Compositions and methods to increase the systemic bioavailability of a polypeptide therapeutic agent undergoing oral administration

EP4642440A1Pending Publication Date: 2025-11-05ALGIFARMA IPR AS
View PDF 0 Cites 0 Cited by

Patent Information

Application Number
EP2023837388
Authority / Receiving Office
EP · EP
Patent Type
Applications
Current Assignee / Owner
Priority Date
2023-03-23
Filing Date
2023-12-29
Publication Date
2025-11-05

AI Technical Summary

Technical Problem

Polypeptide therapeutics administered orally face low bioavailability due to degradation in the harsh gastric environment, limiting their effectiveness and requiring inconvenient parenteral administration.

Method used

The use of alginate oligomers with an average molecular weight of less than 15,000 Daltons, combined with therapeutic polypeptides during oral, orogastric, or intragastric administration, enhances absorption from the stomach without additional protection, increasing systemic bioavailability.

Benefits of technology

This approach allows for higher and more rapid therapeutic levels in the systemic circulation, reducing the required dose and side effects, improving patient convenience and manufacturing efficiency.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure IMGF000047_0001
    Figure IMGF000047_0001
  • Figure IMGF000065_0001
    Figure IMGF000065_0001
  • Figure IMGF000066_0001
    Figure IMGF000066_0001
Patent Text Reader

Abstract

The present invention provides method for increasing the systemic bioavailability of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment. Such methods allow for systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, a polypeptide therapeutic agent via oral, orogastric, nasogastric, or intragastric administration routes. Further provided are compositions for use in such methods comprising alginate oligomers, polypeptide therapeutic agents, and optionally gastrointestinal permeation enhancers.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] Compositions and methods to increase the systemic bioavailability of a polypeptide therapeutic agent undergoing oral administration

[0002] The present invention relates to novel and improved compositions and methods for enhancing the absorption of therapeutic polypeptides from the stomach. This in turn enhances the systemic bioavailability of therapeutic polypeptides administered by routes which require transit of the stomach, e.g. administration by oral, orogastric, nasogastric, and intragastric routes. More specifically, the invention relates to the use of alginate oligomers together with therapeutic polypeptides to enhance their absorption from the stomach. The invention has particular utility in the context of the oral administration of therapeutic polypeptides which are typically administered by injection because of low oral bioavailability. By enhancing the systemic bioavailability of therapeutic polypeptides undergoing oral administration the effectiveness of therapeutic interventions may be enhanced, making viable treatments which are more convenient and comfortable than parenteral approaches.

[0003] The efficacy of polypeptide therapeutics is often limited by their ability to reach their targets. The mucosal surfaces of the lower gastrointestinal tract are attractive target sites for drug delivery due to their vascularity and large surface area. However, the main route to reaching those surfaces involves transit of the stomach, and polypeptide therapeutics are especially susceptible to the harsh chemical and enzymatic conditions of the gastric milieu. The very low pH and high concentrations of pepsin protease cause significant degradation of polypeptides transiting the stomach. Moreover, the entire gastrointestinal tract (mouth, pharynx, oesophagus, stomach, small intestine, large intestine, and anus) are lined with a mucus layer which serves as a physical barrier between the epithelial cell layer and the Gl tract lumen. To enter the systemic circulation therapeutic polypeptides need to cross the charged and complex polymeric “mesh” of components that make up that mucus layer. The thickness of the mucus barrier is not uniform and varies but is about 1 mm in the stomach and 100-150 pm in the colon and rectal region.

[0004] As such, therapeutic polypeptides have conventionally been administered by injection, in particular intravenous or subcutaneous injection, to maximise systemic bioavailability. Administration by injection is however uncomfortable and inconvenient and so, for polypeptide therapeutics which require regular administration to maintain therapeutically effective levels systemically, long term patient adherence to treatment plans becomes a significant challenge. The production and administration costs for injectable medicaments are often greater than for oral medicaments, at least in part due to the need for sterility and hardware, and the need for a medically trained professional to administer the drug. The solid waste associated with injectable drugs also poses a biohazard and environmental burden. It would therefore be more ideal if there was the option for therapeutic polypeptides to be orally administered to patients.

