Anti-PR recombinant rabbit monoclonal antibody and application thereof
By developing a highly specific and sensitive anti-PR recombinant rabbit monoclonal antibody, the problem of insufficient sensitivity and specificity of existing antibodies in immunohistochemical detection has been solved, enabling accurate identification of PR protein and accurate disease diagnosis, supporting personalized treatment.
Patent Information
- Application Number
- CN202610238054.4
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- Filing Date
- 2026-02-28
- Publication Date
- 2026-03-27
- Estimated Expiration
- 2046-02-28
AI Technical Summary
Existing anti-PR antibodies lack sufficient sensitivity and specificity in immunohistochemical detection, making it difficult to accurately distinguish between PR-A and PR-B subtypes, identify low-expression samples, and reduce non-specific staining, thus affecting the accuracy of disease diagnosis and treatment decisions.
A new anti-PR recombinant rabbit monoclonal antibody was developed. It was prepared by recombinant expression in mammalian cells and using specific amino acid and nucleotide sequences to design a highly specific and sensitive antibody for immunohistochemical detection.
It achieves high specificity and high sensitivity in the identification of PR proteins, improving the reliability of disease diagnosis and the accuracy of treatment strategies, especially in distinguishing between PR-A and PR-B subtypes and identifying low-expression samples.
Smart Images

Figure CN121736110A_ABST
Abstract
Description
TECHNICAL FIELD
[0001] The present application belongs to the field of immunochemistry, and particularly relates to an anti-PR recombinant rabbit monoclonal antibody and application thereof, in particular, application in immunohistochemical detection. BACKGROUND
[0002] The PR protein, i.e., the progesterone receptor (PR), is a core transcription factor mediating the biological effects of progesterone (P4). The protein has two subtypes: the PR-A subtype has a molecular weight of about 94 kDa, and the PR-B subtype has a molecular weight of about 110 kDa. PR is a protein with dual functions: it can act as a transcription factor directly interacting with DNA in the nucleus to regulate transcription in a ligand-dependent manner, and it can also act as a non-transcription factor to regulate signaling pathways outside the nucleus. PR protein regulates the expression of downstream genes by binding to progesterone and is widely involved in physiological processes such as female reproductive system development (e.g., uterus, breast), pregnancy maintenance, and embryo implantation. PR plays a key role in mediating and regulating the functions of the ovary, uterus, and breast and reproductive activities. Studies have shown that PR dysfunction is closely related to the occurrence and development of various reproductive system diseases and hormone-dependent tumors, and particularly has key pathological significance in breast cancer and endometrial diseases. PR is an important molecular marker for disease diagnosis, classification, and treatment strategy development.
[0003] Currently, the IHC method is commonly used in clinics for in situ detection of PR protein in tissues, and the expression of PR in cells is observed under a microscope to assess whether PR is abnormally expressed. However, the anti-PR antibodies used in existing detection techniques still have obvious deficiencies in sensitivity and specificity, especially in distinguishing between PR-A and PR-B subtypes, recognizing low-expression samples, and reducing non-specific staining. This leads to subjective and poor reproducibility of IHC staining results in pathological evaluation, affecting the accuracy of disease classification and treatment decision-making based on the PR status.
[0004] Therefore, developing an anti-PR antibody with high sensitivity, strong specificity, and suitable for pathological detection scenarios such as IHC has important practical significance for accurate identification of PR protein, improving the reliability of related disease diagnosis, and promoting the development of individualized treatment strategies. SUMMARY
[0005] (1) Technical problems to be solved In view of the above-mentioned defects and disadvantages of the prior art, the present application provides an anti-PR recombinant rabbit monoclonal antibody which can be widely applied and accurately identify PR expression, and application thereof. The present application also relates to a nucleotide sequence encoding the anti-PR recombinant rabbit monoclonal antibody, a recombinant plasmid or expression vector, a preparation method and application of the anti-PR recombinant rabbit monoclonal antibody in a PR protein detection method or device.
[0006] (II) Technical solutions In order to achieve the above-mentioned purpose, the main technical solutions adopted by the present application include: In a first aspect, the present application provides an anti-PR recombinant rabbit monoclonal antibody, which comprises a heavy chain variable region and a light chain variable region, the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO: 4; and the amino acid sequence of the light chain variable region is shown in SEQ ID NO: 5.
