ZmEREB18 protein related to corn plant height and heat resistance as well as related biological material and application of ZmEREB18 protein
By overexpressing the ZmEREB18 protein or its encoding gene in maize, DNA recombination technology was used to improve the heat resistance and reduce the plant height of maize, solving the problem of lodging resistance in maize under high temperature conditions and providing genetic resources and breeding foundation for excellent new maize varieties.
Patent Information
- Application Number
- CN202511539580.6
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2025-10-27
- Publication Date
- 2026-02-10
AI Technical Summary
How to adjust the root system structure of corn to improve its heat resistance and reduce plant height, thereby increasing lodging resistance and yield.
By expressing or overexpressing the ZmEREB18 protein or its encoding gene, efficient protein expression in maize can be achieved using DNA recombination technology. Combined with appropriate promoter and terminator sequences, this improves the heat resistance of maize and reduces plant height.
It significantly improves the heat resistance of maize and reduces plant height, enhances the lodging resistance of maize, and provides genetic resources and breeding foundation for excellent new maize varieties.
Smart Images

Figure FT_1 
Figure FT_2
Abstract
Description
Technical Field
[0001] This invention relates to the field of biotechnology, specifically to the ZmEREB18 protein related to maize plant height and heat resistance, and its related biomaterials and applications. Background Technology
[0002] corn( Zea mays L.) is a major food crop with a wide distribution, large planting area and high yield, playing a crucial role in ensuring food security. It is not only an important source of food for humans, but also an important raw material for livestock feed, bioenergy and industrial products. However, with global warming and frequent extreme weather events, maize production is seriously threatened. Breeding superior varieties is an effective way to resist external stress and increase yield. Plant height is a key factor restricting dense breeding. Appropriately reducing plant height can effectively reduce lodging, increase planting density and thus increase yield[1]. In 1935, the first dwarf gene in maize was discovered. Br2 It was found that its plant height was reduced by about 50%, but its stem strength was increased, indicating high yield potential and commercial value [2,3].
[0003] Therefore, identifying key genes that regulate plant height and stress resistance is crucial. This will provide genetic material for revealing the mechanism of maize plant architecture formation and provide theoretical support and genetic resources for the breeding of superior new maize varieties.
[0004] References [1]Duvick DN, Smith JSC, Cooper M. Long-term selection in acommercial hybrid maize breeding program[M] / / Plant Breeding Reviews. Oxford, UK: John Wiley&Sons, Inc., 2010: 109-151. [2] Shi Yunsu, Yu Yongtao, Song Yanchun, et al. Discovery and genetic identification of a new dwarf maize germplasm resource [J]. Journal of Plant Genetic Resources, 2008, 9(4): 521-524. [3] Research on dwarf genes and dwarf breeding in maize. Wang Tianyi, Wang Ronghuan, Wang Xiaqing, Zhang Ruyang, Xu Ruibin, Jiao Yanyan, Sun Xuan, Wang Jidong, Song Wei, Zhao Jiuran Summary of the Invention The technical problem to be solved by this invention is how to adjust the root system structure of corn and how to improve the high temperature resistance of corn.
[0005] To address the aforementioned technical problems, this invention first provides a protein, named ZmEREB18 protein, which is a protein of type A1, A2, or A3 as follows: A1. The amino acid sequence is the protein that is the amino acid sequence shown in SEQ ID No. 2 of the sequence listing; A2. A protein that has more than 80% identity with and has similar function to the protein shown in A1, obtained by substituting and / or deleting and / or adding amino acid residues of the amino acid sequence shown in SEQ ID No. 2 in the sequence listing. A3. A fusion protein obtained by attaching a protein tag to the N-terminus and / or C-terminus of A1 or A2.
[0006] In the aforementioned proteins, the protein tag refers to a polypeptide or protein fused with the target protein using in vitro DNA recombination technology for expression, detection, tracing, and / or purification of the target protein. The protein tag may be a Flag tag, His tag, MBP tag, HA tag, myc tag, GST tag, and / or SUMO tag, etc.