[0005] Alginates are naturally occurring polysaccharides that have been found to have a number of uses, both clinical (e.g. in wound dressings, as excipients in drug formulations, and in anti-heartburn preparations) and non-clinical (e.g. in food preparation). They are linear polymers of (1-4) linked p-D-mannuronic acid (M) and / or its C-5 epimer a-L-guluronic acid (G). The primary structure of alginates can vary greatly. The M and G residues can be organised as homopolymeric blocks of contiguous M or G residues, as blocks of alternating M and G residues and single M or G residues can be found interspacing these block structures. An alginate molecule can comprise some or all of these structures and such structures might not be uniformly distributed throughout the polymer. In the extreme, there exists a homopolymer of guluronic acid (polyguluronate) or a homopolymer of mannuronic acid (polymannuronate).

[0006] Alginates have been isolated from marine brown algae (e.g. certain species of Durvillea, Lessonia and Laminaria) and bacteria such as Pseudomonas aeruginosa and Azotobacter vinelandii. Other pseudomonads (e.g. Pseudomonas fluorescens, Pseudomonas putida, and Pseudomonas mendocina) retain the genetic capacity to produce alginates and may be induced to do so even though in the wild they do not produce detectable levels of alginate.

[0007] Alginate is synthesised as polymannuronate and G residues are formed by the action of epimerases (specifically C-5 epimerases) on the M residues in the polymer. In the case of alginates extracted from algae, the G residues are predominantly organised as G blocks because the enzymes involved in alginate biosynthesis in algae preferentially introduce the G neighbouring another G, thus converting stretches of M residues into G-blocks. Alginates are typically isolated from natural sources as large high molecular weight polymers (e.g. an average molecular weight in the range 300,000 to 500,000 Daltons). It is known, however, that such large alginate polymers may be degraded, or broken down, e.g. by chemical or enzymatic hydrolysis to produce alginate structures of lower molecular weight. Alginates that are used industrially typically have an average molecular weight in the range of 100,000 to 300,000 Daltons (such alginates are still considered to be large polymers) although alginates of an average molecular weight of approximately 35,000 Daltons have been used as excipients in pharmaceuticals.

[0008] Alginate oligomers have been recognised as having the ability to alter the physical properties of isolated sputum (from patients with cystic fibrosis and normal controls), and mucus samples from the lung and the gastrointestinal tract (Pritchard et al. Mucin structural interactions with an alginate oligomer mucolytic in cystic fibrosis sputum. Vibrational Spectroscopy 2019; 102932; Ermund A, et al. OligoG CF-5 / 20 normalizes cystic fibrosis mucus by chelating calcium. Clin Exp Pharmacol Physiol. 2017 44, 639- 647; Vitko M, et al. A novel guluronate oligomer improves intestinal transit and survival in cystic fibrosis mice. J Cyst Fibros. 2016 Nov 15(6):745-751 ; Pritchard MF, et al. A New Class of Safe Oligosaccharide Polymer Therapy To Modify the Mucus Barrier of Chronic Respiratory Disease. Mol Pharm. 2016 Mar 7; 13(3): 863-72.; Nordgard CT, et al. Alterations in mucus barrier function and matrix structure induced by guluronate oligomers. Biomacromolecules. 2014 Jun 9;15(6):2294-300; Sletmoen M., et al. Oligoguluronate induced competitive displacement of mucin-alginate interactions: relevance for mucolytic function. Soft Matter, 2012, 8, 8413; Nordgard CT, Draget KI. Oligosaccharides as modulators of rheology in complex mucus systems.

[0009] Biomacromolecules. 2011 Aug 8;12(8):3084-90).