[0007] The anti-PR recombinant rabbit monoclonal antibody (PR rabbit-derived antibody) can be used for immunohistochemical detection, and can specifically and sensitively identify and detect the expression of PR protein on tumor cells or immune cells.
[0008] The anti-PR monoclonal antibody is obtained by recombinant expression of mammalian cells. Specifically, the anti-PR recombinant rabbit monoclonal antibody provided by the present application is obtained by rabbit hybridoma fusion screening and eukaryotic expression of 293 cells. In the preparation of the anti-PR monoclonal antibody, the antigen for immunizing rabbits (New Zealand white rabbits) is a synthetic polypeptide, and the amino acid sequence of the synthetic polypeptide is shown in SEQ ID NO: 1, which is obtained by artificial chemical synthesis. After immunizing the rabbits, the positive hybridoma cell line which can efficiently secrete the monoclonal antibody is obtained by cell fusion and clone screening, and the nucleotide sequence encoding the heavy chain amino acid sequence and the light chain amino acid sequence of the antibody is obtained by using molecular cloning technology. The nucleotide sequence is constructed on a eukaryotic expression vector, and is transfected into 293 cell lines by transfection reagent. The cell supernatant is collected, and the cell supernatant is purified by protein A column affinity chromatography to obtain the rabbit monoclonal antibody. Immunohistochemical detection shows that the antibody can specifically recognize PR protein.
[0009] The anti-PR monoclonal antibody can recognize recombinant PR antigen protein and PR molecules on tumor cells and immune cells; and the anti-PR monoclonal antibody can also be applied in immunohistochemical pathological diagnostic agents.
[0010] In a second aspect, the present application provides a coding gene for encoding the above-mentioned anti-PR recombinant rabbit monoclonal antibody.
[0011] Preferably, the coding gene comprises a DNA sequence as shown in SEQ ID NO: 2 or a sequence complementary thereto for encoding the heavy chain variable region of the anti-PR recombinant rabbit monoclonal antibody, and a DNA sequence as shown in SEQ ID NO: 3 or a sequence complementary thereto for encoding the light chain variable region of the anti-PR recombinant rabbit monoclonal antibody.
[0012] In a third aspect, the present application provides a nucleic acid molecule comprising a coding gene for encoding the anti-PR recombinant rabbit monoclonal antibody.
[0013] In a fourth aspect, the present application provides an expression vector or recombinant plasmid comprising the nucleic acid molecule described above.
[0014] In a fifth aspect, the present application provides a host cell transformed or transfected with the expression vector or recombinant plasmid described above.
[0015] In a sixth aspect, the present application provides a method for preparing the anti-PR recombinant rabbit monoclonal antibody, which comprises transforming or transfecting the host cell with the expression vector or recombinant plasmid described above, culturing the transformed or transfected cell, collecting the supernatant of the cell and purifying to obtain the anti-PR recombinant rabbit monoclonal antibody.
[0016] In a seventh aspect, the anti-PR recombinant rabbit monoclonal antibody, the coding gene, the nucleic acid molecule, the expression vector or the recombinant plasmid are used for preparing a PR protein molecule detection device. The detection device includes but is not limited to a kit, an antibody chip and the like.
[0017] In an eighth aspect, the present application further provides a PR detection kit comprising the anti-PR recombinant rabbit monoclonal antibody and an immunohistochemical detection reagent described above.
[0018] Preferably, the PR detection kit comprises the anti-PR recombinant rabbit monoclonal antibody, a horseradish peroxidase-labeled secondary antibody, an ethylenediaminetetraacetic acid repair solution, a hydrogen peroxidase blocking solution, a 3,3'-diaminobenzidine concentrate solution, a 3,3'-diaminobenzidine buffer solution, hematoxylin and a bluing solution.
[0019] In the immunohistochemical detection, the detection steps include dewaxing, antigen repair, endogenous peroxidase inactivation, blocking, primary antibody incubation, secondary antibody incubation, 3,3'-diaminobenzidine (DAB) color development, counterstaining, dehydration, mounting and microscopic examination.