[0007] The above-mentioned proteins can be obtained from corn.
[0008] The proteins mentioned above can be synthesized artificially, or their encoding genes can be synthesized first and then expressed biologically.
[0009] In the above-mentioned proteins, identity refers to the identity of the amino acid sequences. The identity of amino acid sequences can be determined using homology search sites on the Internet, such as the BLAST page on the NCBI homepage. For example, in Advanced BLAST 2.1, using blastp as the program, setting the Expect value to 10, setting all filters to OFF, using BLOSUM62 as the matrix, setting the Gap existence cost, Per residue gap cost, and Lambda ratio to 11, 1, and 0.85 (default values) respectively, and performing an identity search on a pair of amino acid sequences to calculate the identity value (%), then the identity value can be obtained.
[0010] In the aforementioned proteins, the 80% or more identity can be at least 81%, 85%, 90%, 91%, 92%, 95%, 96%, 98%, 99%, or 100% identity.
[0011] Biomaterials related to the protein are also within the scope of protection of this invention.
[0012] The biomaterial related to the protein provided by this invention is any one of B1 to B5 below: B1. The nucleic acid molecule encoding the protein; B2, an expression cassette containing the nucleic acid molecule described in B1; B3, a recombinant vector containing the nucleic acid molecule described in B1, or a recombinant vector containing the expression cassette described in B2; B4. Recombinant microorganisms containing the nucleic acid molecules described in B1, or recombinant microorganisms containing the expression cassette described in B2, or recombinant microorganisms containing the recombinant vector described in B3; B5. Transgenic plant cell lines, transgenic plant tissues, or transgenic plant organs containing the nucleic acid molecules described in B1.
[0013] The nucleic acid molecule can be DNA, such as cDNA, genomic DNA, or recombinant DNA; the nucleic acid molecule can also be RNA, such as mRNA or hnRNA.
[0014] In the above-mentioned biological materials, the nucleic acid molecule described in B1) can specifically be a DNA molecule whose coding sequence is SEQ ID No. 1 in the sequence listing.
[0015] In the aforementioned biological materials, the expression cassette described in B2) refers to DNA capable of expressing ZmEREB18 in host cells, and this DNA may include not only the promoter but also... ZmEREB18 The promoter of gene transcription may also include a terminator. ZmEREB18A terminator for gene transcription. Furthermore, the expression cassette may also include an enhancer sequence. Promoters that can be used in this invention include, but are not limited to: constitutive promoters, tissue-, organ-, and development-specific promoters, and inducible promoters. Examples of promoters include, but are not limited to: constitutive promoter 35S of cauliflower mosaic virus; wound-inducible promoters from tomatoes, leucine aminopeptidase ("LAP", Chao et al. (1999) Plant Physiology 120:979-992); chemically inducible promoters from tobacco, pathogenesis-related 1 (PR1) (induced by salicylic acid and BTH (benzothiadiazole-7-thiohydroxy acid S-methyl ester)); tomato protease inhibitor II promoter (PIN2) or LAP promoter (both induced by jasmonic acid methyl ester); heat shock promoters (US Patent 5,187,267); tetracycline-inducible promoters (US Patent 5,057,422); seed-specific promoters, such as millet seed-specific promoter pF128 (CN101063139B (Chinese Patent 2007)). 10099169.7), seed storage protein-specific promoters (e.g., promoters of bean globular protein, napin, oleosin, and soybean beta conglycin (Beachy et al. (1985) EMBO J. 4:3047-3053)). They can be used alone or in combination with other plant promoters. All references cited herein are cited in full. Suitable transcription terminators include, but are not limited to: Agrobacterium carmine synthase terminator (NOS terminator), cauliflower mosaic virus CaMV35S terminator, tml terminator, pea rbcS E9 terminator, and carmine and octopine synthase terminators (see, for example: Odell et al. (I 985 Nature 313:810; Rosenberg et al. (1987) Gene, 56:125; Guerineau et al. (1991) Mol. Gen. Genet, 262:141; Proudfoot (1991) Cell, 64:671; Sanfacon et al. Genes Dev., 5:141; Mogen et al. (1990) Plant Cell, 2:1261; Munroe et al. (1990) Gene, 91:151; Ballad et al. (1989) Nucleic Acids Res. 17:7891; Joshi et al. (1987) Nucleic Acid Res., 15:9627).
