following fertilisation.
[0033] As used herein, the terms “improving” or “enhancing” (e.g. “improving abiotic stress resistance” or “enhancing abiotic stress resistance”) are used interchangeably.
[0034] The term heat stress refers to exposure to temperatures exceeding the optimal temperature range for growth of a plant. It is understood that the optimal range of temperatures varies between plants and not all plants have the same optimal temperature range. In other words, the specific temperature threshold for heat stress varies between plants species. Heat stress can disrupt essential physiological processes and can lead to stunted growth, reduced yields, and reduced or abolished fertility. Typically, the optimum temperature of plants is between 21 and 29°C, more preferably between 22 and 26°C. In one embodiment, an increase in temperature of between 10 and 15°C above the optimal temperature for a given plant leads to heat stress. In one embodiment, the plant is exposed to above optimum daytime temperatures. In another embodiment, the plant is exposed to above optimum nighttime temperatures. In another embodiment, the plant is exposed to above optimum daytime and night-time temperatures. Daytime may be a period of between 10 to 20 hours, preferably around 16 hours. Night-time may be a period of between 12 to 4 hours, preferably around 8 hours.
[0035] In a further embodiment, the plant may be exposed to temperatures of at least 22°C, or at least 23°C, or at least 24°C, or at least 25°C, or at least 26°C, or at least 27°C, or at least 28°C or at least 29°C, or at least 30°C, or at least 31 °C, or at least 32°C, or at least 33°C, or at least 34°C, or at least 35°C, or at least 36°C or more. In one embodiment, the plants may be exposed to a temperature of at least 32°C or more. Preferably these are daytime temperatures.
[0036] In a further embodiment, the plant may be exposed to temperatures of at least 16°C, or at least 17°C, or at least 18°C, or at least 19°C, or at least 20°C, or at least 21 °C, or at least 22°C, or at least 23°C, or at least 24°C, or at least 25°C, or at least 26°C, or at least 27°C, or at least 28°C or at least 29°C, or at least 30°C or more. In one embodiment, the plants may be exposed to a temperature of at least 26°C or more. Preferably these are night-time temperatures. In one embodiment, the plant may be exposed to a daytime temperature of at least 32°C or more and a night-time temperature of at least 26°C or more.
[0037] The temperatures described above are all temperatures that can lead to heat stress in a plant.
[0038] In a further embodiment, the plant may be exposed to the above temperatures for at least 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 7 days, 8 days, 9 days, 10 days, 11 days, 12 days, 13 days, 14 days, 15 days, 16 days, 17 days, 18 days, 19 days, 20 days, 21 days, 22 days, 23 days, 24 days, 25 days, 26 days, 27 days, 28 days, 29 days or 30 days or more. In practice there may be no minimum or maximum duration.
[0039] Accordingly, it can also be considered that the invention relates to a method of improving or enhancing the thermotolerance (or thermoresistance) of a plant, part thereof or plant cell. The term thermotolerance and thermoresistance may be used interchangeably herein and refer to the ability of a plant to grow and / or survive at high temperatures (i.e. above optimum temperature). A plant’s natural tolerance of heat is their basal thermotolerance. Meanwhile, acquired thermotolerance can be considered to be an enhanced level of thermotolerance after exposure to a heat stress.
[0040] In particular, the inventors have identified that introducing a gain of function mutation (referred to herein as CNGC15GoF) into a highly conserved domain in a cyclic nucleotide-gated ion channel (CNGC), and in particular in CNGC15 confers heat stress resistance (or tolerance; such terms may be used interchangeably) during the fertilisation period in plants. In other words, the inventors have found that introducing a gain of function mutation into a CNGC in plants maintains fertility - compared to wildtype or control plants that lack the mutation - under heat stress.
[0041] According to the invention, a plant has improved or enhanced stress tolerance, and in particular, heat stress tolerance during fertilisation if the plant remains (or maintains fertility) or has improved fertility compared to a wild-type or control plant that has not been exposed to any stress, in particular heat stress. The invention therefore also provides a method of maintaining or improving plant fertility under stress, wherein said method comprises introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC). Preferably, the at least one mutation is in at least one conserved motif.
[0042] Alternatively, the invention provides a method of maintaining plant fertility under stress, or being fertile under stress conditions, wherein said method comprises introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a nuclear-localised cyclic nucleotide- gated ion channel (CNGC) amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation. Preferably the at least one mutation is in at least one conserved motif.
[0043] According to the invention “maintaining fertility” means that the fertility of the plant is the same as the fertility of a control or wild-type plant that has not been exposed to heat stress. That is, the fertility of the plant has not decreased or significantly decreased compared to the fertility of (an equivalent) plant that has been exposed to heat stress.
[0044] Seed development can be used as a measure of the fertility of a plant. In one embodiment, the fertility of a plant can be determined by measuring seed development - for example, measuring seed setting, seed size and / or seed number. Alternatively, the development and / or size (length and / or width and / or number) of one or more silique (siliquae) - the seed capsule - can be used to determine the fertility of a plant. Where the size or number of the silique (or siliquae) and / or the development of seeds is the same (or not significantly different) as that in a wild-type or control plant that has not been exposed to stress, particularly heat stress, it can be considered that the fertility of the plant is maintained. Alternatively, where the size or number of the silique (or siliquae) and / or the development of seeds is improved or better or increased than the size or number of silique (or siliquae) and / or the development of seeds in a wild-type or control plant that has been exposed to stress, particularly heat stress, it can also be considered that the fertility of the plant is improved. An increase may be at least an increase of 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90% or 95% or more compared in the size or number of siliquae and / or in the development of seeds (e.g. seed size, number of seeds) in a wild-type or control plant that has been exposed to stress. Any of the above can be measured using standard techniques in the art.
[0045] Alternatively, “maintaining fertility” may mean maintaining ovule and / or pollen viability. Specifically, maintaining ovule and / or pollen viability under heat stress means that at least one of ovule viability or pollen viability is not significantly reduced under heat stress compared to a wild-type or control plant that has not been exposed to heat stress. Ovule viability may refer to the capacity of an ovule to develop into a mature seed following fertilisation. A viable ovule is a healthy cell within the plant ovary that has the potential to form a seed after successful fertilisation. Pollen viability may refer to the ability of pollen to mature and fertile. Viable pollen cells are able to germinate, form a pollen tube and fertilise the ovule leading to seed development. The viability of pollen may be measured by determining one or more of (i) seed set in a fertilised plant (e.g. number of fertilised ovules per ovary) and / or (ii) cytochemical staining of granules and / or (iii) analysing germination of pollen in vitro or on styles.
[0046] Heat stress can also cause meiosis to stop in plants, consequently reducing or abolishing the fertility of said plants. Without being bound by theory, it may be that mutating CNGC and specifically CNGC15, protects meiotic pathways from any impact from heat stress.
[0047] Accordingly, the invention also provides a method of maintaining meiosis under stress, wherein said method comprises
[0048] (i) introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), preferably in at least one conserved motif; or
[0049] (ii) introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a CNGC amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation, and wherein preferably the at least one mutation is in at least one conserved motif. By “at least one mutation in at least one gene” is meant that where the gene of a CNGC15 subtype is present as more than one copy or homologue (with the same or slightly different sequence) there is at least one mutation in at least one (endogenous) gene. Preferably all genes are mutated. Preferably the mutation in the gene sequences leads to a mutation in the amino acid sequence of the CNGC.
