Drought-resistant gene osdel1, amplification method and application in plant drought-resistant improvement

Abstract

The application discloses a drought-resistant gene OsDEL1, an amplification method and application in plant drought-resistant improvement, and belongs to the technical field of plant genetic engineering. The application provides a drought-resistant gene OsDEL1, wherein the nucleotide sequence of the drought-resistant gene OsDEL1 is shown as SEQ ID NO. 1. The application further provides a primer pair for amplifying the drought-resistant gene OsDEL1, a method for amplifying the drought-resistant gene OsDEL1 by using the primer pair, and application of the drought-resistant gene OsDEL1 in improving plant drought resistance. The drought-resistant gene OsDEL1 and the corresponding protein are applied to genetic engineering and breeding of crops, new drought-resistant rice varieties are bred, the safety hazard of abnormal drought caused by global climate change to food crops is reduced, and the drought-resistant gene OsDEL1 has important reference significance for drought-resistant related research of other crops.

Description

TECHNICAL FIELD

[0001] The present application relates to the field of plant genetic engineering technology, in particular to a drought-resistant gene OsDEL1, an amplification method and application in plant drought resistance improvement. BACKGROUND

[0002] Rice (Oryza sativa L.) is one of the most important food crops in the world, and its production is affected by various environmental factors, among which drought is one of the main abiotic stresses that limit rice yield. Therefore, improving the drought resistance of rice is crucial to food security. When plants perceive drought stress, they will initiate the expression of a series of drought stress-related genes to regulate the tolerance of plants to drought. Transcription factors play a very important role in the molecular regulation network of plant drought resistance. They can activate or inhibit the transcription of downstream target genes by binding to specific cis-acting elements in the promoter of downstream target genes, thereby responding to drought stress. Transcription factor families such as bZIP, NAC MYB, bHLH, WRKY, AP2 / EREBP and GRF can all participate in regulating the response of rice to adverse stress. Members of the E2F / DP transcription factor family can also participate in regulating the drought resistance of plants. For example, overexpression of the maize ZmE2F gene in Arabidopsis thaliana can improve the drought resistance of Arabidopsis thaliana. However, the research on this family of members is relatively less.

[0003] Exploring new drought-resistant genetic resources in rice and elucidating their drought resistance molecular mechanisms can provide a theoretical basis for breeding new high-quality drought-resistant rice varieties. It is of great significance to ensure the safe production and sustainable development of rice. Since there is no relevant report on whether the OsDEL1 gene can improve the drought resistance of rice, cloning the OsDEL1 gene from rice and exploring its biological function in improving the drought resistance of rice are of great significance for breeding new drought-resistant rice varieties. SUMMARY

[0004] The purpose of the present application is to provide a drought-resistant gene OsDEL1, an amplification method and application in plant drought resistance improvement, to solve the problems existing in the prior art. The OsDEL1 gene provided by the present application can improve the drought resistance of rice, and has good application prospect in breeding drought-resistant rice varieties. The present application lays an important foundation for rice drought resistance breeding.

[0005] To achieve the above purpose, the present application provides the following solutions.

[0006] Technical solution one: a drought-resistant gene OsDEL1, the nucleotide sequence of the drought-resistant gene OsDEL1 is shown as SEQ ID NO. 1.

[0007] Technical solution two: the protein encoded by the drought-resistant gene OsDEL1.

[0008] Further, the amino acid sequence of the protein is shown as SEQ ID NO. 2.

[0009] Technical solution three: a set of primer pairs for amplifying the drought-resistant gene OsDEL1, comprising an upstream primer with a nucleotide sequence as shown in SEQ ID NO. 3 and a downstream primer with a nucleotide sequence as shown in SEQ ID NO. 4.

[0010] Technical solution four: a method for amplifying the drought-resistant gene OsDEL1 using the primer pairs, comprising the following steps: using the nucleic acid molecules of plants as templates, preparing the templates and the primer pairs into a PCR amplification system for PCR amplification to obtain the drought-resistant gene OsDEL1.

[0011] Technical solution five: a method for improving the drought resistance of plants by reducing the expression level of the OsDEL1 gene.

[0012] Technical solution six: the drought-resistant gene OsDEL1, the protein, or the drought-resistant gene OsDEL1 amplified by the method in improving the drought resistance of plants.

[0013] Further, the plants include rice.

