Sweet potato IbNFYA3 gene and its application in improving plant stress resistance

By cloning and overexpressing the sweet potato IbNFYA3 gene, the problem of insufficient drought and salt tolerance of sweet potato was solved, and the normal growth and enhanced stress resistance of Arabidopsis thaliana under high salt and drought stress were achieved.

CN119391719BActive Publication Date: 2025-09-23QINGDAO AGRI UNIV +2
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
CN202411807826.9
Authority / Receiving Office
CN · China
Patent Type
Patents(China)
Current Assignee / Owner
Filing Date
2024-12-10
Publication Date
2025-09-23
Estimated Expiration
2044-12-10

AI Technical Summary

Technical Problem

In the existing technology, sweet potatoes have poor drought and salt resistance, and conventional breeding efficiency is low, making it difficult to effectively improve the plant's stress resistance, especially under drought and high salt stress, where growth is inhibited, affecting yield.

Method used

The sweet potato IbNFYA3 gene was cloned, a plant expression vector was constructed, and it was transformed into plants through Agrobacterium-mediated methods, etc., so that it was overexpressed, thereby improving the plant's stress resistance, especially high salt tolerance and drought tolerance.

Benefits of technology

Overexpression of the IbNFYA3 gene significantly improved the salt tolerance and drought tolerance of Arabidopsis thaliana, enabling it to maintain normal growth under high salt and drought stress and enhancing the plant's stress resistance.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN119391719B_ABST
    Figure CN119391719B_ABST
Patent Text Reader

Abstract

The present invention discloses the sweet potato IbNFYA3 gene and its application in improving plant stress resistance, belonging to the technical field of molecular biology. The amino acid sequence encoded by the sweet potato IbNFYA3 gene of the present invention is shown in SEQ ID NO.2, and its nucleic acid sequence is shown in SEQ ID NO.1. A plant expression vector of the IbNFYA3 gene was constructed and transformed into Arabidopsis thaliana. The results showed that Arabidopsis plants transformed with the IbNFYA3 gene had normal morphological development, and that the transgenic Arabidopsis seedlings could withstand at least 125mM NaCl stress or 300mM mannitol stress. Expression of the IbNFYA3 gene in Arabidopsis thaliana significantly improved its high salt tolerance and drought resistance. Therefore, the IbNFYA3 gene has important application value in the cultivation of new drought-resistant and salt-tolerant germplasms.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] The invention belongs to the technical field of molecular biology, and particularly relates to a sweet potato IbNFYA3 gene and an application thereof in improving plant stress resistance. Background Art

[0002] Organisms in their natural environments often face various adverse conditions (such as drought, high salinity, and low temperatures); these conditions can inhibit their growth and even lead to their death. With the continuous deterioration of the environment, stresses such as high salinity and drought have become a global problem. Breeding new varieties with multiple stress tolerances has become a major research goal for plant breeders.

[0003] Sweet potatoes are moderately drought- and salt-tolerant crops, but their tolerance varies across different growth stages. Drought and salt stress can inhibit sweet potato growth, affect tuber development, and reduce yield. Drought and salt tolerance in plants are controlled by multiple genes, and conventional breeding techniques are inefficient and time-consuming. Rapidly developing genetic engineering technologies are providing new avenues for genetic improvement. Genetic transformation using genes that play a key role in drought and salt stress responses is an important means of obtaining new drought- and salt-tolerant germplasm. Summary of the Invention

[0004] In view of the problems existing in the prior art, the object of the present invention is to provide the sweet potato IbNFYA3 gene and its application in improving plant stress resistance.

[0005] In order to achieve the above object, the present invention adopts the following technical solutions:

[0006] The sweet potato IbNFYA3 gene, the amino acid sequence encoded by the gene is shown in SEQ ID NO.2, and the nucleic acid sequence thereof is shown in SEQ ID NO.1.

[0007] Application of the sweet potato IbNFYA3 gene in improving plant stress resistance or preparing products that improve plant stress resistance.