[0050] In Medicago truncatula, the CNGC15 family comprises MtCNGC15a, b and c. In one embodiment, the method comprises introducing at least one mutation in MtCNGC15a or at least one mutation in MtCNGC15b or at least one mutation in MtCNGC15c. In one embodiment, the method comprises introducing at least one mutation in MtCNGC15a and at least one mutation in MtCNGC15c or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in MtCNGC15a and at least one mutation in MtCNGC15b or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in MtCNGC15b and at least one mutation in MtCNGC15c or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in MtCNGC15a and at least one mutation in MtCNGC15b and at least one mutation in MtCNGC15c or homologues thereof. In one embodiment, the MtCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 12 or a functional variant or homologue thereof, MtCNGC15b comprises or consists of SEQ ID NO: 13 or a functional variant or homologue thereof and MtCNGC15c comprises or consists of SEQ ID NO: 14 or a functional variant or homologue thereof. In another embodiment, the MtCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 54 or a functional variant or homologue thereof, MtCNGC15b comprises or consists of SEQ ID NO: 55 or a functional variant or homologue thereof and MtCNGC15c comprises or consists of SEQ ID NO: 56 or a functional variant or homologue thereof.
[0051] In another example, in Arabidopsis the AtCNGC15 family comprises one member: AtCNGC15. In one embodiment, the method comprises introducing at least one mutation in at least one gene encoding AtCNGC15. In one embodiment, the AtCNGC15 amino acid sequence comprises or consists of SEQ ID NO: 1 or a functional variant or homologue thereof. In another embodiment, the AtCNGC15 nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 43 or a functional variant or homologue thereof. In another example, in soybean the GmCNGC15 family comprises five members, GmCNGC15 a, b, c, d and e. In one embodiment, the method comprises introducing at least one mutation (in at least one gene of) at least one, two, three or four of GmCNGC15 a, b, c, d and e. In an alternative embodiment, the method comprises introducing at least one mutation (in at least one gene of) all of GmCNGC15 a, b, c, d and e. In one embodiment, the GmCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 2 or a functional variant or homologue thereof, GmCNGC15b comprises or consists of SEQ ID NO: 3 or a functional variant or homologue thereof, GmCNGC15c comprises or consists of SEQ ID NO: 4 or a functional variant or homologue thereof, GmCNGC15d comprises or consists of SEQ ID NO: 5 or a functional variant or homologue thereof, and GmCNGC15e comprises or consists of SEQ ID NO: 6 or a functional variant or homologue thereof. In another embodiment, the GmCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 44 or a functional variant or homologue thereof, GmCNGC15b comprises or consists of SEQ ID NO: 45 or a functional variant or homologue thereof, GmCNGC15c comprises or consists of SEQ ID NO: 46 or a functional variant or homologue thereof, GmCNGC15d comprises or consists of SEQ ID NO: 47 or a functional variant or homologue thereof, and GmCNGC15e comprises or consists of SEQ ID NO: 48 or a functional variant or homologue thereof.
[0052] In another example, in tomato, the SICNGC15 family comprises three members; SICNGC15a, SICNGC15b and SICNGC15c. In one embodiment, the method comprises introducing at least one mutation in (in at least one gene of) SICNGC15a, SICNGC15b and SICNGC15c. In another embodiment, the method comprises introducing at least one mutation in (in at least one gene of) SICNGC15a and SICNGC15b. In another embodiment, the method comprises introducing at least one mutation in (in at least one gene of) SICNGC15a and SICNGC15c. In another embodiment, the method comprises introducing at least one mutation in (in at least one gene of) SICNGC15b and SICNGC15c. In a further embodiment, the method comprises introducing at least one mutation in (in at least one gene of) SICNGC15a and SICNGC15b and SICNGC15c. In one embodiment, the SICNGC15a amino acid sequence comprises or consists of SEQ ID NO: 29 or a functional variant or homologue thereof, SICNGC15b comprises or consists of SEQ ID NO: 30 or a functional variant or homologue thereof, and SICNGC15c comprises or consists of SEQ ID NO: 31 or a functional variant or homologue thereof. In another embodiment, the SICNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 71 or a functional variant or homologue thereof, SICNGC15b comprises or consists of SEQ ID NO: 72 or a functional variant or homologue thereof and SICNGC15c comprises or consists of SEQ ID NO: 73 or a functional variant or homologue thereof.
[0053] In another example, in maize the CNGC15 family comprises one member: ZmCNGC15. In one embodiment, the method comprises introducing at least one mutation in at least one gene encoding ZmCNGC15. In one embodiment, the ZmCNGC15 amino acid sequence comprises or consists of SEQ ID NO: 32 or a functional variant or homologue thereof. In another embodiment, the ZmCNGC15 nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 74 or a functional variant or homologue thereof.
[0054] In another example, in wheat the CNGC15 family comprises seven members, TrCNGC15 a, b, c, d, e, f and g. In one embodiment, the method comprises introducing at least one mutation in (in at least one gene of) at least one, two, three, four, five or six of TrCNGC15. In an alternative embodiment, the method comprises introducing at least one mutation in (in at least one gene of) all of TrCNGC15 a, b, c, d, e, f and g. In one embodiment, the TrCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 33 or a functional variant or homologue thereof, TrCNGC15b comprises or consists of SEQ ID NO: 34 or a functional variant or homologue thereof, TrCNGC15c comprises or consists of SEQ ID NO: 35 or a functional variant or homologue thereof, TrCNGC15d comprises or consists of SEQ ID NO: 36 or a functional variant or homologue thereof, TrCNGC15e comprises or consists of SEQ ID NO: 37 or a functional variant or homologue thereof, TrCNGC15f comprises or consists of SEQ ID NO: 38 or a functional variant or homologue thereof and TrCNGC15g comprises or consists of SEQ ID NO: 39 or a functional variant or homologue thereof. In one example, the method comprises introducing at least one mutation in TrCNGC15a and at least one mutation in TrCNGC15c. In another embodiment, the TrCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 75 or a functional variant or homologue thereof, TrCNGC15b comprises or consists of SEQ ID NO: 76 or a functional variant or homologue thereof, TrCNGC15c comprises or consists of SEQ ID NO: 77 or a functional variant or homologue thereof, TrCNGC15d comprises or consists of SEQ ID NO: 78 or a functional variant or homologue thereof, TrCNGC15e comprises or consists of SEQ ID NO: 79 or a functional variant or homologue thereof, TrCNGC15f comprises or consists of SEQ ID NO: 80 or a functional variant or homologue thereof and TrCNGC15g comprises or consists of SEQ ID NO: 81 or a functional variant or homologue thereof. In one example, the genetically altered plant comprises at least one mutation in TrCNGC15a and at least one mutation in TrCNGC15c.
[0055] In another example, in rice the CNGC15 family comprises one member: OsCNGC15. In one embodiment, the method comprises introducing at least one mutation in at least one gene encoding OsCNGC15. In one embodiment, the OsCNGC15 amino acid sequence comprises or consists of SEQ ID NO: 28 or a functional variant or homologue thereof. In another embodiment, the OsCNGC15 nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 70 or a functional variant or homologue thereof.