[0014] Technical solution seven: the drought-resistant gene OsDEL1, the protein, or the drought-resistant gene OsDEL1 amplified by the method in breeding crop germplasm with different drought resistance.

[0015] Further, the drought resistance is reduced by overexpressing the expression level of the drought-resistant gene OsDEL1, and the drought resistance is enhanced by reducing the expression level of the drought-resistant gene OsDEL1.

[0016] The present application finds that knocking out the OsDEL1 gene can improve the drought resistance of rice.

[0017] The present application provides the application of the OsDEL1 gene in regulating the drought resistance of rice, specifically, overexpressing the OsDEL1 gene can reduce the survival rate of rice under drought conditions and reduce the drought resistance of rice; knocking out the OsDEL1 gene can improve the survival rate of rice under drought conditions and improve the drought resistance of rice, and knocking out the OsDEL1 gene can improve the sensitivity of rice to ABA; the nucleotide sequence of the OsDEL1 gene is shown as SEQ ID NO. 1, and the amino acid sequence of the protein encoded by the rice OsDEL1 gene is shown as SEQ ID NO. 2.

[0018] The method for reducing the expression amount of the OsDEL1 gene in rice is to knock out the OsDEL1 gene in rice and introduce a wild-type receptor material into rice to improve the drought resistance of rice.

[0019] Further, the knockout vector of the rice OsDEL1 gene is constructed by using the CRISPR / Cas9 method, and the knockout vector is transformed into a wild type receptor material of rice to improve the drought resistance of rice.

[0020] Further, the variety of the rice is Zhonghua 11.

[0021] The present application discloses the following technical effects:

[0022] The present application constructs the overexpression and gene knockout vector of the rice OsDEL1 gene, and the overexpression and knockout vector is transformed into a receptor material of rice by using the Agrobacterium-mediated method. The positive plants are detected by using the fluorescence quantitative PCR and sequencing analysis. The drought resistance of the obtained positive transgenic plants is analyzed, and the results show that the OsDEL1 gene can improve the drought tolerance of rice, the knockout of the gene in rice can significantly improve the drought resistance of rice, the overexpression of the OsDEL1 gene significantly reduces the drought resistance of rice, and therefore the rice OsDEL1 gene can be applied to the genetic engineering breeding of crops, and has a good application prospect in the cultivation of drought-resistant rice varieties, and lays an important foundation for the drought-resistant breeding of rice. BRIEF DESCRIPTION OF DRAWINGS

[0023] In order to more clearly illustrate the technical solutions in the embodiments of the present application or the prior art, the drawings needed in the embodiments will be briefly introduced below. Obviously, the drawings in the following description are only some embodiments of the present application, and other drawings can be obtained by those skilled in the art without creative labor.

[0024] Figure 1 The results of the real-time fluorescence quantitative PCR analysis of the expression pattern of OsDEL1 in wild type ZH11 at different time points after 20% PEG treatment (A) and 50 μM ABA treatment (B); the untreated is used as a control and is recorded as 0h; * represents a significant difference compared with the control (*, P<0.05, **, P<0.01, ***, P<0.001), and the statistical method uses T-test test;

[0025] Figure 2 The expression amount of OsDEL1 in the OsDEL1 overexpression transgenic rice is detected by real-time fluorescence quantitative PCR; * represents a significant difference compared with the wild type (*, P<0.05, **, P<0.01, ***, P<0.001), and the statistical method uses T-test test;

[0026] Figure 3 The target sequence information of the first and second exon regions of the OsDEL1 gene (A) and the target sequence editing effect of the knockout transgenic rice (B).

[0027] Figure 4 Rehydration of rice for each treatment group, wherein A is before treatment, B is 24 hours after rehydration, and C is 8 days after rehydration;

[0028] Figure 5 Rehydration of rice for each treatment group, wherein A is before treatment, B is 24 hours after rehydration, and C is 8 days after rehydration;

[0029] Figure 6 Survival of rice under drought stress for each treatment group, wherein A is wild type and OsDELl-ox type rice, and B is wild type and del 1 type transgenic rice;

[0030] Figure 7 Measurement of water loss rate of OsDELl gene overexpression and knock-out transgenic rice under drought stress; * represents significant difference compared with wild type (*, P < 0.05, **, P < 0.01, ***, P < 0.001), and the statistical method is T-test;