[0020] (Three) beneficial effects The recombinant rabbit monoclonal antibody against PR provided by this invention exhibits high specificity and sensitivity in binding to PR protein molecules. It can specifically recognize and detect PR protein expression on cells, showing high positive expression when detecting PR protein. Immunohistochemical assays in various tissues have revealed that this antibody can be applied to immunohistochemistry (IHC), indirect enzyme-linked immunosorbent assay (ELISA), Western blotting, antibody chip preparation, flow cytometry, and other detection and screening methods, facilitating accurate assessment and detection results. The PR recombinant rabbit monoclonal antibody of the 278G8D6 clone of this invention, due to its high specificity and strong positive signal, is easier to score in IHC staining, making it more accurate for detecting and differentiating cancers. Attached Figure Description
[0021] Figure 1 These are immunohistochemical staining results of the 278G8D6 anti-PR monoclonal antibody prepared in this invention and a commercially available antibody in ovarian cancer, breast cancer, and uterine tissues. The concentration of the 278G8D6 anti-PR monoclonal antibody used was 1 μg / mL. Image a shows the immunohistochemical staining results of the 278G8D6 clone PR antibody in ovarian cancer; image b shows the immunohistochemical staining results of the commercially available antibody in ovarian cancer (images a and b are at the same magnification); image c shows the immunohistochemical staining results of the 278G8D6 clone PR antibody in breast cancer; image d shows the immunohistochemical staining results of the commercially available antibody in breast cancer (images c and d are at the same magnification); image e shows the immunohistochemical staining results of the 278G8D6 clone PR antibody in uterine tissue; image f shows the immunohistochemical staining results of the commercially available antibody in uterine tissue (images e and f are at the same magnification). Figure 2 This is a statistical graph showing the titer of the 278G8D6 anti-PR monoclonal antibody of the present invention and commercially available antibodies at eight different concentration gradients. Figure 3 The Western blotting results of the 278G8D6 anti-PR monoclonal antibody of this invention as a primary antibody were used to verify its ability to recognize the PR protein. Detailed Implementation
[0022] To further illustrate the technical means and effects of this invention, the following description, in conjunction with embodiments and accompanying drawings, provides a further explanation of the invention. It is understood that the specific embodiments described herein are merely illustrative of the invention and not intended to limit it.
[0023] Where specific techniques or conditions are not specified in the examples, they shall be performed in accordance with the techniques or conditions described in the literature in this field, or in accordance with the product instructions. Reagents or instruments whose manufacturers are not specified are all conventional products that can be purchased through legitimate channels. Human tissue samples are formalin-fixed and paraffin-embedded human tissue samples, all of which have been pathologically verified, and informed consent has been obtained from the patients.
[0024] Example 1 This embodiment describes the preparation and screening of anti-PR recombinant rabbit monoclonal antibodies, including the following steps: (1) Antigen preparation The specific sequence of the PR antigen is shown in SEQ ID NO:1 below.
[0025] SEQ ID NO: 1 is: DLILNEQRMKESSFYS.
[0026] The aforementioned polypeptide sequence was selected based on the analysis of the PR molecule sequence, considering its structure, antigenicity, hydrophilicity / hydrophobicity of constituent amino acids, and secondary structure. The polypeptide with the sequence shown in SEQ ID NO:1 was artificially synthesized and used as an antigen for immunizing rabbits. During immunization, the polypeptide with the sequence shown in SEQ ID NO:1 was conjugated with hemocyanin (KLH) and used as the PR antigen to immunize rabbits.
[0027] (2) Immunity The PR antigen obtained in step (1) was mixed with complete Freund's adjuvant (volume ratio 1:1) and emulsified. Multiple New Zealand white rabbits were immunized by subcutaneous injection. Two weeks later, the PR antigen containing the above sequence (the polypeptide shown in SEQ ID NO:1) was emulsified with incomplete Freund's adjuvant (volume ratio 1:1) for a second and third immunization. After the three immunizations, blood was collected and serum titers were determined by serial dilution using ELISA. The rabbit with the highest antibody titer against the SEQ ID NO:1 antigen was selected for the next step of cell fusion.