[0056] In another example, in Hordeum vulgare, the CNGC15 family comprises HvCNGC15a, b and c. In one embodiment, the method comprises introducing at least one mutation in HvCNGC15a or at least one mutation in HvCNGC15b or a homologue thereof or at least one mutation in HvCNGC15c or a homologue thereof. In one embodiment, the genetically altered plant comprises at least one mutation in HvCNGC15a and at least one mutation in HvCNGC15c or homologues thereof. In another embodiment, the genetically altered plant comprises at least one mutation in HvCNGC15a and at least one mutation in HvCNGC15b or homologues thereof. In another embodiment, the genetically altered plant comprises at least one mutation in HvCNGC15b and at least one mutation in HvCNGC15c or homologues thereof. In another embodiment, the genetically altered plant comprises at least one mutation in HvCNGC15a and at least one mutation in HvCNGC15b and at least one mutation in HvCNGC15c or homologues thereof. In one embodiment, the HvCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 40 or a functional variant or homologue thereof, HvCNGC15b comprises or consists of SEQ ID NO: 41 or a functional variant or homologue thereof and HvCNGC15c comprises or consists of SEQ ID NO: 42 or a functional variant or homologue thereof. In another embodiment, the HvCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 82 or a functional variant or homologue thereof, HvCNGC15b comprises or consists of SEQ ID NO: 83 or a functional variant or homologue thereof and HvCNGC15c comprises or consists of SEQ ID NO: 84 or a functional variant or homologue thereof.
[0057] In another example, in Arachis hypogaea, the CNGC15 family comprises AhCNGC15a, b and c. In one embodiment, the method comprises introducing at least one mutation in AhCNGC15a or at least one mutation in AhCNGC15b or a homologue thereof or at least one mutation in AhCNGC15c or a homologue thereof. In one embodiment, the method comprises introducing at least one mutation in AhCNGC15a and at least one mutation in AhCNGC15c or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in AhCNGC15a and at least one mutation in AhCNGC15b or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in AhCNGC15b and at least one mutation in AhCNGC15c or homologues thereof. In another embodiment, the method comprises introducing at least one mutation in AhCNGC15a and at least one mutation in AhCNGC15b and at least one mutation in AhCNGC15c or homologues thereof. In one embodiment, the AhCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 232 or a functional variant or homologue thereof, AhCNGC15b comprises or consists of SEQ ID NO: 234 or a functional variant or homologue thereof and AhCNGC15c comprises or consists of SEQ ID NO: 233 or a functional variant or homologue thereof. In another embodiment, the AhCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 237 or a functional variant or homologue thereof, AhCNGC15b comprises or consists of SEQ ID NO: 239 or a functional variant or homologue thereof and AhCNGC15c comprises or consists of SEQ ID NO: 238 or a functional variant or homologue thereof.
[0058] In another example, in Linum usitatissimum, the CNGC family comprises LuCNGCa and c. In one embodiment, the method comprises introducing at least one mutation in LuCNGCa or at least one mutation in LuCNGCc or a homologue thereof. In one embodiment, the method comprises introducing at least one mutation in LuCNGCa and at least one mutation in LuCNGCc or homologues thereof. In one embodiment, the LuCNGCa amino acid sequence comprises or consists of SEQ ID NO: 235 or a functional variant or homologue thereof, and LuCNGCc comprises or consists of SEQ ID NO: 236 or a functional variant or homologue thereof. In another embodiment, the LuCNGCa nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 240 or a functional variant or homologue thereof and LuCNGCc comprises or consists of SEQ ID NO: 241 or a functional variant or homologue thereof.
[0059] In another example, in Brassica napus, the CNGC family comprises BnCNGC15a. In one embodiment, the method comprises introducing at least one mutation in BnCNGC15a or a homologue thereof. In one embodiment, the BnCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 247, 248 or a functional variant or homologue thereof. In another embodiment, the BnCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 249, 250 or a functional variant or homologue thereof.
[0060] In another example, in Fragaria vesca, the CNGC family comprises F.vCNGC15a. In one embodiment, the method comprises introducing at least one mutation in F.vCNGC15a or a homologue thereof. In one embodiment, the F.vCNGC15a amino acid sequence comprises or consists of SEQ ID NO: 253 or a functional variant or homologue thereof. In another embodiment, the F.vCNGC15a nucleic acid sequence (or gene sequence) comprises or consists of SEQ ID NO: 254 or a functional variant or homologue thereof.
[0061] In the above embodiments an ‘endogenous’ nucleic acid or gene may refer to the native or natural sequence in the plant genome - for example, one of the abovereferenced nucleic acid or amino acid sequences (SEQ ID NO: 43 to 84, 237 to 241, 249, 250, 254 and SEQ ID NO: 1 to 42, 232 to 236, 247, 248 and 253).
[0062] The term “variant” or “functional variant” as used herein with reference to any of the sequences defined herein refers to a variant gene sequence or part of the gene sequence which retains the biological function of the full non-variant (e.g. wild-type) sequence. In the context of CNGC, a functional variant is one that retains the wild-type function - i.e. acts as cyclic nucleotide gated channel and can generate nuclear calcium oscillations. Observing a change in nuclear calcium oscillations, and thus cyclic nucleotide gated channel function, can be achieved through methods such as aequorin based FAS (film adhesive seedlings) luminescence Ca2+ imaging and case12 based live cell confocal fluorescence Ca2+ imaging. Appropriate protocols for these methods have been reported in the literature, at for example, in Zhu et al. Measuring spatial and temporal Ca2+ signals in Arabidopsis plants. J Vis Exp. 2014 Sep 2;(91). A functional variant also comprises a variant of the gene of interest, which has sequence alterations that do not affect function, for example in non-conserved residues. Also encompassed is a variant that is substantially identical, i.e. has only some sequence variations, for example in non-conserved residues, compared to the wild type sequences as shown herein and is biologically active. Alterations in a nucleic acid sequence that results in the production of a different amino acid at a given site that does not affect the functional properties of the encoded polypeptide are well known in the art. For example, a codon for the amino acid alanine, a hydrophobic amino acid, may be substituted by a codon encoding another less hydrophobic residue, such as glycine, or a more hydrophobic residue, such as valine, leucine, or isoleucine. Similarly, changes which result in substitution of one negatively charged residue for another, such as aspartic acid for glutamic acid, or one positively charged residue for another, such as lysine for arginine, can also be expected to produce a functionally equivalent product. Nucleotide changes which result in alteration of the N-terminal and C-terminal portions of the polypeptide molecule would also not be expected to alter the activity of the polypeptide. Each of the proposed modifications is well within the routine skill in the art, as is determination of retention of biological activity of the encoded products.
[0063] As used in any aspect of the invention described herein a “variant” or a “functional variant” has at least 25%, 26%, 27%, 28%, 29%, 30%, 31%, 32%, 33%, 34%, 35%, 36%, 37%, 38%, 39%, 40%, 41%, 42%, 43%, 44%, 45%, 46%, 47%, 48%, 49%, 50%,
[0064] 51%, 52%, 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61%, 62%, 63%, 64%, 65%,
[0065] 66%, 67%, 68%, 69%, 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%,
[0066] 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%,
[0067] 96%, 97%, 98%, or at least 99% overall sequence identity to the non-variant nucleic acid or amino acid sequence.