[0016] Existing plant expression vectors can be used to construct structures containing the aforementioned... ZmEREB18 Recombinant expression vectors for gene expression cassettes. These plant expression vectors include binary Agrobacterium vectors and vectors suitable for plant microbombardment, such as pCAMBIA1300, pAHC25, pWMB123, pBin438, pCAMBIA1302, pCAMBIA2301, pCAMBIA1301, pBI121, pCAMBIA1391-Xa, or pCAMBIA1391-Xb (CAMBIA). The plant expression vectors may also contain the 3' untranslated region of a foreign gene, i.e., a polyadenylated signal and any other DNA fragment involved in mRNA processing or gene expression. The polyadenylated signal can guide the addition of polyadenylated acid to the 3' end of the mRNA precursor, such as Agrobacterium crown gall tumor inducing (Ti) plasmid genes (e.g., carmine synthase genes). Nose The untranslated regions transcribed at the 3' end of plant genes (such as soybean storage protein genes) have similar functions. When constructing plant expression vectors using the genes of this invention, enhancers, including translational enhancers or transcriptional enhancers, can also be used. These enhancer regions can be ATG start codons or adjacent region start codons, but they must be identical to the reading frame of the coding sequence to ensure correct translation of the entire sequence. The sources of the translation control signals and start codons are wide-ranging; they can be natural or synthetic. The translation initiation region can originate from the transcription initiation region or structural genes. To facilitate the identification and screening of transgenic plant cells or plants, the plant expression vectors used can be processed, such as by adding genes encoding enzymes or luminescent compounds that can be expressed in plants (e.g., those encoding enzymes that produce color changes). GUS Genes, luciferase genes, etc.), antibiotic marker genes (such as those conferring resistance to kanamycin and related antibiotics). nptII Genes that confer resistance to the herbicide phosphinic acid at least Genes that confer resistance to the antibiotic hygromycin hp Genes, and the genes that confer resistance to methatrexate dhfr Genes such as EPSPS genes (which confer resistance to glyphosate) or chemical reagent resistance marker genes (such as herbicide resistance genes), and mannose-6-phosphate isomerase genes that provide the ability to metabolize mannose, can be used. From a safety perspective, transgenic plants can be directly selected by stress screening without adding any selective marker genes.
[0017] In the aforementioned biological materials, the recombinant microorganisms may specifically be yeast, bacteria, algae, and fungi.
[0018] Any of the following applications of the aforementioned protein or biological material, P1-P7, also fall within the scope of protection of this invention: P1. Application in improving the heat resistance of corn; P2. Application in the preparation of products that improve the heat resistance of corn; P3. Application in reducing the height of maize plants; P4. Application in the preparation of products that reduce maize plant height; P5. Application in improving the lodging resistance of corn; P6. Application in the preparation of products that enhance the lodging resistance of corn; P7. Application in maize breeding, wherein the maize breeding is for selecting heat-resistant maize, or for selecting maize with short plant height and / or lodging resistance.
[0019] To address the aforementioned technical problems, the present invention also provides a method for cultivating heat-resistant corn.
[0020] The method for cultivating heat-resistant maize provided by the present invention includes the step of increasing the expression level of the protein or its encoding gene in the recipient maize to obtain heat-resistant maize; the heat resistance of the heat-resistant maize is higher than that of the recipient maize.
[0021] To address the aforementioned technical problems, the present invention also provides a method for cultivating dwarf, tall maize plants.