[0008] Based on the above solution, the stress resistance is at least one of high salt resistance and drought resistance.

[0009] A method for improving plant stress resistance comprises constructing a plant expression vector containing the IbNFYA3 gene, transforming the vector into a plant, and overexpressing the IbNFYA3 gene in the plant, thereby improving the plant stress resistance; the amino acid sequence encoded by the IbNFYA3 gene is shown in SEQ ID NO.2.

[0010] Based on the above scheme, the nucleic acid sequence of the IbNFYA3 gene is shown as SEQ ID NO.1.

[0011] Based on the above solution, the stress resistance is at least one of high salt resistance and drought resistance.

[0012] On the basis of the above scheme, the method of transforming the plant body is one of the following methods: Agrobacterium-mediated method, gene gun method, electric shock method, PEG method, and liposome method.

[0013] Based on the above scheme, the Agrobacterium is Agrobacterium tumefaciens or Agrobacterium rhizogenes.

[0014] A product for improving plant stress resistance is a recombinant expression vector, expression cassette, recombinant bacteria, recombinant virus or transgenic cell line containing an IbNFYA3 gene sequence; the nucleic acid sequence of the IbNFYA3 gene is shown in SEQ ID NO: 1.

[0015] Beneficial effects of the present invention:

[0016] 1. The present invention cloned the IbNFYA3 gene from sweet potato. Sequencing results showed that the gene coding sequence contained 1101 nucleotides and the encoded protein contained 366 amino acids.

[0017] 2. A plant expression vector encoding the IbNFYA3 gene was constructed and transformed into Arabidopsis thaliana. Results showed that transgenic Arabidopsis plants harboring the IbNFYA3 gene exhibited normal morphological development and were resistant to at least 125 mM NaCl or 300 mM mannitol stress. Expression of the IbNFYA3 gene in Arabidopsis significantly improved its high-salinity and drought tolerance. Therefore, the IbNFYA3 gene has important application value in the development of new drought- and salt-tolerant germplasm. BRIEF DESCRIPTION OF THE DRAWINGS

[0018] Figure 1 For analysis of IbNFYA3 transcriptional activation activity;

[0019] Figure 2 The expression of IbNFYA3 in Xu 55-2 cells after being treated with 30% PEG6000, 200 mM NaCl and 100 μM ABA stress;

[0020] Figure 3 The in vitro phenotypes of drought and salt tolerance of Columbia wild-type Arabidopsis and IbNFYA3 transgenic Arabidopsis are shown;

[0021] Figure 4 Root length and fresh weight of Columbia wild-type Arabidopsis and IbNFYA3 transgenic Arabidopsis after NaCl or mannitol treatment;

[0022] Figure 5 To identify the drought and salt tolerance of wild-type Arabidopsis thaliana and IbNFYA3 transgenic Arabidopsis thaliana in pot culture;

[0023] Figure 6 Expression analysis of stress-resistance-related genes in Columbia wild-type Arabidopsis and IbNFYA3 transgenic Arabidopsis under different conditions;

[0024] Figure 7 To analyze the physiological and biochemical indicators of stress resistance of Columbia wild-type Arabidopsis and IbNFYA3 transgenic Arabidopsis under different conditions;

[0025] Figure 8 Analysis of reactive oxygen species accumulation in leaves of Columbia wild-type Arabidopsis and IbNFYA3 transgenic Arabidopsis under different conditions. DETAILED DESCRIPTION

[0026] The terms used in the present invention, unless otherwise specified, generally have the meanings commonly understood by those of ordinary skill in the art. Below, in conjunction with specific examples, the present invention will be further described in detail with reference to data. The following examples are merely for illustration of the present invention and are not intended to limit the scope of the present invention in any way.

[0027] The experimental methods in the following examples, unless otherwise specified, are all conventional methods and are performed according to the techniques or conditions described in the literature in this field or according to the product instructions. The experimental materials, reagents, and drugs used in the following examples, unless otherwise specified, can all be purchased through general channels.