[0068] The term homolog, as used herein, also designates a CNGC, specifically a CNGC15 gene orthologue from other plant species. Suitable homologues can be identified by sequence comparisons and identifications of conserved domains as described above. There are predictors in the art that can be used to identify such sequences. The function of the homologue can be identified as described herein and a skilled person would thus be able to confirm the function, for example when overexpressed in a plant. A homolog may also have, in increasing order of preference, at least 50%, 51 %, 52%,
[0069] 53%, 54%, 55%, 56%, 57%, 58%, 59%, 60%, 61 %, 62%, 63%, 64%, 65%, 66%, 67%,
[0070] 68%, 69%, 70%, 71 %, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81 %, 82%,
[0071] 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91 %, 92%, 93%, 94%, 95%, 96%, 97%,
[0072] 98%, or at least 99% overall sequence identity to the amino acid sequences represented by one of SEQ ID NO: 1 to 42 and 232 to 236, 247, 248, 253 or to the nucleic acid sequences shown in SEQ ID NOs: 43 to 84 and 237 to 241 , 249, 250, 254. Functional variants of CNGC15 gene homologs as defined above are also within the scope of the invention.
[0073] In one embodiment, the homolog is Arabidopsis, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 1 or a variant thereof.
[0074] In another embodiment, the homolog is soybean, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 2, 3, 4, 5 or 6 or a variant thereof.
[0075] In another embodiment, the homolog is Medicago, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 7, 8, 9, 10, 11 ,12, 13, 14, 15, 16, 17, 18, 19, 20, 21 , 22, 23, 24, 25, 26 or 27 or a variant thereof.
[0076] In another embodiment, the homolog is tomato, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 29, 30 or 31 or a variant thereof.
[0077] In another embodiment, the homolog is maize, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 32 or a variant thereof.
[0078] In another embodiment, the homolog is wheat, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 33, 34, 35, 36, 37, 38 or 39 or a variant thereof.
[0079] In another embodiment, the homolog is rice, and the CNGC15 amino acid sequence comprises or consists of SEQ ID NO: 28 or a variant thereof.
[0080] In another embodiment, the homolog is barley, and the CNGC15 comprises or consists of SEQ ID NO: 40, 41 , or 42 or a variant thereof. In another embodiment, the homolog is peanut, and the CNGC15 comprises or consists of SEQ ID NO: 232, 233, 234 or a variant thereof.
[0081] In another embodiment, the homolog is flax (common flax or linseed), and the CNGC comprises or consists of SEQ ID NO: 235, 236 or a variant thereof.
[0082] In another embodiment, the homolog is strawberry, and the CNGC comprises or consists of SEQ ID NO: 253 or variant thereof.
[0083] In another embodiment, the homolog is oilseed rape, and the CNGC comprises or consists of SEQ ID NO: 247, 248 or a variant thereof.
[0084] In one embodiment, CNGC15 or the CNGC15 subtype comprises at least one highly conserved motif. Preferably, the methods of the invention comprise introducing at least one mutation in at least one of conserved motifs. In one embodiment, the motif comprises the sequence XDPX, wherein X is any amino acid. More preferably, the motif comprises the sequence XDPL. Even more preferably, the conserved motif comprises the sequence VDPL.
[0085] In one embodiment, the mutation is a mutation at one or more positions in the XDPX motif. In a preferred embodiment, the mutation is a point mutation or a substitution mutation. That is, a mutation that exchanges one nucleotide base for another and that leads to a change in the codon causing the nucleic acid sequence to encode a different amino acid at that position.
[0086] In one embodiment, where the conserved motif is XDPX or XDPL or VDPL, the mutation is selected from a substitution of P for another amino acid, preferably a substitution of P for S.
[0087] In one embodiment, the mutation is selected from one or more of the following mutations in VDPL: a substitution of V for another amino acid; and / or a substitution of D for another amino acid; and / or a substitution of P for another amino acid; preferably L or S and / or a substitution of L for another amino acid, preferably F. In a preferred embodiment, the mutation in the VDPL is a substitution of P for L.
[0088] In another embodiment, the mutation in the VDPL is a substitution of P for S.
[0089] In another embodiment, the mutation in the VDPL is a substitution of L for F.
[0090] In one embodiment VDPL is mutated to VDLL.
[0091] In another embodiment, VDPL is mutated to VDSL.
[0092] In another embodiment, VDPL is mutated to VDPF.
[0093] In another embodiment, VDPL is mutated to VDSF.
[0094] In another embodiment, VDPL is mutated to VDLF.
[0095] In one embodiment, where the conserved motif is XDPX or XDPL or IDPL or IDPM, the mutation is selected from a substitution of P for another amino acid, preferably a substitution of P for S.
[0096] In one embodiment, the mutation is selected from one or more of the following mutations in IDPL: a substitution of I for another amino acid; and / or a substitution of D for another amino acid; and / or a substitution of P for another amino acid; preferably S; and / or a substitution of L for another amino acid, preferably F or M.
[0097] In a preferred embodiment, the mutation in the IDPL is a substitution of P for S.
[0098] In another embodiment, the mutation in the IDPL is a substitution of L for F.
[0099] In one embodiment, the mutation is selected from one or more of the following mutations in IDPM: a substitution of I for another amino acid; and / or a substitution of D for another amino acid; and / or a substitution of P for another amino acid; preferably S; and / or a substitution of M for another amino acid.
[0100] In a preferred embodiment, the mutation in the IDPM is a substitution of P for S.
[0101] In one embodiment IDPL is mutated to IDSL. In another embodiment, IDPM is mutated to IDSM.
[0102] In another embodiment IDPL is mutated to IDSF.
[0103] In a further preferred embodiment, the mutation is at the following positions is selected from one of the following substitutions in Table 1 :
[0104] Table 1 : CNGC mutation positions
[0105]
[0106] Accordingly, in one embodiment, the method comprises introducing at least one mutation into a CNGC15 nucleic acid sequence, wherein the CNGC15 nucleic acid sequence comprises or consists of: a. a nucleic acid sequence encoding a polypeptide comprising at least one XDPX, preferably a XDPL motif, and more preferably a VDPL motif or a variant thereof; b. a nucleic acid sequence encoding a polypeptide as defined in one of SEQ ID Nos 1 to 42, 232 to 236, 247, 248, 253; or c. a nucleic acid sequence as defined in one of SEQ ID Nos 43 to 84, 237 to 241 , 249, 250, 254; or d. a nucleic acid sequence with at least 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or at least 99% overall sequence identity to either (a) or (c); or e. a nucleic acid sequence encoding a CNGC15 polypeptide as defined herein that is capable of hybridising under stringent conditions as defined herein to the nucleic acid sequence of any of (a) to (d).
[0107] Hybridization of such sequences may be carried out under stringent conditions. Typically, stringent conditions will be those in which the salt concentration is less than about 1.5 M Na ion, typically about 0.01 to 1.0 M Na ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to 50 nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides). Duration of hybridization is generally less than about 24 hours, usually about 4 to 12 hours. Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide.
[0108] In one embodiment, the mutation is introduced using targeted genome editing. That is, in one embodiment, the invention relates to a method and plant that has been generated by genetic engineering methods as described above, and does not encompass naturally occurring varieties or generating plants by traditional breeding methods. Targeted genome modification or targeted genome editing is a genome engineering technique that uses targeted DNA double-strand breaks (DSBs) to stimulate genome editing through homologous recombination (HR)-mediated recombination events.
[0109] In a preferred embodiment, the genome editing method that is used according to the various aspects of the invention is CRISPR.