[0022] The method for cultivating dwarf-tall maize provided by the present invention includes the step of increasing the expression level of the protein or its encoding gene in the recipient maize to obtain dwarf-tall maize; wherein the plant height of the dwarf-tall maize is shorter than that of the recipient maize.
[0023] To address the aforementioned technical problems, the present invention also provides a method for cultivating lodging-resistant corn.
[0024] The method for cultivating lodging-resistant maize provided by the present invention includes the step of increasing the expression level of the protein or its encoding gene in the recipient maize to obtain lodging-resistant maize; the lodging resistance of the lodging-resistant maize is stronger than that of the recipient maize.
[0025] In the above method, increasing the expression level of the protein or its encoding gene in the recipient maize can be achieved by introducing the encoding gene of the protein into the recipient maize.
[0026] In the above method, the gene encoding the protein can be modified as follows before being introduced into the recipient plant to achieve better expression: 1) Modify the gene sequence adjacent to the initiation methionine to enable efficient translation initiation; for example, by using a sequence known to be effective in plants. 2) Linked to promoters of various plant expression to facilitate their expression in plants; the promoters may include constitutive, inducible, temporally regulated, developmentally regulated, chemically regulated, tissue-selective, and tissue-specific promoters; the selection of promoters will vary with the time and space requirements of expression, and also depends on the target species; for example, tissue or organ-specific expression promoters, depending on the stage of development of the target receptor; although it has been shown that many promoters derived from dicotyledons are functional in monocotyledons and vice versa, ideally, dicotyledonous promoters are selected for expression in dicotyledons, and monocotyledonous promoters are selected for expression in monocotyledons; 3) Linking with a suitable transcription terminator can also improve the expression efficiency of the gene of the present invention; for example, tml from CaMV, E9 from rbcS; any available terminator known to function in plants can be linked with the gene of the present invention. 4) Introduce enhancer sequences, such as intron sequences (e.g., derived from Adhl and Bronzel) and viral leader sequences (e.g., derived from TMV, MCMV, and AMV).
[0027] The gene encoding the protein can be introduced into plant cells using conventional biotechnological methods such as Ti plasmids, plant virus vectors, direct DNA transformation, microinjection, and electroporation (Weissbach, 1998, Method for Plant Molecular Biology VIII, Academy Press, New York, pp.411-463; Geiserson and Corey, 1998, Plant Molecular Biology (2nd Edition).
[0028] In the above method, the heat-resistant corn can be genetically modified corn or corn obtained through conventional breeding techniques such as hybridization.
[0029] This invention discloses a method for processing corn. ZmEREB18 Gene overexpression was performed to verify its correlation with maize plant height and heat tolerance, resulting in maize mutant materials with significantly reduced plant height and significantly improved heat tolerance. This invention provides new materials for maize variety breeding. Attached Figure Description
[0030] Figure 1 In Embodiment 1 of the present invention ZmEREB18 Relative mRNA expression levels in gene-overexpressing plants. * indicates a significant result from the analysis. P <0.05, ** indicates the significance analysis result is... P <0.01.
[0031] Figure 2 In Embodiment 1 of the present invention ZmEREB18 Phenotypic comparison of overexpression plants 1 and 2 with wild-type KN5585. Figure 2 A represents the plant height phenotype. Figure 2 B represents the phenotype after heat stress. Detailed Implementation
[0032] The present invention will now be described in further detail with reference to specific embodiments. The given embodiments are merely illustrative of the invention and not intended to limit its scope. The embodiments provided below can serve as a guide for further improvements by those skilled in the art and do not constitute a limitation on the invention in any way.
[0033] Unless otherwise specified, the experimental methods used in the following examples are conventional methods, performed according to the techniques or conditions described in the literature in this field or according to the product instructions. Unless otherwise specified, the materials and reagents used in the following examples are commercially available.
[0034] In the quantitative experiments in the following examples, three replicate experiments were set up, and the average value of the results was taken.
[0035] In the following examples, unless otherwise specified, the first position of each nucleotide sequence in the sequence listing is the 5' terminal nucleotide of the corresponding DNA, and the last position is the 3' terminal nucleotide of the corresponding DNA.