[0028] In the following examples,

[0029] The sweet potato line “Xu 55-2” is a drought-tolerant sweet potato line preserved by the Sweet Potato Research Center of Qingdao Agricultural University;

[0030] Escherichia coli DH5α was maintained by the Sweet Potato Research Center of Qingdao Agricultural University;

[0031] The pGBKT7 vector was deposited by the Sweet Potato Research Center of Qingdao Agricultural University;

[0032] Y2H yeast cells were maintained by the Sweet Potato Research Center of Qingdao Agricultural University;

[0033] The plant expression vector Super1300 was deposited by the Sweet Potato Research Center of Qingdao Agricultural University;

[0034] Agrobacterium tumefaciens strain GV3101 was purchased from Shanghai Weidi Biotechnology Co., Ltd.;

[0035] The transgenic recipient material was the wild-type Arabidopsis thaliana Columbia variety provided by the Sweet Potato Research Center of Qingdao Agricultural University.

[0036] Example 1

[0037] Cloning of the IbNFYA3 gene

[0038] Using cDNA obtained by reverse transcription of sweet potato (Xu 55-2) RNA as a template, PCR amplification was performed with primer pair P1 and P2 to obtain the IbNFYA3 gene as shown in SEQ ID NO.1, which contains 1101 nucleotides and encodes a protein containing 366 amino acids, the sequence of which is shown in SEQ ID NO.2.

[0039] SEQ ID NO.1(5'→3'):

[0040]

[0041] SEQ ID NO.2

[0042] MLNFSFSKEGDQTAAQSFTPMSITSSSLWNSTDQPENPLSESADTGQKSAPQRGFCMKQTESQLQDQDNTSTLSTDQSHQTVAAMTPSNCHMPKVGPQPGFATLLSLLISSDMSHSLETQLGRLRSYAEIHERQMKDCSIKPSQPHLDEDCTIHQGQLDFSQSMACLSWTEPYLGRLVATYG PNGIIVVFLKFEQIYPQMVGIVPARMPLPSECAESIPIYVNAKQYRAILRRREIRAKLEAENKVVKVRKPYLHESRHAHALKRARGSGGRFLNKSELQQLKSAASPTHGKNISNQKGGGDISGSQLQHSESGSWGTTSTPSGSDVTSIFSGDGIFQQPEFRVSSSPYHMGVSMHEAENFVRRRT

[0043] The sequences of the PCR amplification primer pair P1 and P2 are as follows:

[0044] P1: 5'-ATGCCTAAATTTCTCATTCTC-3' (SEQ ID NO.3);

[0045] P2: 5'-TCAGGTTCTCTACGCACAA-3' (SEQ ID NO. 4).

[0046] PCR amplification system (50 μL): 25 μL 2× Flash HS PCR Master Mix, 2 μL each of 20 μmol / L forward and reverse primers, 500 ng reverse transcription product, and ddH2O supplementation;

[0047] The PCR amplification program was as follows: pre-denaturation at 95°C for 5 min, followed by 35 cycles of denaturation at 95°C for 30 s, annealing at 58°C for 30 s, and extension at 72°C for 1 min; after the cycle was completed, extension was continued for 10 min.

[0048] Example 2

[0049] IbNFYA3 transcriptional activation activity analysis

[0050] Primers were designed based on the IbNFYA3 sequence and conserved domains. Restriction sites (NdeⅠ and SalⅠ) and protective bases (primer sequences such as P3 and P4) were added to both ends of the primers. The full-length gene sequence was amplified and inserted into the multiple cloning site of the pGBKT7 vector (Kan resistance) to obtain the pGBKT7+IbNFYA3 recombinant vector.