[0110] In a preferred embodiment of any aspect of the invention described herein, sgRNAs can be used with a modified Cas9 protein, such as nickase Cas9 or nCas9 or a “dead” Cas9 (dCas9) fused to a “Base Editor” - such as an enzyme, for example a deaminase such as cytidine deaminase, or TadA (tRNA adenosine deaminase) or ADAR or APOBEC. These enzymes are able to substitute one base for another. As a result no DNA is deleted, but a single substitution is made (Kim et al., 2017; Gaudelli et al. 2017). Alternatively, the method may use sgRNA together with a template or donor DNA constructs, to introduce a targeted SNP or mutation, in particular one of the substitutions described herein, into a CNGC gene. In this embodiment, the introduction of a template DNA strand, following a sgRNA-mediated snip in the double-stranded DNA, can be used to produce a specific targeted mutation (i.e. a SNP) in the gene using homology directed repair. As a further alternative, prime editing can be used to introduce the specific mutation (Anzalone et al., 2019). Here a catalytically impaired Cas9 endonuclease is fused to an engineered reverse transcriptase programmed with a prime editing guide RNA (pegRNA) that is both specific to the target site and encodes the desired edit. Using the above methods we can mutate the nucleotides that encode the conserved VDPL motif and therefore lead to one of the above-described substitutions in the amino acid sequence.
[0111] Once targeted genome editing has been performed, rapid high-throughput screening procedures can be used to analyse amplification products for the presence of a mutation in the CNGC15 gene, and in particular, in the VDPL motif. Once a mutation is identified, the seeds of the M2 plant carrying that mutation are grown into adult M3 plants and screened for the phenotypic characteristics associated with the target gene CNGC15 / easy. Mutants with one or more mutations in a CNGC, and in particular in the VDPL motif, and as a result maintained fertility under heat stress compared to a control, can thus be identified. Accordingly, in one embodiment, there is provided a method of producing a genetically altered plant, part thereof or plant cell that has increased tolerance to heat stress compared to wild-type or control plants, wherein the method comprises introducing at least one mutation in at least one CNGC gene, preferably a CNGC15 subtype. Preferably, the mutation is in a nucleic acid sequence encoding a CNGC15 subtype selected from one of the sequences defined in SEQ ID NO: 43 to 84, 237 to 241, 249, 250, and 254, as described in detail above.
[0112] Plants obtained or obtainable and seeds obtained or obtainable from such plants by such method which carry a functional mutation or dominant mutation in at least one endogenous CNGC15 gene are also within the scope of the invention.
[0113] In one embodiment, the progeny plant is stably transformed with the CRISPR constructs, and comprises the exogenous polynucleotide which is heritably maintained in the plant cell. The method may include steps to verify that the construct is stably integrated. The method may also comprise the additional step of collecting seeds from the selected progeny plant.
[0114] In one embodiment, the method may comprise obtaining a DNA sample from a transformed plant and carrying out DNA amplification to detect the at least one mutation in the CNGC gene, and preferably a substitution in the VDPL motif. In a further embodiment of any of the methods described herein, the method may further comprise at least one or more of the steps of assessing the phenotype of the genetically altered plant, and measuring fertility (e.g. seed production, seed size, seed setting or silique size). In other words, the method may involve the step of screening the plants for the desired phenotype.
[0115] Alternatively, more conventional mutagenesis methods can be used to introduce at least one mutation into at least one CNGC gene. These methods include both physical and chemical mutagenesis. A skilled person will know further approaches can be used to generate such mutants, and methods for mutagenesis and polynucleotide alterations are well known in the art. See, for example, Kunkel (1985) Proc. Natl. Acad. Sci. USA 82:488-492; Kunkel et al. (1987) Methods in Enzymol. 154:367-382; U.S. Patent No. 4,873,192; Walker and Gaastra, eds. (1983) Techniques in Molecular Biology (MacMillan Publishing Company, New York) and the references cited therein. In another embodiment, mutagenesis is physical mutagenesis, such as application of ultraviolet radiation, X-rays, gamma rays, fast or thermal neutrons or protons. The targeted population can then be screened to identify a substitution mutation in a CNGC gene.
[0116] In another embodiment of the various aspects of the invention, the method comprises mutagenizing a plant population with a mutagen. The mutagen may be a fast neutron irradiation or a chemical mutagen, for example selected from the following non-limiting list: ethyl methanesulfonate (EMS), methylmethane sulfonate (MMS), N-ethyl-N- nitrosurea (ENU), triethylmelamine (1'EM), N-methyl-N-nitrosourea (MNU), procarbazine, chlorambucil, cyclophosphamide, diethyl sulfate, acrylamide monomer, melphalan, nitrogen mustard, vincristine, dimethylnitosamine, N-methyl-N'-nitro- Nitrosoguanidine (MNNG), nitrosoguanidine, 2-aminopurine, 7,12 dimethyl- benz(a)anthracene (DMBA), ethylene oxide, hexamethylphosphoramide, bisulfan, diepoxyalkanes (diepoxyoctane (DEO), diepoxybutane (BEB), and the like), 2-methoxy- 6-chloro-9 [3-(ethyl-2-chloroethyl)aminopropylamino]acridine dihydrochloride (ICR-170) or formaldehyde. Again, the targeted population can then be screened to identify one of the above described mutations in the CNGC gene.
[0117] In another embodiment, the method used to create and analyse mutations is targeting induced local lesions in genomes (TILLING), reviewed in Henikoff et al, 2004. In this method, seeds are mutagenised with a chemical mutagen, for example EMS. The resulting M1 plants are self-fertilised and the M2 generation of individuals is used to prepare DNA samples for mutational screening. DNA samples are pooled and arrayed on microtiter plates and subjected to gene specific PCR. The PCR amplification products may be screened for mutations in the CNGC15 gene using any method that identifies heteroduplexes between wild type and mutant genes. For example, but not limited to, denaturing high pressure liquid chromatography (dHPLC), constant denaturant capillary electrophoresis (CDCE), temperature gradient capillary electrophoresis (TGCE), or by fragmentation using chemical cleavage. Preferably the PCR amplification products are incubated with an endonuclease that preferentially cleaves mismatches in heteroduplexes between wild type and mutant sequences. Cleavage products are electrophoresed using an automated sequencing gel apparatus, and gel images are analyzed with the aid of a standard commercial image-processing program. Any primer specific to a CNGC nucleic acid sequence may be utilized to amplify the CNGC nucleic acid sequence within the pooled DNA sample. Preferably, the primer is designed to amplify the regions of a CNGC gene where useful mutations are most likely to arise e.g. in the XDPL motif that is highly conserved as explained elsewhere. To facilitate detection of PCR products on a gel, the PCR primer may be labelled using any conventional labelling method. In an alternative embodiment, the method used to create and analyse mutations is EcoTILLING. EcoTILLING is molecular technique that is similar to TILLING, except that its objective is to uncover natural variation in a given population as opposed to induced mutations. The first publication of the EcoTILLING method was described in Comai et al. (2004).
[0118] As described above, in one embodiment the method may comprise introducing and expressing a nucleic acid construct wherein said nucleic acid construct comprises a nucleic acid sequence encoding a CNGC amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation, and wherein preferably the at least one mutation is in at least one conserved motif.
[0119] In one embodiment, the method comprises introducing a nucleic acid construct comprising a nucleic acid sequence that encodes a CNGC polypeptide from the same plant - for example, a wheat CNGC polypeptide is expressed in wheat. In another embodiment, the nucleic acid construct comprises a nucleic acid sequence encoding a CNGC polypeptide from a different plant - for example, a wheat CNGC polypeptide is expressed in rice.