[0031] Figure 8 Sensitivity of wild type rice (ZH11) and OsDELl gene knock-out transgenic rice (del 1-1 and del 1-2) to ABA, wherein A is germination of CK group (0 μM ABA), and B is germination under 5 μM ABA;

[0032] Figure 9 Statistics of sensitivity of wild type rice (ZH11) and OsDELl gene knock-out transgenic rice (del 1-1 and del 1-2) to ABA, wherein A is statistics of root length and bud length of CK group (0 μM ABA), and B is statistics of root length and bud length under 5 μM ABA. DETAILED DESCRIPTION

[0033] Various exemplary embodiments of the present application will now be described in detail, with reference to the drawings. The detailed description is not to be taken in a limiting sense and is understood to be merely describing certain aspects, features, and embodiments of the present application.

[0034] It is to be understood that the terminology used herein is for the purpose of describing particular embodiments only and is not intended to be limiting. Additionally, for a numerical range recited in this disclosure, it is contemplated that each and every value and sub-range within the range is specifically included and disclosed. Every

[0035] Unless otherwise indicated, all technical and scientific terms used herein have the same meaning as those commonly understood by one of ordinary skill in the art to which this application pertains. Although methods and materials similar or equivalent to those described herein can be used in the practice or testing of the present application, the preferred methods and materials are described. All publications mentioned in this specification are herein incorporated by reference for the purposes of the disclosure and description of the procedures and / or materials described therein. In case of conflict between the content of the specification and that of any incorporated literature, the content of the specification controls.

[0036] Various modifications and variations of the described methods and materials of the application will be apparent to those skilled in the art from the foregoing disclosure. Other embodiments of the application will be apparent to those skilled in the art from consideration of the specification and practice of the application disclosed herein. The specification and examples given are exemplary only. It is to be understood that the application is not limited in scope by the

[0037] As used herein, the terms "comprises", "comprising", "includes", "including", "has", "having", "contains", "containing", or variations thereof, are intended to be open-ended terms that mean inclusion, but not limited to, the listed materials and methods.

[0038] The application first uses transcriptome sequencing analysis to screen OsDEL1 gene from wild type rice ZH11 (Zhonghua 11, purchased conventionally) in response to drought stress, indicating that OsDEL1 may be involved in regulating drought resistance of rice. In order to verify this hypothesis, the application uses real-time fluorescent quantitative PCR to detect the expression of OsDEL1 in wild type rice ZH11 after 20% PEG treatment (simulating drought stress), and finds that the expression of OsDEL1 is significantly down-regulated after 20% PEG treatment for 0.5h-24h, indicating that OsDEL1 can respond to drought stress.

[0039] Example 1 Real-time fluorescent quantitative PCR analysis of the response of OsDEL1 to drought

[0040] 1. Primer design for real-time quantitative PCR

[0041] Nucleotide sequence of OsDEL1:

[0042]

[0043] Amino acid sequence of the protein encoded by OsDEL1:

[0044] MATAAVMAAVPSSSPADAAEAVVMTEAVPSLPQRQQPVFVEGRGGKLRDHAYSRKQKSLGLLCSNFVALYNRDDVESIGLDDAARRLGVERRRIYDIVNVLESVGILVRKAKNRYSWIGFGGVPMALRELKERALREKSGLAPLPVEEPSAAIMSDDEDEDKMGDADGDTESEKLSQPVDNPSDNKPGAPRCRLRSDHRKEKSLGLLTQNFVKLFLTMEVDTISLDEAAKLLLGEGHAENSMRTKVRRLYDIANVLSSLNFIDKIQQADSRKPAFRWLGSAGKPKAENGVTIAVPPPGKTISNKRAFGTELTNIDINRSRLDSTIPKKAKLTLSGGEILKNCKLSVQKQLGQGSKGGFVYGPFHPAGARKQELDNGNKGHTDNVQNWESLAASFRPQYQNQALGDLFAHYVEAWKSWYSEFAQGSSMMQQHFGMPVINQFL*(SEQ ID NO. 2).

[0045] The real-time quantitative PCR primers were designed according to the nucleotide sequence of OsDEL1 as follows:

[0046] OsDEL1-q-F (upstream primer): GACTCAACAATCCCAAAGAA (SEQ ID NO. 3);

[0047] OsDEL1-q-R (downstream primer): TTTCCAGGCTTCCACATA (SEQ ID NO. 4).