[0051] The primers for constructing the IbNFYA3 transcriptional activation activity analysis vector are as follows. The underline indicates the restriction endonuclease recognition sequence:

[0052] P3:5'-GGAATTC CATATG ATGCTAAAATTTCCATTCTC-3'(NdeI, SEQ ID NO.5);

[0053] P4:5'-ACGC GTCGAC TCAGGTTCTTCTACGCACAA-3'(SalI, SEQ ID NO.6);

[0054] Transform the recombinant vector pGBKT7+IbNFYA3 into Y2H yeast cells as follows:

[0055] Yeast Y2H Gold was activated on YPDA solid medium. A single colony of yeast was picked and placed in a centrifuge tube. YPDA liquid medium was added and shaken. 1 mL of the culture was centrifuged at 5000 rpm for 1 minute, and the supernatant was discarded. The pellet was suspended in 500 mL of ddH2O and centrifuged at 5000 rpm for 1 minute, and the supernatant was discarded. The following were added to the centrifuge tube in sequence: 50 μL of 1M LiAc, 20 μL of 1M DTT, 6.75 μL of carrier DNA, and 1 μg of recombinant plasmid. Mix well, and then add 160 μL of 50% PEG4000. The tube was placed in a 42°C waterbath for 30 minutes. The tube was centrifuged at 5000 rpm for 1 minute, and the supernatant was discarded. The pellet was suspended in 500 mL of ddH2O and centrifuged at 5000 rpm for 1 minute, and the supernatant was discarded. Add 150 μL of ddH₂O to the centrifuge tube to resuspend the pellet. Streak the suspended cells onto SD / -Trp / -His / X-α-Gal solid medium and incubate in a 30°C incubator for 3-5 days. Observe the growth of the colonies. Use pGBKT7 as a negative control and pGAL4 as a positive control.

[0056] The results are as follows Figure 1 As shown, the protein encoded by the full-length IbNFYA3 gene does not have transcriptional activation activity.

[0057] Example 3

[0058] Expression of IbNFYA3 in sweet potato after adverse stress treatment

[0059] (1) Xu 55-2 seedlings were treated with Hoagland's solution containing 30% PEG6000, 200 mM NaCl, or 100 μM ABA. Samples were collected at 0 h, 1 h, 3 h, 6 h, 12 h, and 24 h after treatment, quickly frozen in liquid nitrogen, and ground into a powder. RNA was extracted using an RNA extraction kit. The extracted total RNA was treated with DNase I and purified.

[0060] (2) The samples were reacted on a QuantStudio 3 fluorescent quantitative PCR instrument.

[0061] The 20 μL reaction system includes: 10 μL 2×SybrGreen qPCR Master Mix, 0.25 μL each of 20 μmol / L forward and reverse primers, and 20 ng of reverse transcription product.

[0062] The amplification procedure was as follows: pre-denaturation at 94°C for 2 minutes, followed by 40 cycles of denaturation at 94°C for 30 seconds, annealing at 58°C for 30 seconds, and extension at 72°C for 30 seconds. After each cycle, the reaction was slowly heated to 94°C for melting curve preparation. Each reaction was performed in triplicate.

[0063] IbNFYA3 gene quantitative PCR primers are:

[0064] P5: 5'-CGGCTGCTGGAAAATGC-3' (SEQ ID NO.7);

[0065] P6: 5'-AAAGGGCGGTGGAGACA-3' (SEQ ID NO. 8).

[0066] The primer sequence of the internal standard gene Actin is:

[0067] P7: 5'-AGCAGCATGAAGATTAAGGTTGTAGCAC-3' (SEQ ID NO.9);

[0068] P8: 5'-TGGAAAATTAGAAGCACTTCCTGTGAAC-3' (SEQ ID NO. 10).

[0069] The results are as follows Figure 2 As shown in the data, the expression of IbNFYA3 gene was significantly upregulated after 30% PEG6000 and 200 mM NaCl stress treatments and was induced by 100 μM ABA, indicating that it is involved in the ABA-mediated response of sweet potato to drought and salt stress.

[0070] Example 4

[0071] Construction of IbNFYA3 gene plant expression vector

[0072] Using the cDNA of the sweet potato line "Xu 55-2" as a template, PCR amplification was performed using upstream and downstream primers (P9 and P10, the underline indicates the restriction endonuclease recognition sequence) containing KpnI and SalI restriction sites to obtain the coding region sequence of the IbNFYA3 gene containing the restriction sites.