[0010] This has led to previous proposals to exploit such properties to enhance drug delivery across mucosal surfaces, including macromolecular drugs (W02007 / 039754, W02008 / 125828). In the context of mucosal surfaces which are accessible without the need to have the alginate oligomer and the drug exposed to the conditions of the stomach, e.g. exposed mucus membranes, the respiratory tract, the genitourinary tracts, the colon, rectum, anus, mouth, pharynx, or oesophagus, there is no particular obstacle to put such proposals into effect. However, in the context of the administration of drugs, and polypeptide therapeutics in particular, by routes which require transit of the stomach, e.g. administration by oral, orogastric, nasogastric, and intragastric routes, it has to date been assumed that to enhance the uptake of those therapeutic polypeptides with alginate oligomers, it is essential to protect both the polypeptide and the alginate oligomer from the harsh environment of the gastric milieu (e.g. by providing these elements with an enteric coating) thereby allowing passage through the stomach and delivery to the intestines where enhanced uptake can take place (W02010 / 109180).

[0011] The prevailing logic is that alginate oligomers are able to enhance delivery of polypeptides across mucus barrier on account of (i) their electrostatic interactions with mucin glycan moieties and the peptide backbone of mucin polymers, and (ii) cation chelation. The resulting effects lead to an increase in mucus pore size, reduced viscosity and lower ability to hinder passage of polypeptides. These properties are presumed to be dependent on alginate oligomers being functionally and structurally intact and not precipitating or gelling. Alginates will precipitate if the pH is below its pKa(3.6-3.8). Human gastric pH is 1.5-3.5 and so it was assumed that alginate oligomers would precipitate in the gastric milieu and therefore result in loss of mucus altering functions: Indeed, high molecular weight alginates readily “precipitate” forming a hydrogel barrier in the stomach, which is employed in the treatment of GERD, wherein the alginates form a physical barrier to prevent acid reflux.

[0012] From the perspective of the polypeptide therapeutic, as mentioned already, the very low pH and high concentrations of proteases such as pepsin in the stomach cause significant degradation and / or denaturation which results in loss of function and attrition of the administered dose.

[0013] It has now been surprisingly found that alginates with an average molecular weight of less than 15,000 Daltons, e.g. of 2-100 monomer residues, referred to herein as alginate oligomers, may be used together with (or in combination or conjunction with) therapeutic polypeptides during their administration by routes which require transit of the stomach, e.g. administration by oral, orogastric, nasogastric, and intragastric routes, without additional forms of substantive protection from the gastric environment, to enhance the uptake of those therapeutic polypeptides from the stomach. This is turn may increase the systemic bioavailability of the polypeptide, e.g. to such an extent that therapeutically effective levels can be reached in the systemic circulation, and / or such levels may be reached more rapidly and / or maximum circulating levels may be increased. In certain embodiments this might allow less of the polypeptide therapeutic to be administered in order to achieve the requisite therapeutic efficacy, and so in turn side effects could be minimised and patient convenience and adherence can be increased. The need to administer less polypeptide and potentially less associated ingredients in the dosage form being used further leads to manufacturing efficiencies and cost reductions.

[0014] It has further been found that use of an gastrointestinal permeation enhancer (more specifically a gastrointestinal epithelial barrier permeation enhancer) together with the alginate oligomer and the therapeutic peptide during their administration by routes which require transit of the stomach, e.g. administration by oral, orogastric, nasogastric, and intragastric routes, without additional forms of substantive protection from the gastric environment, still further enhances the uptake of those therapeutic polypeptides from the stomach. This is turn may enhance the systemic bioavailability of the polypeptide, e.g. to such an extent that therapeutically effective levels can be reached in the systemic circulation, and / or such levels may be reached more rapidly and / or maximum circulating levels may be increased. In certain embodiments this might allow less of the polypeptide therapeutic to be administered in order to achieve the requisite therapeutic efficacy, and so in turn side effects could be minimised and patient convenience and adherence can be increased. The need to administer less polypeptide and potentially less associated ingredients in the dosage form being used further leads to manufacturing efficiencies and cost reductions.