[0120] The nucleic acid construct may be stably incorporated into the plant genome.
[0121] In one embodiment, the nucleic acid sequence encodes a CNGC polypeptide as defined in any one of SEQ ID Nos: 85 to 231, 242 to 246, 251 , 252, 255 or a functional variant thereof.
[0122] The nucleic acid sequence encoding a CNGC polypeptide is also preferably operably linked to a regulatory sequence. Preferably the regulatory sequence is a promoter. The term "operably linked" as used herein refers to a functional linkage between the promoter sequence and the gene of interest, such that the promoter sequence is able to initiate transcription of the gene of interest.
[0123] A "plant promoter" comprises regulatory elements, which mediate the expression of a coding sequence segment in plant cells. Accordingly, a plant promoter need not be of plant origin, but may originate from viruses or micro-organisms, for example from viruses which attack plant cells. The "plant promoter" can also originate from a plant cell, e.g. from the plant which is transformed with the nucleic acid sequence to be expressed in the inventive process and described herein. This also applies to other "plant" regulatory signals, such as "plant" terminators. The promoters upstream of the nucleotide sequences useful in the methods of the present invention can be modified by one or more nucleotide substitution(s), insertion(s) and / or deletion(s) without interfering with the functionality or activity of either the promoters, the open reading frame (ORF) or the 3'-regulatory region such as terminators or other 3' regulatory regions which are located away from the ORF. It is furthermore possible that the activity of the promoters is increased by modification of their sequence, or that they are replaced completely by more active promoters, even promoters from heterologous organisms. For expression in plants, the nucleic acid molecule must, as described above, be linked operably to or comprise a suitable promoter which expresses the gene at the right point in time and with the required spatial expression pattern. The term "operably linked" as used herein refers to a functional linkage between the promoter sequence and the gene of interest, such that the promoter sequence is able to initiate transcription of the gene of interest.
[0124] In one embodiment, the promoter is the endogenous or native CNGC, specifically CNGC15 promoter.
[0125] In another embodiment, the promoter is a constitutive promoter. A "constitutive promoter" refers to a promoter that is transcriptionally active during most, but not necessarily all, phases of growth and development and under most environmental conditions, in at least one cell, tissue or organ. Examples of constitutive promoters include but are not limited to actin, HMGP, CaMV19S, GOS2, rice cyclophilin, maize H3 histone, alfalfa H3 histone, 34S FMV, rubisco small subunit, OCS, SAD1, SAD2, nos, V-ATPase, super promoter, G-box proteins and synthetic promoters. In another embodiment, the promoter is a tissue-specific promoter. Tissue specific promoters are transcriptional control elements that are only active in particular cells or tissues at specific times during plant development. In one embodiment, the tissuespecific promoter is a root-specific promoter. In one embodiment, the root-specific promoter is the P1534 promoter (as described in Li et al. 2019).
[0126] In another aspect of the invention, there is provided a method of making a genetically altered plant, the method comprising introducing and expressing a nucleic acid construct as described herein in a plant.
[0127] In one embodiment, the method comprises a. selecting a part of the plant; b. transfecting at least one cell of the part of the plant of paragraph (a) with at least one nucleic acid construct as described above; c. regenerating at least one plant derived from the transfected cell or cells; d. selecting one or more plants obtained according to paragraph (c) that express the CNGC polypeptide, for example a CNGC polypeptide as defined in SEQ ID NO: 85 to 231 , 242 to 246, 251 , 252, 255 or a functional variant thereof.
[0128] Transformation methods as used herein for generating a genetically altered plant of the invention are known in the art. Thus, according to the various aspects of the invention, a CRISPR or nucleic acid construct as described herein is introduced into a plant and expressed as a transgene. The construct is introduced into said plant through a process called transformation. The terms "introduction" or "transformation" or “transfection” as referred to herein encompass the transfer of an exogenous polynucleotide into a host cell, irrespective of the method used for transfer. Plant tissue capable of subsequent clonal propagation, whether by organogenesis or embryogenesis, may be transformed with a genetic construct of the present invention and a whole plant regenerated therefrom. The particular tissue chosen will vary depending on the clonal propagation systems available for, and best suited to, the particular species being transformed. Exemplary tissue targets include leaf disks, pollen, embryos, cotyledons, hypocotyls, megagametophytes, callus tissue, existing meristematic tissue (e.g., apical meristem, axillary buds, and root meristems), and induced meristem tissue (e.g., cotyledon meristem and hypocotyl meristem).
[0129] The CRISPR or nucleic acid construct may be transiently or stably introduced into a host cell and may be maintained non-integrated, for example, as a plasmid. Alternatively, it may be integrated into the host genome. The resulting transformed plant cell may then be used to regenerate a transformed plant in a manner known to persons skilled in the art.
[0130] Transformation of plants is now a routine technique in many species. Advantageously, any of several transformation methods may be used to introduce a CRISPR or nucleic acid construct into a suitable ancestor cell. The methods described for the transformation and regeneration of plants from plant tissues or plant cells may be utilized for transient or for stable transformation. Transformation methods include the use of liposomes, electroporation, chemicals that increase free DNA uptake, injection of the DNA directly into the plant, particle gun bombardment, transformation using viruses or pollen and microinjection. Methods may be selected from the calcium / polyethylene glycol method for protoplasts, electroporation of protoplasts, microinjection into plant material, DNA or RNA-coated particle bombardment, infection with (non-integrative) viruses and the like. Transgenic plants, including transgenic crop plants, are preferably produced via Agrobacterium tumefaciens mediated transformation.
[0131] To select transformed plants, the plant material obtained in the transformation is subjected to selective conditions so that transformed plants can be distinguished from untransformed plants. For example, the seeds obtained in the above-described manner can be planted and, after an initial growing period, subjected to a suitable selection by spraying. A further possibility is growing the seeds, if appropriate after sterilization, on agar plates using a suitable selection agent so that only the transformed seeds can grow into plants. Alternatively, the transformed plants are screened for the presence of a selectable marker.
[0132] The generated transformed plants may be propagated by a variety of means, such as by clonal propagation or classical breeding techniques. For example, a first generation (or T1) transformed plant may be selfed and homozygous second-generation (or T2) transformants selected, and the T2 plants may then further be propagated through classical breeding techniques. The generated transformed organisms may take a variety of forms. For example, they may be chimeras of transformed cells and nontransformed cells; clonal transformants (e.g., all cells transformed to contain the expression cassette); grafts of transformed and untransformed tissues (e.g., in plants, a transformed rootstock grafted to an untransformed scion).
[0133] The method may further comprise regenerating a genetically altered plant from the transformed plant or plant cell, and obtaining a progeny plant derived from the transgenic plant, wherein said progeny exhibits at least one mutation in a CNGC15 gene as described and shows an increase in nodulation and / or AM.
[0134] A genetically altered plant of the present invention may also be obtained by transference of any of the sequences of the invention by crossing, e.g., using pollen of the genetically altered plant described herein to pollinate a wild-type or control plant, or pollinating the gynoecia of plants described herein with other pollen that is not transformed or genetically altered as described herein. The methods for obtaining the plant of the invention are not exclusively limited to those described in this paragraph; for example, genetic transformation of germ cells from the ear of wheat could also be carried out as mentioned, but without having to regenerate a plant afterwards.