[0073] P9:5'-GG GGTACC ATGCTAAAATTTCCATTCTC-3' (KpnI, SEQ ID NO. 11);

[0074] P10:5'-ACGC GTCGAC GGTTCTTCTACGCACAA-3'(SalI, SEQ ID NO.12)

[0075] The PCR product was recovered, and the plant expression vector Super1300 was digested with KpnI and SalI. The IbNFYA3 gene coding sequence was cloned into the corresponding restriction sites of the plant expression vector Super1300 to obtain the plant expression vector Super1300-IbNFYA3 of the gene.

[0076] Example 5

[0077] Obtaining Transgenic Arabidopsis thaliana Carrying the IbNFYA3 Gene

[0078] (1) Preparation, activation and bacterial liquid preparation of recombinant Agrobacterium strains: The Super1300-IbNFYA3 recombinant plasmid was transformed into competent cells of Agrobacterium strain GV3101 using the liquid nitrogen freeze-thaw method, and the recombinant strain containing the recombinant plasmid was screened. A single colony of the recombinant strain was picked and inoculated into LB (rifampicin 50 mg / L, kanamycin 50 mg / L) liquid medium. The culture was cultured at 28°C and 180 rpm until OD600 = 0.5-0.8. 2 mL of the bacterial liquid was transferred to 50 mL LB (rifampicin 50 mg / L, kanamycin 50 mg / L) medium and cultured until OD600 = 0.6-0.8. The bacterial liquid was centrifuged at 5000 rpm for 15 min and then suspended in the same volume of liquid 1 / 2 MS (0.02% Silwet L-77) for later use.

[0079] (2) Planting of Arabidopsis thaliana: Select appropriate Arabidopsis thaliana seeds, soak them in 1% NaClO for 5 minutes, rinse them with sterile water 4-6 times, and plant them on the substrate soil.

[0080] (3) Agrobacterium-mediated genetic transformation: Select healthy Arabidopsis plants in the early fruiting stage and place them upside down with their pots on top of a container containing the Agrobacterium suspension prepared in step 1). Immerse the entire inflorescence in the Agrobacterium suspension for approximately 20-30 seconds, taking care to minimize contact of the leaves with the solution. Remove the pots and place them horizontally in a dark box for approximately 24 hours. Maintain a constant humidity. After 24 hours, place the treated Arabidopsis plants under light conditions of 22-25°C to allow normal growth. Mature seeds are harvested approximately 3 weeks later.

[0081] Transgenic Arabidopsis seeds were inoculated into 20 mL of MS (hygromycin 50 mg / L) medium and cultured at 22°C for about 1 week. Bright green and strong Arabidopsis seedlings were selected and transplanted into substrate soil. Transgenic plants were purified to the T3 generation.

[0082] 3. PCR detection of transgenic plants

[0083] Genomic DNA from transgenic plants was extracted, and primers designed using the aforementioned vector sequences were used for PCR amplification. The PCR reaction procedure was as follows: 95°C for 5 minutes; 95°C for 50 seconds, 55°C for 50 seconds, 72°C for 1 minute, 32 cycles; and 72°C for 10 minutes. After completion of the reaction, the product was detected by electrophoresis, and positive transgenic plants were screened.

[0084] The primers for identifying transgenic plants are:

[0085] P13: 5'-CGCCATTTCGCCTTTTCAGAAATGG-3' (SEQ ID NO. 13);

[0086] P14: 5'-TGGTACAAACGTAGGGCTAGCTG-3' (SEQ ID NO. 14).