[0015] Thus, the invention provides a method for increasing the systemic bioavailability of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0016] The invention further provides an alginate oligomer for use in a method for increasing the systemic bioavailability of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0017] Generally, the term "systemic bioavailability" as used herein refers to the fraction of an administered dose of an active pharmaceutical ingredient (API), such as a therapeutic polypeptide as defined herein, which reaches the systemic circulation in active or reversibly deactivated form. By definition, when an API is administered intravenously, its bioavailability is 100%. However, when it is administered via other routes, e.g. orally or subcutaneously, its bioavailability decreases (due to incomplete absorption and first-pass metabolism). Absolute systemic bioavailability is calculated as the relative exposure of the API in systemic circulation following non-intravenous administration (e.g. mucosal, such as oral or inhalation), estimated as the area under the plasma concentration versus time curve (AUG) compared to the exposure of the API following intravenous administration.

[0018] In accordance with the invention, the use of an alginate oligomer together with a therapeutic polypeptide, and optionally a gastrointestinal permeation enhancer, undergoing oral, orogastric, nasogastric, or intragastric administration to a stomach of a human or non-human animal as part of one or more dosage forms will result in a greater measure of absolute systemic bioavailability as compared to the administration of the therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer, in the absence of the alginate oligomer, but otherwise in identical circumstances.

[0019] AUG may be calculated as the definite integral of the concentration of a drug in blood plasma as a function of time. Conveniently this may be calculated using the trapezoidal rule.

[0020] Expressed differently, the invention provides a method for the gastric uptake of an active or reversibly deactivated polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject in as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0021] Likewise, the invention further provides an alginate oligomer for use in a method for the gastric uptake of an active or reversibly deactivated polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0022] Expressed differently again, the invention provides a method for absorbing an active or reversibly deactivated polypeptide therapeutic agent from a stomach of a human or non- human animal subject, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0023] Likewise, the invention further provides an alginate oligomer for use in a method for absorbing an active or reversibly deactivated polypeptide therapeutic agent from a stomach of a human or non-human animal subject, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0024] Expressed differently again, the invention provides a method for increasing absorption of an active or reversibly deactivated polypeptide therapeutic agent from a stomach of a human or non-human animal subject, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0025] Likewise, the invention further provides an alginate oligomer for use in a method for increasing absorption of an active or reversibly deactivated polypeptide therapeutic agent from a stomach of a human or non-human animal subject, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0026] Increased absorption from a stomach may be seen as increased systemic bioavailability over the time in which a substantial proportion of the target agent / dosage form will be resident (retained) in the stomach to which it has been administered. It might also be seen as a greater Cmax following entry to the stomach. It might also be seen as a more rapid rise in plasma concentration, and / or a reduced lag in time taken for the plasma concentration of the therapeutic polypeptide to begin to rise. These observations are as compared to the administration of the therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer, in the absence of the alginate oligomer, but in otherwise identical circumstances.

[0027] Expressed differently again, the invention provides a method for improving the effectiveness of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration in the systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, the polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment..

[0028] Likewise, the invention further provides an alginate oligomer for use in a method for improving the effectiveness of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration in the systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, the polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment..

[0029] By “improving the effectiveness of a polypeptide therapeutic” it is meant any positive effect on the therapeutic use of the polypeptide in question. This may include a greater efficacy or potency at its site of action or pharmacological receptor, longer duration of pharmacological effect, fewer or less severe side effects (systemic or local), wider therapeutic window, greater circulating plasma levels, prolonged circulating plasma levels, higher Cmax, more rapid uptake, and the like. These observations are as compared to the administration of the therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer, in the absence of the alginate oligomer, but in otherwise identical circumstances. Improved effectiveness may be seen in the requirement for less polypeptide to be administered in essentially the same way order to achieve the same therapeutic outcomes.