[0028] (3) Cell fusion Prepare mouse-derived sp2 / 0 myeloma cells in advance, ensuring they are in the logarithmic growth phase at the time of fusion. Immunized rabbit spleens were used to prepare a single-cell suspension of lymphocytes. The rabbit spleen lymphocytes were mixed with the myeloma cells, and 50% PEG1500 was added. IMDM medium was added, and after centrifugation and discarding the supernatant, the cells were gently resuspended and mixed in HAT medium. The volume was adjusted to 800 mL, and the mixture was aliquoted into 96-well plates and incubated at 37°C with 5% CO2. The fused cell status in the 96-well plates was observed 6-9 days after fusion. The medium was changed with HT, and the plates were continued to be incubated at 37°C with 5% CO2.
[0029] (4) Screening and cloning Seven to ten days after fusion, clonal cells were screened using an ELISA test with the PR antigen (SEQ ID NO:1). The corresponding cell line numbers were labeled, and the cells in the positive wells were subjected to limiting dilution until the entire 96-well plate showed a positive result for the ELISA test. Stable monoclonal lines with high positive values were selected to obtain hybridoma cell lines secreting specific monoclonal antibodies, recorded as 278G8D6.
[0030] (5) Perform antibody sequencing on the selected hybridoma cell lines. Total RNA was isolated from 278G8D6 hybridoma cells according to the TriZol RNA extraction reagent instructions. Following the instructions of the TIANScript first-strand cDNA synthesis kit, the total RNA was reverse transcribed into cDNA. The nucleotide sequences of the antibody heavy chain variable region and antibody light chain variable region were amplified using specific primers. The primers for the heavy chain variable region were: VH-F AGACTGGGCTGCGCTGGCTTC (SEQ ID NO:6), VH-R GTGAGGGTGCCCGAG (SEQ ID NO:7); and VK-F ATGGACAYGAGGGCCCCCACTC (SEQ ID NO:8), VK-R GGTGGGAAGATGAGGACAGTAGG (SEQ ID NO:9). The nucleotide sequences of the antibody heavy chain variable region and antibody light chain variable region were then cloned into eukaryotic expression vectors (InvivoGen, pfuse-rchg, pfuse2-rclk1) for cell transfection.
[0031] (6) Cell transfection and screening Prepare 293 cells for transfection in advance. After centrifugation and replacement with fresh culture medium, transfer the cells into 24-well plates at a density of 1.5 ml per well (3 × 10⁻⁶ cells / well). 6 per ml.
[0032] The eukaryotic expression vector was mixed with polyethyleneimine (PEI) at a mass ratio of 1:6 and added to the prepared 293 cells. The cells were then cultured in a shaker at 37°C and 5% CO2. After 3-5 days of culture, the transfected cell supernatant was subjected to ELISA to screen for positive wells against the corresponding antigen. The cell supernatant from the positive wells was then subjected to immunohistochemical detection. A positive immunohistochemical test confirmed the correct antibody sequence.
[0033] (7) Preparation and purification of monoclonal antibodies on cells The confirmed positive expression vector was used to transfect a large number of cells. After culturing for 3-5 days, the cell suspension was collected, centrifuged, and the supernatant was purified using affinity chromatography with protein A to obtain antibodies with a purity >95%. The purified monoclonal antibody concentration was determined, aliquoted, and stored at 4-8°C.
[0034] Finally, the heavy chain variable region nucleotide sequence of the 278G8D6 anti-PR recombinant rabbit monoclonal antibody is shown in SEQ ID No. 2, and the light chain variable region nucleotide sequence of the anti-PR recombinant rabbit monoclonal antibody is shown in SEQ ID NO: 3.
[0035] The specific sequences of SEQ ID NO:2 and SEQ ID NO:3 are as follows: The sequence of SEQ ID NO:2 is: cagtcgctggaggagtccgggggtcgcctggtcacgcctgggacacccctgacactcacctgcacagcctctggattctccctcagtagctactacatgagctgggtccgccaggctccaggggaggggctggaatggatcggaaccattagtgatggtgggcgc acatggtacgcgagctgggcgaaaggccgattcaccatctccgaaacctcgaccacggtggatctgaaaatgtccagtctgacaaccgaggacacggccacctatttctgtgtcagaagtgaaggttcattgtggggccaaggcaccctggtcaccgtctcctca.