[0135] In a further aspect of the invention there is provided a plant obtained or obtainable by the above-described methods. In a further aspect, there is provided a seed obtained or obtainable from the plant. Also included in the scope of the invention is progeny plants obtained from the seed and as well as seed obtained from the progeny plants.
[0136] In another aspect of the invention there is provided the use of the genetically altered plant, part thereof or plant cell of the invention to improve or increase stress tolerance, as described above. In particular, there is provided the use of the genetically altered plant of the invention to maintain or be fertile under stress conditions, and in particular under heat stress conditions. That is, there is provided the use of the genetically altered plant of the invention in breeding when the plant is grown under stress, and in particular heat stress conditions. As described herein, the genetically altered plant, part thereof or plant cell of the invention may
[0137] (i) have at least one mutation, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), preferably in at least one conserved motif, as described above; or
[0138] (ii) express a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a CNGC amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation, and wherein preferably the at least one mutation is in at least one conserved motif. As described above.
[0139] In another aspect of the invention, there is provided a method for identifying and / or selecting a plant that has improved abiotic stress tolerance in a plant the method comprising screening a population of plants, parts thereof or plant cells and detecting in the plant or plant germplasm at least one polymorphism in at least one conserved domain of a cyclic nucleotide-gated ion channel (CNGC) gene, preferably a polymorphism in a VDPL motif; and selecting said plant.
[0140] There is also provided a method for identifying and / or selecting a plant that will maintain its fertility under stress conditions, the method comprising screening a population of plants and detecting in the plant or plant germplasm at least one polymorphism in at least conserved domain of CNGC, preferably a conserved domain of a CNGC15, preferably a polymorphism in the VDPL motif, as described above, compared to a control plant or a plant from the same or different plant population, and selecting said plant.
[0141] Suitable tests for assessing the presence of a polymorphism would be well known to the skilled person, and include but are not limited to, Isozyme Electrophoresis, Restriction Fragment Length Polymorphisms (RFLPs), Randomly Amplified Polymorphic DNAs (RAPDs), Arbitrarily Primed Polymerase Chain Reaction (AP-PCR), DNA Amplification Fingerprinting (DAF), Sequence Characterized Amplified Regions (SCARs), Amplified Fragment Length polymorphisms (AFLPs), Simple Sequence Repeats (SSRs-which are also referred to as Microsatellites), and Single Nucleotide Polymorphisms (SNPs). In one embodiment, Kompetitive Allele Specific PCR (KASP) genotyping is used.
[0142] In one embodiment, the method comprises a) obtaining a nucleic acid sample from a plant and b) carrying out nucleic acid amplification of CNGC alleles using one or more primer pairs.
[0143] In a further embodiment, the method may further comprise introgressing the chromosomal region comprising at least one of said CNGC polymorphisms as described above into a second plant or plant germplasm to produce an introgressed plant or plant germplasm.
[0144] In another aspect of the invention there is provided a plant obtained or obtainable by the method described herein. There is also provided a seed derived from a plant as described herein.
[0145] A plant according to all aspects of the invention described herein may be a monocot or a dicot plant.
[0146] In one embodiment, the plant is a crop plant. By crop plant is meant any plant which is grown on a commercial scale for human or animal consumption or use. In another embodiment the plant is Arabidopsis or Medicago truncatula.
[0147] The plant may be a dicot or a monocot. Preferably the plant is selected from wheat, rice, potatoes, maize, soybean, tomato, barley, sugar cane, sorghum, sunflower, sugar beet, rye, cotton, peanut, flax (common flax or linseed), strawberry, oilseed rape and any leguminous plant.
[0148] The term "plant" as used herein encompasses whole plants and progeny of the plants and plant parts, including seeds, fruit, shoots, stems, leaves, roots (including tubers), flowers, tissues and organs, wherein each of the aforementioned expresses the nucleic acid construct of the invention. The term "plant" also encompasses plant cells, suspension cultures, callus tissue, embryos, meristematic regions, gametophytes, sporophytes, pollen and microspores. The invention also extends to harvestable parts of a plant of the invention as described herein, but not limited to seeds, leaves, fruits, flowers, stems, roots, rhizomes, tubers and bulbs.
[0149] In a most preferred embodiment, the plant part or harvestable product is a seed or grain. Therefore, in a further aspect of the invention, there is provided a seed or grain produced from the methods described herein. Accordingly, in one aspect of the invention there is provided seed, wherein the seed comprises at least one mutation in CNGC15 as described herein or expresses the nucleic acid construct or CRISPR construct of the invention. Also provided is a progeny plant obtained from the seed as well as seed obtained from that progeny.
[0150] A control plant as used herein according to all of the aspects of the invention is a plant, which has not been modified according to the methods of the invention. Accordingly, in one embodiment the control plant does not express a nucleic acid construct of the invention or a CRSIPR construct or alternatively the plant does not have one or more mutations in the CNCG15 polypeptide as described herein. In one embodiment, the control plant is a wild type plant. Alternatively, a control plant is a plant that has not been exposed to heat stress. The control plant is typically of the same plant species, preferably having the same genetic background as the modified plant.
[0151] While the foregoing disclosure provides a general description of the subject matter encompassed within the scope of the present invention, including methods, as well as the best mode thereof, of making and using this invention, the following examples are provided to further enable those skilled in the art to practice this invention and to provide a complete written description thereof. However, those skilled in the art will appreciate that the specifics of these examples should not be read as limiting on the invention, the scope of which should be apprehended from the claims and equivalents thereof appended to this disclosure. Various further aspects and embodiments of the present invention will be apparent to those skilled in the art in view of the present disclosure.
[0152] Unless context dictates otherwise, the descriptions and definitions of the features set out above are not limited to any particular aspect or embodiment of the invention and apply equally to all aspects and embodiments, which are described. The invention is now described in the following non-limiting examples.
[0153] EXAMPLES
[0154] Example 1- Mutating CNGC15 Confers Heat Stress Tolerance During Fertilisation
[0155] Heat stress is known to have a dramatic and detrimental effect on the seed production of crops as well as model plant species, such as Arabidopsis. Heat stress affects the size of the siligue and the maturation of the seeds in wild-type Arabidopsis plants, this is shown in Figures 1 and 2. However, the inventors have found that introducing a gain of function mutation into CNGC15 rescues the seed setting and seed size defects observed in wild-type plants. This is shown in Figure 1 where it can be seen that only cngc15KO / CNGC15GoFplants developed seeds. The mutant complemented with the CNGC15GoFwas the only plant the presented normal seed development, demonstrating that CNGC15GoFcan confer heat stress resistance during fertilization period in Arabidopsis thaliana.
[0156] Methods:
[0157] Arabidopsis thaliana ColO wild type, mutant knock out CNGC15 (cngc15 KO), and the cngc15 KO expressing either CNGC15 or CNGC15GoFdriven by its native promoter were grown until the first flowering at 22°C (16 hours day, 8 hours night) and then transferred to heat stress conditions (16h day at 32°C, 8h night at 26°C). After 20 days, seed set was analysed.