[0048] 2. Material culture and stress treatment

[0049] (1) The test rice material was wild type ZH11, which was cultured in a water culture box to the four-leaf stage.

[0050] (2) Take the leaves of rice seedlings at different time points of untreated, 20% PEG treatment after 0.5 h, 2 h, 6 h, 8 h, 12 h and 24 h, and 50 μM ABA treatment after 2 h, 6 h and 12 h, and freeze them in liquid nitrogen and keep them in a refrigerator at -80°C. Use Trizol reagent to extract total RNA of rice, and reverse transcribe the RNA into cDNA, and use the cDNA as a template for real-time fluorescent quantitative PCR (real-time fluorescent quantitative PCR reaction system and procedure: refer to the instructions of the SuperMix for qPCR of Qiagen Prepare the reaction system (operate on ice) using the instructions of the Green qPCR SuperMix. Use a two-step PCR reaction, and the amplification standard procedure is as follows:

[0051]

[0052] The results, as shown in Figure 1 , show that the expression of OsDEL1 gene in ZH11 is significantly down-regulated after 20% PEG and 50 μM ABA treatment, indicating that the gene plays an important role in drought stress.

[0053] Example 2 Construction of OsDEL1 overexpression and knockout transgenic rice

[0054] 1. Use the PCAMBIA1301 vector (purchased from New England Biolabs) to construct the overexpression vector of OsDEL1, and use the 35S promoter to drive the expression of OsDEL1, as follows:

[0055] (1) Design the following primers according to the nucleotide sequence of OsDEL1 to amplify the CDS sequence thereof:

[0056] OsDEL1-ox-F: TGACCATGGTAGATCTCTATGGCGACGGCGGCGGT (SEQ ID NO. 5);

[0057] OsDEL1-ox-R: AATTCGAGCTGGTGACCCAAAAACTGGTTAATGACAGGCA (SEQ ID NO. 6).

[0058] (2) Extract the total RNA of the leaves of wild-type ZH11 grown under normal conditions, and reverse transcribe to obtain cDNA. Use the cDNA as a template, and use the high-fidelity DNA polymerase Max Master Mix was used to amplify the rice OsDEL1 gene. The PCR product was detected by 1% agarose gel electrophoresis, and a single DNA band (1321 bp) was obtained, which was the OsDEL1 gene fragment amplified by PCR. The OsDEL1 fragment was recovered according to the instructions of Magen HiPure Gel Pure DNA Kits.

[0059] The PCAMBIA1301 vector was double-digested with BglII and BstEII, and the digested product was recovered. According to the ClonExpress II One Step Cloning Kit instructions, the OsDEL1 gene fragment recovery product was connected to the PCAMBIA1301 vector according to the connection system in Table 1 by homologous recombination method, and the overexpression vector of OsDEL1 (OsDEL1-ox) was obtained.

[0060] Table 1 Connection system

[0061]

[0062]

[0063] Note: X / Y is calculated according to the formula to obtain the amount of vector and insert (calculation formula: optimal cloning vector usage = [0.02 x cloning vector base pair number] ng; optimal insert usage = [0.04 x insert base pair number] ng). In Table 1, X is 4 μL and Y is 10 μL.

[0064] 2. The pYLCRISPR / Cas9Pubi-H vector was used to construct the knockout vector of OsDEL1, as follows:

[0065] (1) According to the nucleotide sequence of OsDEL1, the following target sequence was selected on the first exon and the second exon:

[0066] Target 1: TCGTCTTCGCCGGCCGACGC (SEQ ID NO. 7);

[0067] Target 2: GCGACGACGTGGAGTCTATC (SEQ ID NO. 8);

[0068] According to the target sequence, the following target primers were synthesized:

[0069] OsDEL1-gRT1: CGTCGGCCGGCGAAGACGAGTTTTAGAGCTAGAAAT (SEQ ID NO. 9);

[0070] OsDEL1-OsU6aT1: TCGTCTTCGCCGGCCGACGGGCAGCCAAGCCAGCA (SEQ ID NO. 10);

[0071] OsDEL1-gRT2: CGACGACGTGGAGTCTATCGTTTTAGAGCTAGAAAT (SEQ ID NO. 11);

[0072] OsDEL1-OsU6aT2: GATAGACTCCACGTCGTCGGGCAGCCAAGCCAGCA (SEQ ID NO. 12);