[0036] The sequence of SEQ ID NO:3 is: gatgttgtgatgacccagactccagcctccgtggaggcagctgtgggaggcacagtcaccatcaagtgccaggccagtcagagcattagcagttggttatcctggtatcagcagaaaccagggcagcctcccaagctcctgatctatagggcatccactctggaatct ggggtcccatcgcggttcaaaggcagtggatctgggacagagttcactctcaccatcagcgacctggagtgtgccgatgctgccacttactactgtcaatgcacttatggtagtagtagtagtagtaatggtggagttttcggcggagggaccgaggtggtggtcaaa.
[0037] The obtained base sequence was translated into an amino acid sequence and analyzed. The amino acid sequence of the heavy chain variable region of the 278G8D6 anti-PR recombinant rabbit monoclonal antibody was shown in SEQ ID NO:4, and the amino acid sequence of the light chain variable region of the anti-PR recombinant rabbit monoclonal antibody was shown in SEQ ID NO:5.
[0038] The specific sequences of SEQ ID NO:4 and SEQ ID NO:5 are as follows: The sequence of SEQ ID NO:4 is: QSLEESGGRLVTPGTPLTLTCTASGFSLSSYYMSWVRQAPGEGLEWIGTISDGGRTWYASWAKGRFTISETSTTVDLKMSSLTTEDTATYFCVRSEGSLWGQGTLVTVSS.
[0039] The sequence of SEQ ID NO:5 is: DVVMTQTPASVEAAVGGTVTIKCQASQSISSWLSWYQQKPGQPPKLLIYRASTLESGVPSRFKGSGSGTEFTLTISDLECADAATYYCQCTYGSSSSSNGGVFGGGTEVVVK.
[0040] Example 2 This example demonstrates immunohistochemical detection using anti-PR recombinant rabbit monoclonal antibody as the primary antibody, and the method is as follows: (1) Sample preparation: The ovarian cancer, breast and uterine tissue sections fixed in formalin and embedded in paraffin were baked in a constant temperature oven at 60℃ for 1-2 hours and stored for later use; (2) Dewaxing of sections: Paraffin sections are first placed in fresh xylene for dewaxing, soaked twice, 10 minutes each time; (3) Hydration of sections: The sections were hydrated by soaking in anhydrous ethanol, anhydrous ethanol, 95% ethanol, 85% ethanol and 70% ethanol for 5 minutes in sequence, and then rinsed twice with purified water for 3 minutes each time. (4) Antigen retrieval: It is recommended to use the high temperature heat retrieval method for 3 minutes (if using an automatic retrieval instrument, you can set it to 98℃ for 20 minutes). After the slides have cooled to room temperature, circle the tissue to be tested with an immunohistochemical pen and rinse twice with purified water for 3 minutes each time. (5) Inactivation of endogenous peroxidase: Add an appropriate amount of endogenous peroxidase blocking agent to completely cover the tissue, incubate at room temperature for 10 min, rinse twice with purified water for 3 min each time, and rinse once with phosphate buffer (PBST); (6) Primary antibody incubation: Add 100 μL of 1 μg / mL 278G8D6 anti-PR recombinant rabbit monoclonal antibody to completely cover the tissue, incubate in a 37℃ incubator for 1 h, and wash with PBST 3 times for 5 min each time; (7) Secondary antibody incubation: Perform secondary antibody incubation according to the instructions of the DAB staining solution kit of the secondary antibody staining system used. After incubation, rinse the slides with PBST 3 times for 5 minutes each time, and rinse with purified water once. (8) DAB staining: Prepare DAB staining solution according to the instructions of the DAB staining solution kit. Drop an appropriate amount of the prepared DAB staining solution to completely cover the tissue. Stop staining when the color does not deepen. Rinse 3 times with purified water. (9) Hematoxylin counterstaining: Counterstain the sections according to the operating steps and suggestions in the instructions of the hematoxylin manufacturer, and rinse with PBST or tap water to return to blue; (10) Dehydration and clearing: Soak in 70%, 85%, 95%, 100%, and 100% graded alcohols sequentially for 3 minutes each time; clear with xylene twice for 5 minutes each time; (11) Mounting: Mount the sample with neutral resin.