[0087] Example 6

[0088] Identification of Drought and Salt Tolerance in Transgenic Arabidopsis

[0089] To analyze the salt and drought tolerance of transgenic Arabidopsis thaliana seedlings, we seeded the transgenic IbNFYA3 Arabidopsis and wild-type Colombian Arabidopsis in 1 / 2 MS medium for germination. One week later, the seedlings were transferred to 1 / 2 MS medium containing 125 mM NaCl or 300 mM mannitol. The cultures were incubated at 22°C for about two weeks, and the results were observed. Figure 3 and Figure 4 As shown, the results showed that under high salt or mannitol stress conditions, the growth and rooting of transgenic IbNFYA3 Arabidopsis seedlings were better than those of Columbia wild-type Arabidopsis seedlings. Therefore, the salt tolerance of transgenic IbNFYA3 Arabidopsis seedlings was 125 mM or above, and the drought tolerance was 200 mM mannitol or above.

[0090] To analyze the salt and drought tolerance of transgenic plants under soil culture conditions, the seeds of the transgenic IbNFYA3 gene Arabidopsis and the wild-type Arabidopsis thaliana were inoculated in 1 / 2MS culture medium for germination. After 1 week, the seedlings were transferred to culture soil and cultured for another 10 days before treatment. The salt-treated plants were irrigated with a 300 mM NaCl aqueous solution every 3 days, while the natural drought-treated plants were not irrigated. After 2 weeks of natural drought, they were rehydrated for 3 days and the results were observed (e.g. Figure 5 The results showed that under high salt or natural drought stress conditions, the growth and rooting of transgenic IbNFYA3 Arabidopsis seedlings were better than those of Columbia wild-type Arabidopsis seedlings.

[0091] Example 7

[0092] Induced expression of stress-resistant genes in transgenic IbNFYA3 Arabidopsis and Columbia wild-type Arabidopsis under different conditions

[0093] RNA was extracted from Arabidopsis thaliana (IbNFYA3) and wild-type (Columbia) plants subjected to normal stress, drought stress (natural drought for two weeks), or high-salt stress (irrigated with a 300 mM NaCl solution every three days for two weeks). The extracted total RNA was treated with DNase I and purified. Fluorescent quantitative primers were designed based on sequences specific to Arabidopsis stress resistance genes. The samples were reacted using a QuantStudio 3 fluorescent quantitative PCR instrument using the same reaction system as in Example 3, and the data were analyzed.

[0094] AtZEP and gene quantitative PCR primers are:

[0095] P15: 5'-CGGAGCTTTCTTCTTGATGG-3' (SEQ ID NO. 15);

[0096] P16: 5'-TCGATTTCGGAGTTTTCCTG-3' (SEQ ID NO. 16);

[0097] AtLOX2 gene quantitative PCR primers are:

[0098] P17: 5'-CAAACCTCAGAAGACGATGTAAGG-3' (SEQ ID NO. 17);

[0099] P18: 5'-GACCTCTCGACCAAGTTATGCC-3' (SEQ ID NO. 18);

[0100] AtP5CR gene quantitative PCR primers are:

[0101] P19: 5'-AGTTTAGCTTCACAGACCGTTC-3' (SEQ ID NO. 19);

[0102] P20: 5'-GCTCTGTGAGAGCTCGCGGCTTC-3' (SEQ ID NO. 20);

[0103] AtP5CS gene quantitative PCR primers are:

[0104] P21: 5'-ATGATCTTATTTATGTTCTGC-3' (SEQ ID NO. 21);

[0105] P22: 5'-CACTATCTTCCGTCACTAT-3' (SEQ ID NO. 22);

[0106] The primer sequence of the internal standard gene AtActin is:

[0107] P23: 5'-GCACCCTGTTCTTCTTACCGA-3' (SEQ ID NO. 23);

[0108] P24: 5'-AGTAAGGTCACGTCCAGCAAGG-3' (SEQ ID NO. 24).

[0109] The results are as follows Figure 6 As shown, under normal growth conditions, there were no significant differences in the expression levels of stress-resistance genes between transgenic and wild-type lines. However, under salt or drought stress, the expression levels of AtZEP, a gene involved in the ABA signaling pathway, AtLOX2, a gene involved in the JA signaling pathway, and AtP5CR and AtP5CS, genes involved in the proline biosynthesis pathway, were significantly higher in transgenic Arabidopsis than in wild-type plants. This suggests that IbNFYA3 activates the expression of stress-resistance genes under salt or drought stress.