[0036] In the following embodiments, the maize inbred line KN5585 is described in the non-patent literature “Zhenju Li, Junbin Chen, Chuang Liu, Shengfeng He, Mingyu Wang, Lei Wang, Vijai Bhadauria, Shiwei Wang, Wenyu Cheng, Hui Liu, Xiaohong Yang, Mingliang Xu, You-Liang Peng, Wangsheng Zhu. Natural variations of maize ZmLecRK1 determine its interaction with ZmBAK1 and resistance patterns to multiple pathogens. Molecular Plant. Volume 17, Issue 10, 7 October 2024, Pages 1606-1623”, which is available to the public from the applicant to repeat the experiments of the present invention.
[0037] Example 1 Preliminary big data analysis revealed a gene in corn that is associated with reduced plant height and heat tolerance. ZmEREB18 Gene number is Zm00001d018081 To verify ZmEREB18 The gene function was determined, and the gene sequence was cloned. ZmEREB18 The gene is 1026 bp in length, and its nucleotide sequence is shown in SEQ ID No. 1, encoding a 341-amino acid protein, ZmEREB18. Bioinformatics analysis predicts that this gene lacks 5'UTR and 3'UTR sequences and contains no intron sequences; that is, its CDS sequence is also shown in SEQ ID No. 1. Protein ZmEREB18 is a member of the AP2 / EREBP (APETALA2 / ethylene-responsiveelement binding proteins) transcription factor family, with its amino acid sequence shown in SEQ ID No. 2, a molecular weight of 36570 Da, and contains one AP2 / ERF domain.
[0038] SEQ ID No.1 SEQ ID No.2 MAAAAIDMYKYYNTSAHQIPSSSPSDQELAKALEPFITSASSSSSSSPYHGYSSSSMSQDSYMPTPSYTSYATSPLPTPAAASSSQLPPLYSSPYAAPCMAGQMGLNQLGPAQIQQIQAQFMFQQQQQQQRGLHAAFLGPRAQPMKQSGSPSPPPPLAPAQSKLYRGVRQ RHWGKWVAEIRLPKNRTRLWLGTFDTAEDAALAYDKAAFRLRGDTARLNFPALRRGGAHLAGPLHASVDAKLTAICQSLSESKSKSGSSGDESAASPPDSPKCSASTTEGEGEEESGSAGSPPPPPPPPTLAPPVPEMAKLDFTEAPWDETEAFHLRKYPSWEIDWDSILS 1. Build ZmEREB18 overexpression strains To verify ZmEREB18 The function of genes constructs ZmEREB18 The overexpression vector, using maize inbred line KN5585 as background material, was obtained through Agrobacterium-mediated transformation. ZmEREB18 Maize overexpression plants.
[0039] The specific construction method is as follows: Cloning in maize inbred line KN5585 ZmEREB18 The gene sequence (as shown in SEQ ID No. 1) was commissioned to Weimi Biotechnology (Jiangsu) Co., Ltd. to construct a gene overexpression recombinant plasmid. , This plasmid was modified from pCAMBIA3300. ZmEREB18 The sequence was inserted into the pTraesCS-V011 vector backbone to obtain the target gene. ZmEREB18 overexpression vector pTraesCS-V011- ZmEREB18 pTraesCS-V011- ZmEREB18 The first 10,000 nucleotide sequences are shown in SEQ ID No. 3, and the nucleotide sequences from position 10,001 onwards are shown in SEQ ID No. 4, wherein the sequence from position 3116 to position 4141 of SEQ ID No. 3 is identical to the sequence of SEQ ID No. 1.
[0040] SEQ ID NO.3 SEQ ID NO.4 The successfully constructed overexpression vector pTraesCS-V011- ZmEREB18 Transfected into Agrobacterium AGL1 (documented in non-patent literature "Agrobacterium-mediated high-frequency transformation of an elite commercial maize (Zea mays L.) inbred line"), recombinant strain AGL1 / pTraesCS-V011- was obtained. ZmEREB18 Agrobacterium-mediated genetic transformation was performed using maize inbred line KN5585 as the recipient, resulting in transformed plants.