[0073] (2) Construction of sgRNA expression cassette (take target 1 as an example):

[0074] 1) Take 2-5 ng pYLgRNA-OsU6a plasmid as a template, 0.2 μM of primer U-F and OsDEL1-OsU6aT1, 0.1 μM of primer gR-R and OsDEL1-gRT1, and use high-fidelity enzyme Max Master Mix to perform the first round of PCR reaction. The PCR reaction program is as follows: 25-28 cycles of 94°C for 10 s, 58°C for 15 s, and 72°C for 20 s. In the amplification process, the sgRNA expression cassette fragment combined by two fragments is generated by overlapping PCR. The sequence of the primer U-F is shown in SEQ ID NO. 13, and the sequence of the primer gR-R is shown in SEQ ID NO. 14;

[0075] U-F: CTCCGTTTTACCTGTGGAATCG (SEQ ID NO. 13);

[0076] gR-R: CGGAGGAAAATTCCATCCAC (SEQ ID NO. 14).

[0077] 2) Take 1 μl of the first round of PCR product diluted 10 times with ddH2O, and take 1 μl as a template. Add Pps-GGL and Pgs-GGR as primers (final concentration 0.15 μM). Amplify using high-fidelity enzyme Max Master Mix, and the PCR program is as follows: 17-20 cycles of 94°C for 10 s, 58°C for 15 s, and 72°C for 20 s. The PCR product is detected by 1% agarose gel electrophoresis, and the sgRNA expression cassette is recovered. The sequence of the primer Pps-GGL is shown in SEQ ID NO. 15, and the sequence of the primer Pgs-GGR is shown in SEQ ID NO. 16;

[0078] ​​Pps-GGL: TTCAGAGGTCTCTCTCGACTAGTATGGAATCGGCAGCAAAGG (SEQ ID NO. 15);

[0079] Pgs-GGR: AGCGTGGGTCTCGACCGACGCGTATCCATCCACTCCAAGCTC (SEQ ID NO. 16).

[0080] 3) Assembly of sgRNA expression cassette to pYLCRISPR / Cas9Pubi-H vector. pYLCRISPR / Cas9Pubi-H plasmid and sgRNA expression cassette were subjected to enzyme digestion-ligation reaction according to the enzyme digestion-ligation system shown in Table 2, and the enzyme digestion-ligation was performed by temperature cycling: 3 cycles (37°C for 10 min, 10°C for 5 min, 20°C for 5 min) first; 10 cycles (37°C for 3 min, 10°C for 5 min, 20°C for 5 min) second, and finally 37°C for 5 min. The ligation product was obtained;

[0081] Table 2 Enzyme digestion-ligation system

[0082]

[0083] 4) The ligation product in step 3) was transformed into DH5a competent cells by heat shock, and positive clones were identified by blue-white screening and bacterial liquid PCR detection, to obtain OsDEL1 gene knockout vectors.

[0084] Example 3: Obtaining of OsDEL1 overexpression and knockout transgenic rice and identification of positive plants

[0085] The OsDEL1 overexpression and knockout vector plasmids obtained in Example 2 were transformed into Agrobacterium EHA105. The overexpression and knockout vectors were transformed into wild type ZH11 variety by Agrobacterium EHA105 mediated genetic transformation method to obtain transgenic plants. Transgenic positive plants OsDEL1-ox-1, OsDEL1-ox-16 and OsDEL1-ox-17 of OsDEL1 overexpression were obtained by PCR detection of hygromycin gene Hpt and real-time quantitative PCR detection of OsDEL1 expression. Figure 2

[0086] The following method was used to detect the targeting effect of OsDEL1 gene knockout transgenic rice:

[0087] ​(1) The DNA of the T0 generation of the gene knockout transgenic rice obtained by using the CTAB method was extracted, and the target sequence of the first exon and the second exon region of the OsDEL1 gene was amplified by PCR, and the amplification product was sent to Shanghai Shenguo Bioengineering Co., Ltd. for sequencing. The PCR amplification primer sequence of the target sequence of the first exon and the second exon region of the OsDEL1 gene is as follows.

[0088] OsDEL1-csa9-JC-target1-F: GCCAAATCAAAGCCCCCTCT (SEQ ID NO. 17);

[0089] OsDEL1-csa9-JC-target1-R: CCAAATCCACGAATCCCCC (SEQ ID NO. 18).