[0041] The PR antibody prepared in this application and a commercially available PR antibody were used to perform the above-mentioned immunohistochemical detection in human ovarian cancer, breast, and uterine tissues, respectively. The results are shown in the figure. Figure 1 .
[0042] Depend on Figure 1The results showed that PR protein exhibited specific nuclear staining in human ovarian cancer, breast, and uterine tissues. Furthermore, the PR recombinant rabbit monoclonal antibody of the 278G8D6 clone showed better staining results and a deeper staining color than commercially available PR antibodies. This indicates that the PR recombinant rabbit monoclonal antibody of the 278G8D6 clone of this invention, due to its high specificity and strong positive signal, is easier to evaluate and has higher identification accuracy in IHC staining, making it more accurate for detecting and differentiating cancers.
[0043] Example 3 This example describes the determination of the affinity of the 278G8D6 anti-PR recombinant rabbit monoclonal antibody. The determination method is as follows: (1) Remove the labeled PR peptide (SEQ ID NO:1) from 4℃ and allow it to return to room temperature. Dilute to a concentration of 1 μg / ml and add 100 μL / well to a 96-well microplate and incubate overnight at 4℃. Then block with 2% bovine serum albumin (BSA) overnight at 4℃. (2) The PR recombinant rabbit monoclonal antibody of clone 278G8D6 was diluted to an initial concentration of 0.5 μg / mL, and then serially diluted 2-fold, with a total of 8 concentration gradients for comparison; (3) Add the diluted anti-PR recombinant rabbit monoclonal antibody at 100 μL / well to a 96-well microplate containing peptides, cover with a sealing film, and incubate at 37°C for 1 h to allow the reaction to reach equilibrium. (4) After the reaction is complete, remove the microplate, discard the liquid, rinse with purified water 5 times, and pat dry. (5) Dilute horseradish peroxidase (HRP) labeled goat anti-rabbit IgG according to the instructions for use of the secondary antibody, add 100 μL / well to the microplate, and incubate at 37°C for 1 h to allow the reaction to reach equilibrium. (6) After the reaction is complete, remove the microplate, discard the liquid, rinse with purified water 5 times, and pat dry. (7) Add 3,3',5,5'-tetramethylbenzidine (TMB) colorimetric solution at 100 μL / well and react at room temperature for 6 minutes; (8) After the reaction is complete, add 2M H2SO4 at a rate of 50μL / well to stop the color development; (9) Read the OD value at 450 nm on the microplate reader, organize the data, and analyze the results as follows: Figure 2 As shown.
[0044] Figure 2 The results showed that, in eight concentration gradient experiments, the anti-PR recombinant rabbit monoclonal antibody of the 278G8D6 clone of the present invention had a strong affinity and high sensitivity for PR protein molecules, and could still achieve a high OD value under low antibody concentration conditions, which can save experimental and detection costs.
[0045] Example 4 This example is an immunoblotting (Western blotting) test using anti-PR recombinant rabbit monoclonal antibody 278G8D6 as the primary antibody. The method is as follows: (1) Select a polyvinylidene fluoride (PVDF) membrane of T47D cell lysate for activation. Activate it with methanol for 1 min, wash the membrane twice with pure water and then wash it three times with TBST. Blocking: Place the membrane in a blocking solution prepared with 5% bovine serum albumin (BSA) and mix it at room temperature for 2 h. The TBST is a commonly used washing buffer suitable for experiments such as immunoblotting. It contains three basic components: Tris buffer, salt (usually sodium chloride), and the surfactant Tween-20.
[0046] (2) Primary antibody incubation: Dilute the 278G8D6 antibody to a concentration of 0.5 μg / mL, place the blocked membrane into the corresponding diluted antibody, and incubate it with mixing at 4 °C overnight. (3) Take out the membrane and wash it three times in TBST solution (2 × 5 min + 1 × 10 min). (4) Secondary antibody incubation: Dilute HRP-anti-rabbit IgG with FG solution at a ratio of 1:5000, mix well and add it to the membrane strip, and incubate it with mixing at room temperature for 1 h. (5) Take out the membrane strip and wash it four times in TBST solution (3 × 5 min + 1 × 8 min). (6) Substrate: Mix equal amounts of luminol / enhancer solution diluted 5-fold with pure water and hydrogen peroxide solution in the same container, add the membrane strip, and incubate for 2 min. (7) Exposure: Place the X-ray film in the cassette and expose the X-ray film for different periods according to the fluorescence intensity. Then operate in the order of developing for 1 min, washing, fixing for 1 min, and finally washing and drying. The results are as Figure 3 shown.