[0041] The obtained transformed plants were identified, screened, and self-pollinated for propagation. The specific method is as follows: At the small trumpet stage of the T1 generation plants, select a leaf from the upper part of the corn plant and apply glufosinate-ammonium (aqueous formulation, 200 g / L active ingredient, product of Sichuan Lier Crop Science Co., Ltd.) diluted 100 times with water to the middle of the leaf, covering an area of approximately 10 cm². 2 Five days later, observe the smeared areas. Plants with no obvious changes in leaves are considered positive, while negative plants show yellowing and withering leaves. Self-pollinate the positive plants to obtain the T2 generation. The T2 generation is then re-identified using the same method to determine the positive plants; the resulting positive lines are the... ZmEREB18 Maize overexpression lines.
[0042] 2. ZmEREB18 Gene expression in maize overexpression plants exist ZmEREB18 Leaves were sampled from T2 generation maize overexpression lines at the tasseling stage to extract total RNA. RNA was analyzed by RT-qPCR. ZmEREB18 RNA and protein expression levels were detected. RNA reverse transcription was performed using the HiScript III RTSuperMix for qPCR kit (Nanjing Novizan Biotechnology Co., Ltd., R303-01); RT-qPCR was performed using the PowerUp SYBP Green Master Mix kit (ABI, A257411) to detect target gene editing. Wild-type KN5585 was used as a control.
[0043] The primer pairs used in RT-qPCR are from ZmEREB18 -F and ZmEREB18 The primer pair for the reference gene is Zm00001d010159, consisting of Zm00001d010159-F and Zm00001d010159-R. The primer sequences are as follows: ZmEREB18-F: ACTACAATACCAGCGCACACC (identical to the sequence of SEQ ID No. 1, positions 29-49); ZmEREB18 -R: CATGGATGGAGAGGACGAGT (reverse complementary to the sequence from position 152 to position 171 of SEQ ID No. 1).
[0044] Zm00001d010159-F:GCTACGAGATGCCTGATGGTC; Zm00001d010159-R:GTGATCTCCTTGCTCATACGATCGGC.
[0045] See results Figure 1 Two of the corn ZmEREB18 Overexpression lines overexpressing 1 and overexpressing 2 ZmEREB18 Gene expression levels were significantly higher than those of wild-type (WT). ZmEREB18 Gene expression levels.
[0046] 3. ZmEREB18 Identification of plant height and heat tolerance of overexpression lines Phenotypic observation was conducted by growing overexpression 1 and overexpression 2 in a glass greenhouse in Datian, with wild-type KN5585 as a control. ZmEREB18 The plants that were positive for overexpression 1 and overexpression 2 were shorter in height. See the photos taken during the pollination period. Figure 2 A.
[0047] After the plants were photographed during the pollination period (see photo) Figure 2 A) was subjected to heat stress treatment at 42℃-50℃, and phenotypic photographs were taken after 4 hours (see A). Figure 2 (B) Compared to the plant phenotype before heat stress treatment, the overexpressing lines after heat stress treatment, compared to the wild type, showed less leaf wrinkling, more relaxed leaves, and lower water loss, indicating that overexpression... ZmEREB18 Genetically modified corn plants are more tolerant of heat stress.
[0048] The present invention has been described in detail above. For those skilled in the art, the invention can be practiced in a wide range of ways with equivalent parameters, concentrations, and conditions without departing from its spirit and scope, and without requiring unnecessary experiments. Although specific embodiments have been given, it should be understood that further modifications can be made to the invention. In summary, according to the principles of the invention, this application is intended to include any changes, uses, or improvements to the invention, including changes made using conventional techniques known in the art that depart from the scope disclosed herein. Some of the essential features can be applied within the scope of the following appended claims.