[0110] Physiological and biochemical indicators related to stress resistance in transgenic IbNFYA3 Arabidopsis

[0111] (1) Transgenic IbNFYA3 Arabidopsis thaliana and Columbia wild-type Arabidopsis plants were collected under normal stress, drought stress (natural drought for 2 weeks), or high salt stress (irrigation with 300 mM NaCl aqueous solution for 2 weeks, watering once every 3 days). The malondialdehyde (MDA) and proline (Pro) contents of Arabidopsis thaliana plants under different conditions and the enzyme activities of SOD and POD, key enzymes in the active oxygen scavenging system, were determined using a microplate reader.

[0112] The results are as follows Figure 7As shown, the relevant parameters of the normally growing IbNFYA3 transgenic lines did not differ significantly from those of the wild-type lines. However, under salt or drought stress, the MDA content of the IbNFYA3 transgenic lines was significantly lower than that of the wild-type lines, while the Pro content and the enzyme activities of SOD and POD were significantly higher than those of the wild-type plants. These results indicate that overexpression of IbNFYA3 can activate the reactive oxygen species scavenging system in transgenic plants under drought or salt stress, enhance their osmotic regulation ability, and reduce stress damage to the membrane system.

[0113] (2) Leaves of Arabidopsis thaliana with IbNFYA3 gene and wild-type Arabidopsis thaliana under different treatment conditions were taken for NBT staining and DAB staining to analyze the leaf O 2- 2 and H2O accumulation.

[0114] The results are as follows Figure 8 As shown, under stress, Arabidopsis transgenic plants overexpressing IbNFYA3 2- The accumulation of H2O2 in Arabidopsis thaliana was significantly lower than that in wild-type Arabidopsis. Overexpression of the IbNFYA3 gene reduced the excessive accumulation of reactive oxygen species under drought and high salt stress, alleviating the damage of high salt and drought stress to the physiological activities of Arabidopsis thaliana.

[0115] The above description is merely a preferred embodiment of the present invention and is not intended to limit the present invention in any other manner. Any person skilled in the art may utilize the above-disclosed technical content to modify or modify the present invention into equivalent embodiments. However, any simple modifications, equivalent variations, and modifications to the above embodiments that do not depart from the technical content of the present invention and are based on the technical essence of the present invention remain within the scope of protection of the present invention.

Claims

1. Sweet potato IbNFYA3 The use of a gene in improving plant stress resistance or preparing a product that improves plant stress resistance is characterized in that: The sweet potato IbNFYA3 The amino acid sequence encoded by the gene is shown in SEQ ID NO. 2; the stress resistance is at least one of high salt tolerance and drought tolerance.

2. The use according to claim 1, characterized in that The sweet potato IbNFYA3 The nucleic acid sequence of the gene is shown in SEQ ID NO.

1.

3. A method for improving plant stress resistance, characterized in that: Build contains IbNFYA3 Plant expression vectors of genes are transformed into plants to make IbNFYA3 Gene overexpression, thereby improving plant stress resistance; IbNFYA3 The amino acid sequence encoded by the gene is shown in SEQ ID NO. 2; the stress resistance is at least one of high salt tolerance and drought tolerance.

4. The method for improving plant stress resistance according to claim 3, wherein: described IbNFYA3 The nucleic acid sequence of the gene is shown in SEQ ID NO.

1.

5. The method for improving plant stress resistance according to claim 3, wherein: The method of transforming the plant body is one of the following: Agrobacterium-mediated method, gene gun method, electric shock method, PEG method, and liposome method.

6. The method for improving plant stress resistance according to claim 5, characterized in that: The Agrobacterium is Agrobacterium tumefaciens or Agrobacterium rhizogenes.