[0047] The PR protein has two subtypes, PR-A and PR-B, and their theoretical molecular weights are around 94 kDa and 110 kDa. Figure 3 T47D in it represents the lysate of human breast ductal carcinoma cells. Figure 3 As can be seen from the results, there are PR positive bands in the T47D lysate. That is, in the lane, the anti-PR recombinant rabbit monoclonal antibody 278G8D6 can specifically recognize the PR protein in T47D cells, indicating that the PR recombinant rabbit monoclonal antibody cloned by 278G8D6 of the present invention can highly specifically recognize the PR protein.
[0048] Finally, it should be noted that the above embodiments are only used to illustrate the technical solutions of the present invention, and not to limit them; although the present invention has been described in detail with reference to the foregoing embodiments, those skilled in the art should understand that modifications can still be made to the technical solutions described in the foregoing embodiments, or equivalent substitutions can be made to some or all of the technical features; and these modifications or substitutions do not cause the essence of the corresponding technical solutions to deviate from the scope of the technical solutions of the embodiments of the present invention.
Claims
1. A recombinant rabbit monoclonal antibody against PR, characterized in that, It includes a heavy chain variable region and a light chain variable region, wherein the amino acid sequence of the heavy chain variable region is shown in SEQ ID NO:4; and the amino acid sequence of the light chain variable region is shown in SEQ ID NO:
5.
2. A gene encoding a gene, characterized in that, Used to encode the anti-PR recombinant rabbit monoclonal antibody of claim 1.
3. The encoding gene according to claim 2, characterized in that, It includes: DNA sequences as shown in SEQ ID NO:2 are used to encode the heavy chain variable region of the anti-PR recombinant rabbit monoclonal antibody, and DNA sequences as shown in SEQ ID NO:3 are used to encode the light chain variable region of the anti-PR recombinant rabbit monoclonal antibody.
4. A nucleic acid molecule, characterized in that, It contains the coding gene as described in claim 2 or 3.
5. An expression vector or recombinant plasmid, characterized in that, It contains the nucleic acid molecule as described in claim 4.
6. Transform or transfect the host cell of the expression vector or recombinant plasmid as described in claim 5.
7. A method for preparing an anti-PR recombinant rabbit monoclonal antibody, characterized in that, The expression vector or recombinant plasmid described in claim 5 is used to transform or transfect the host cell described in claim 6. The transformed or transfected cells are cultured, and the cell supernatant is collected and purified to obtain the anti-PR recombinant rabbit monoclonal antibody.
8. The application of the anti-PR recombinant rabbit monoclonal antibody of claim 1, the encoding gene of claim 2 or 3, the nucleic acid molecule of claim 4, the expression vector or recombinant plasmid of claim 5, and the host cell of claim 6 in the preparation of a PR detection device.
9. A PR detection kit, characterized in that, It includes the anti-PR recombinant rabbit monoclonal antibody and immunohistochemical detection reagent as described in claim 1.
10. The PR detection kit according to claim 9, characterized in that, It includes: The anti-PR recombinant rabbit monoclonal antibody, horseradish peroxidase-labeled secondary antibody, EDTA retrieval solution, catalase blocking solution, 3,3'-diaminophenylhydrazine concentrate, 3,3'-diaminophenylhydrazine buffer, hematoxylin and blueing solution as described in claim 1.
Citation Information
Patent Citations
Anti-PR protein monoclonal antibody hybridomas cell, anti- PR monoclonal antibody generated by same and application
CN105238763A
Anti-PR protein monoclonal antibody as well as preparation method and application thereof
CN113583132A
Monoclonal antibody for detecting progestational hormone receptor as well as preparation method and application of monoclonal antibody
CN114874327A
Rabbit monoclonal antibody aiming at human progestational hormone receptor and application thereof
CN117603357A
Cited By
Anti-ER recombinant rabbit monoclonal antibody and application thereof
CN121991230A