[0158] SEQUENCE LISTING
[0159] The conserved domain “VDPL” is bold and highlighted as VDPL
[0160]
[0161] Mutant Polypeptide Sequences in Arabadopsis thaliana; Mutations are Bold and Underlined KPVE
[0162] Mutant Polypeptide Sequences in Glycine Max; Mutations are in Bold and Underlined Mutant Polypeptide Sequences in Medicago truncatula; Mutations are in Bold and Underlined Mutant Polypeptide Sequences in Oryza sativa var. Japonica; Mutations are Bold and Underlined MACNGSRAVRFQNDMELPHWKTSSVPEC TSSSRSTKHGKAQHQQQQHHDPRKWRRG GGGGGSLKDRVLSRAFSEELESLMSSGAN HLFFDPRGQLIHLWSKIFLAACLASLFVDSF FLYLTGTRQNMCIELKYSLAFTLSMIRSLLDL FYAAHIFFRFRTAFIAPSSRVFGRGELVIQP CKIARRYLAGTFWFDLVTALPLPQFVI Wl VI P KLKESATANRKNILRFSIIFQYLPRLFQIFPLS RQI MATGVMTETAWAGAAYN LI LYM LASH VLGALWYLFSVQRQEACWREACHVEGPS CQTLFFDCKTVSSNRTMWYELSNITSLCTP SNGFYQFGIYGEALDNGLTSSSFTQKYFYC FWWGLKNLSCLGQNLSTSLFIGEITFATVIG VLGLVLFALLIGNMQATMVRLEEWRTKRTD M ERWM N H RQI PQPLKQCVRRYHQYKWLA TRGVDEEALLEDLPMDIRRDIKRHLCLDLVR RVPLFDEMDERMLEAICERLRPALYTRGTR
[0163] LVRELDPVDSMLFIIRGYLDSYTTQGGRSGF FNSCRIGAGEFCGEELLPWALDPRPAASLP LSTRTVRAVSEVEAFALVADDLRFVASQFR
[0164] LOC-O Oryza RLHSARIRHRFRFYSHQWRTWAACFIQAA
[0165] OsCN s02g41 sativa var P115L WRRNKRRRASMELRMREGGEARPGGSVR
[0166] C15 184 710.1 japonica L116F CRRHSCDGKALIKKPMEPDFTVEEED
[0167] Mutant Polypeptide Sequences in Solanum lycopersicum; Mutations are in Bold and Underlined
[0168] 10
[0169] Mutant Polypeptide Sequences in Zea mays; Mutations are Bold and Underlined SR KP FD T A IA N G V Q GN W L KR W DL G R AA S FI
[0170] ZmC 8904_P P114S QAAWRRYKRRRASMELRVREVRAGGSLL
[0171] C15 204 01 Zea mays L115F RSRRHSIEGKASIRKPMEPDFTVEEED
[0172] Mutant Polypeptide Sequences in Triticum aestivum; Mutations are in Bold and Underlined
[0173] Mutant Polypeptide Sequences in Hordeum vulgare; Mutations are Bold and Underlined
[0174] Polypeptide Sequences in Arachis hypogaea
[0175] Polypeptide Sequences in Linum usitatissimum
[0176] 5
[0177] Nucleic Acid Sequences for Arachis hypogaea
[0178] 5 Nucleic Acid Sequences for Linum usitatissimum
[0179] Mutant Polypeptide Sequences in Arachis hypogaea; Mutations are in Bold and
[0180] 5 Underlined
[0181] Mutant Polypeptide Sequences in Linum usitatissimum; Mutations are in Bold and Underlined
[0182] 5 Polypeptide Sequences in Brassica napus Nucleic Acid Sequences for Brassica napus
[0183] Mutant Polypeptide Sequences in Brassica napus; Mutations are in Bold and Underlined
[0184] 5
[0185] Polypeptide Sequences in Fragaria vesca
[0186] Nucleic Acid Sequences for Fragaria vesca
[0187] Mutant Polypeptide Sequences in Fragaria vesca; Mutations are in Bold and Underlined
Claims
CLAIMS:
1. A method of improving abiotic stress tolerance in a plant, wherein said method comprises introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), wherein the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX, and wherein the abiotic stress tolerance is heat stress.
2. The method of claim 1 , wherein the method improves abiotic stress tolerance during fertilisation.
3. A method of maintaining plant fertility under stress, wherein said method comprises introducing at least one mutation in a plant, part thereof or plant cell, wherein the at least one mutation is in at least one gene encoding a nuclear localized cyclic nucleotide-gated ion channel (CNGC), wherein the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX.
4. The method of any preceding claim, wherein the cyclic nucleotide-gated ion channel (CNGC) is CNGC15.
5. The method of claim 4, wherein the CNCG15 gene encodes an amino acid sequence as defined in any one of SEQ ID NOs 1 to 42, 232 to 236, 247, 248 or 253 or a functional variant or homologue thereof.
6. The method of any preceding claim wherein the at least one mutation is in at least one conserved motif, wherein the motif comprises the residues XDPX, preferably XDPL, more preferably VDPL.
7. The method of claim 6, wherein the mutation comprises at least one substitution at one more positions in VDPL, wherein preferably the substitution is a P for L or S and / or a L for F.
8. The method of any preceding claim, wherein the mutation is a gain of function mutation.
9. A method of improving abiotic stress tolerance in a plant, wherein said method comprises introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a nuclear-localised cyclic nucleotide-gated ion channel (CNGC) amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation in at least one conserved motif, wherein the motif comprises theresidues XDPX, preferably XDPL, more preferably VDPL; and wherein the abiotic stress is heat stress.
10. The method of claim 1 , wherein the method improves abiotic stress tolerance during fertilisation.
11. A method of maintaining plant fertility under stress, wherein said method comprises introducing and expressing, in a plant, a nucleic acid construct, wherein said nucleic acid construct comprises a nucleic acid sequence encoding a nuclear-localised cyclic nucleotide-gated ion channel (CNGC) amino acid sequence, wherein the CNGC amino acid sequence comprises at least one mutation in at least one conserved motif, wherein the motif comprises the residues XDPX, preferably XDPL, more preferably VDPL.
12. The method of any of claims 9 to 11, wherein the CNGC in CNGC15.
13. The method of claim 12, wherein the nucleic acid sequence encodes a CNGC15 polypeptide as defined in one of SEQ ID NOs 85 to 231 , 242 to 246, 251 , 252, 255 or a functional variant thereof.
14. The method of any preceding claim, wherein the method maintains plant fertility when the plant is grown under low fertiliser conditions or in the absence of fertiliser.
15. A method for identifying and / or selecting a plant that has improved abiotic stress tolerance in a plant the method comprising screening a population of plants, parts thereof or plant cells and detecting in the plant or plant germplasm at least one polymorphism in at least one conserved domain of a cyclic nucleotide-gated ion channel (CNGC) gene, preferably a polymorphism in a VDPL motif; and selecting said plant.
16. A method for identifying and / or selecting a plant that will maintain its fertility under stress conditions, the method comprising screening a population of plants, parts thereof or plant cells and detecting in the plant or plant germplasm at least one polymorphism in at least one conserved domain of a cyclic nucleotide-gated ion channel (CNGC) gene, preferably a polymorphism in a VDPL motif; and selecting said plant.
17. The method of any preceding claim, wherein the plant is selected from wheat, rice, maize, soybean, tomato, barley, sugar cane, sorghum, sunflower, sugar beet, rye, cotton, potato, peanut, flax (common flax or linseed), strawberry, oilseed rape and any leguminous plant.
18. The method of claim 3, 11 or 16, wherein the stress is heat stress.
Citation Information
Patent Citations
Process for site specific mutagenesis without phenotypic selection
US4873192A
Methods of increasing root endosymbiosis
WO2023073224A1