Claims
1. A protein, characterized in that: it is Proteins of type A1, A2, or A3 as follows: A1. The amino acid sequence is the protein that is the amino acid sequence shown in SEQ ID No. 2 of the sequence listing; A2. A protein that has more than 80% identity with and has similar function to the protein shown in A1, obtained by substituting and / or deleting and / or adding amino acid residues of the amino acid sequence shown in SEQ ID No. 2 in the sequence listing. A3. A fusion protein obtained by attaching a protein tag to the N-terminus and / or C-terminus of A1 or A2.
2. The protein according to claim 1, characterized in that: The protein is derived from corn.
3. A biomaterial relating to the protein of claim 1 or 2, characterized in that: It is any one of B1 to B5 below: B1. A nucleic acid molecule encoding the protein of claim 1; B2, an expression cassette containing the nucleic acid molecule described in B1; B3, a recombinant vector containing the nucleic acid molecule described in B1, or a recombinant vector containing the expression cassette described in B2; B4. Recombinant microorganisms containing the nucleic acid molecules described in B1, or recombinant microorganisms containing the expression cassette described in B2, or recombinant microorganisms containing the recombinant vector described in B3; B5. Transgenic plant cell lines, transgenic plant tissues, or transgenic plant organs containing the nucleic acid molecules described in B1.
4. The biomaterial according to claim 3, characterized in that: B1) The nucleic acid molecule is a DNA molecule whose coding sequence is SEQ ID No. 1 in the sequence listing.
5. The application of the protein according to any one of claims 1-2, characterized in that: The application is any one of P1-P7: P1. Application in improving the heat resistance of corn; P2. Application in the preparation of products that improve the heat resistance of corn; P3. Application in reducing the height of maize plants; P4. Application in the preparation of products that reduce maize plant height; P5. Application in improving the lodging resistance of corn; P6. Application in the preparation of products that enhance the lodging resistance of corn; P7. Application in maize breeding, wherein the maize breeding is for selecting heat-resistant maize, or for selecting maize with short plant height and / or lodging resistance.
6. The application of the biomaterial according to any one of claims 3-4, characterized in that: The application is any one of P1-P7: P1. Application in improving the heat resistance of corn; P2. Application in the preparation of products that improve the heat resistance of corn; P3. Application in reducing the height of maize plants; P4. Application in the preparation of products that reduce maize plant height; P5. Application in improving the lodging resistance of corn; P6. Application in the preparation of products that enhance the lodging resistance of corn; P7. Application in maize breeding, wherein the maize breeding is for selecting heat-resistant maize, or for selecting maize with short plant height and / or lodging resistance.
7. A method for cultivating heat-resistant corn, characterized in that: The method includes the step of increasing the expression level of the protein or its encoding gene as described in claim 1 or 2 in the recipient maize to obtain heat-resistant maize; the heat resistance of the heat-resistant maize is higher than that of the recipient maize.
8. A method for cultivating dwarf, tall maize, characterized in that: The method includes the step of increasing the expression level of the protein or its encoding gene as described in claim 1 or 2 in the recipient maize to obtain dwarf-tall maize; the plant height of the dwarf-tall maize is shorter than that of the recipient maize.
9. A method for cultivating lodging-resistant maize, characterized in that: The method includes the step of increasing the expression level of the protein or its encoding gene as described in claim 1 or 2 in the recipient maize to obtain lodging-resistant maize; the lodging resistance of the lodging-resistant maize is stronger than that of the recipient maize.
Citation Information
Patent Citations
Seed specificity highly effective promoter and its application
CN101063139A
Seed specific highly effective promoter and its application
CN101063139B
Recombinant DNA: transformed microorganisms, plant cells and plants: a process for introducing an inducible property in plants, and a process for producing a polypeptide or protein by means of plants or plant cells
US5057422A
Plant proteins, promoters, coding sequences and use
US5187267A
Corn dehydration responsive element (DRE)-binding protein ZmDBP2 and encoding gene thereof
CN102140134A