[0090] OsDEL1-csa9-JC-target2-F: TTATGACGGAGGCGGTGC (SEQ ID NO. 19);

[0091] OsDEL1-csa9-JC-target2-R: AATGCCATTGGGACGCC (SEQ ID NO. 20).

[0092] (2) The sequencing results were compared with the target sequence, and whether the targeting was successful was identified by judging whether single base insertion, deletion, mutation or deletion of several bases occurred at the target site.

[0093] The results are shown in Table 1. Figure 3 As shown in Table 1, the target sequence of the OsDEL1 gene knockout transgenic rice del1-1 and del1-2 produced a 1 bp base insertion compared with the wild type WT, proving that the target sequence of the OsDEL1 gene knockout transgenic rice was successfully targeted.

[0094] Example 4: Drought resistance identification of OsDEL1 gene overexpression and knockout transgenic rice plants

[0095] The drought resistance of the positive plants of the overexpression and knockout transgenic rice obtained in Example 3 was detected, and the specific detection method is shown as follows:

[0096] The OsDEL1-ox, del1 transgenic rice and ZH11 seedlings cultured in the international rice nutrition solution for about 15 days were subjected to water stress by pouring off the water culture solution for 24 h. Then the rehydration experiment was carried out, and the survival rate was counted after taking pictures 6-7 days after rehydration. Figures 4-6 The results showed that the survival rate of the transgenic rice overexpressing the OsDEL1 gene was lower under drought stress, and the drought resistance was weaker; the survival rate of the del1 transgenic rice was higher under drought stress, and the drought resistance was stronger.

[0097] Example 5 Measurement of water loss rate of OsDEL1 gene transgenic rice plants

[0098] The leaves of ZH11 and OsDEL1 gene overexpression and knockout transgenic rice plants at the heading stage were cut into 2 cm in length on average, and divided into three equal parts, with 3 repeats. They were placed in a culture dish and naturally lost water at room temperature (25°C). The weight of the leaves was measured at 0, 1, 2, 4, 6, 18, and 20 hours, and the water loss rate was calculated as (weight before water loss - weight after water loss) / weight before water loss. "ZH11" represents the wild type, and * represents a significant difference compared with the wild type (*, P < 0.05, **, P < 0.01, ***, P < 0.001). The statistical method used T-test. Figure 7 The results show that the water loss rate of OsDEL1 gene overexpression transgenic rice is significantly higher than that of ZH11, and the water loss rate of OsDEL1 gene knockout transgenic rice is significantly lower than that of ZH11. It is shown that knocking out the OsDEL1 gene can improve the drought resistance of rice by reducing the water loss rate of rice.

[0099] Example 6 del1 transgenic rice plant OsDEL1 gene knockout transgenic rice plant del1 ABA sensitivity experiment

[0100] The del1 transgenic rice and wild type ZH11 seeds were aseptically sown in 1 / 2MS medium with ABA concentrations of 0 μM and 5 μM, respectively, and germinated at 28°C under a 15 / 24h light cycle. The phenotype was observed and photographed at 10 days of treatment, and the root length and shoot length were measured. Figure 8 and Figure 9 The results show that the del1 transgenic rice seeds have higher sensitivity to ABA during germination. It is shown that OsDEL1 may affect the drought resistance of rice through the ABA signal transduction pathway.

[0101] The above examples only describe the preferred modes of the present application, and do not limit the scope of the present application. Without departing from the design spirit of the present application, various modifications and improvements to the technical solutions of the present application made by those of ordinary skill in the art shall fall within the protection scope determined by the claims of the present application.

Claims

1. A method for improving drought tolerance in plants, characterized in that, The drought resistance of plants is improved by reducing the expression level of a drought resistance gene OsDEL1, wherein the nucleotide sequence of the drought resistance gene OsDEL1 is shown as SEQ ID NO. 1, and the plants are rice.

2. The use of the drought resistance gene OsDELl as claimed in claim 1 for increasing drought resistance in plants, characterized in that, The plants are rice.

3. Use of the drought resistance gene OsDELl as claimed in claim 1 for developing different drought resistance crop germplasm, characterized in that, The drought resistance of crops is enhanced by reducing the expression level of the drought resistance gene OsDEL1, and the crops are rice.

Images