[0030] Expressed differently again, the invention provides a method for systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, a polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to the stomach of a human or non- human animal subject, which has, is suspected of having, or is at risk of, said disease or condition or complication thereof, as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0031] Likewise, the invention further provides an alginate oligomer for use in a method for systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, a polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to the stomach of a human or non-human animal subject, which has, is suspected of having, or is at risk of, said disease or condition or complication thereof, as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0032] In accordance with the invention, a systemic treatment or prevention involves the administration of the therapeutic polypeptide in such a way as to result in the polypeptide entering the blood circulation and becoming distributed to areas of the subject’s body which are spatially remote from the site of administration, specifically the stomach. Preferably, circulating levels of the polypeptide are above levels necessary for achieving a therapeutic effect. Systemic treatment encompasses the treatment of systemic conditions, conditions having pathologies at multiple spatially distributed loci and / or conditions having a single localised pathology remote from the site of administration.

[0033] The methods of the invention may include a step following the administration of the polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, of measuring the amount, or concentration, of the polypeptide therapeutic agent in the plasma of the subject, e.g. within 360, 330, 300, 270, 240, 210, 180, 120, 60, 30, 20, 15, 10, or 5 mins of the administration of the polypeptide therapeutic agent, the alginate oligomer or the gastrointestinal permeation enhancer, whichever is last to be administered. In other embodiments the methods of the invention may comprise, or comprise further to the above described measuring step, a step in which systemic bioavailability or absolute systemic bioavailability of the polypeptide therapeutic agent is calculated, e.g. over 360, 330, 300, 270, 240, 210, 180, 120, 60, 30, 20, 15, 10, or 5 mins from the administration of the polypeptide therapeutic agent, the alginate oligomer or the gastrointestinal permeation enhancer, whichever is last to be administered.

[0034] The use of an alginate oligomer in the manufacture of medicaments for use in the above described methods is further contemplated. Such medicaments may be one or more of the above described dosage forms which are administered to the human or non-human animal subject in the course of such methods.

[0035] By “substantive protection from a gastric environment” it is meant that a substantial proportion of the target agent, i.e. the agent under consideration (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer) administered to the stomach is not exposed to the gastric environment, or the potentially deleterious actions of the gastric environment on the target agent are prevented, inhibited or reduced for a substantial proportion of the agent, for the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, is resident in the stomach to which is has been administered.

[0036] Thus, “substantive protection from a gastric environment” may be considered to be the means, e.g. the above mentioned coating, to delay the exposure of the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer to the gastric environment or to delay the potentially deleterious actions of the gastric environment on the target agent, for a time which is about or greater than the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, is resident in the stomach to which is has been administered .

[0037] This may be expressed alternatively as meaning that an insubstantial proportion of the target agent (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer) administered to the stomach is exposed to the gastric environment, or the potentially deleterious actions of the gastric environment on the target agent are limited to an insubstantial proportion of the agent, for the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, is resident in the stomach to which is has been administered.

[0038] In more specific terms, “substantive protection from a gastric environment” may be expressed as meaning that a substantial proportion of the target agent (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer), or the dosage form of which it is a part thereof, administered to the stomach is stabilised (rendered stable) in the gastric environment for the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, is resident in the stomach to which is has been administered.

[0039] This may be expressed alternatively as meaning that an insubstantial proportion of the target agent (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer), or the dosage form of which it is a part thereof, administered to the stomach is destabilised (e.g. denatured, degraded, precipitated, congealed, or inactivated / deactivated for any reason for the agent, or dissolved, dispersed, disintegrated for the dosage form) in the gastric environment for the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, is resident in the stomach to which is has been administered.

[0040] Thus, in accordance with the invention, the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer are administered in one or more dosage forms which do / does not have a structure which may provide the polypeptide therapeutic agent, the alginate oligomer, and / or the gastrointestinal permeation enhancer which is a part thereof substantive protection from a gastric environment.

[0041] A coating or any other dosage form structure which may provide “substantive protection from a gastric environment” may be considered to be one which combats, counteracts, negates, inhibits or reduces potentially deleterious effects of a gastric environment on the target agent (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer), or the dosage form of which it is a part, in particular for the time in which a substantial proportion of the agent, e.g. the dosage form of which it is a part, is resident in the stomach to which is has been administered.

[0042] A “substantial proportion of the target agent” may be considered to be at least 70%, e.g. at least 75%, 80%, 85%, 90% or 95% of the administered dose measured by weight. A “substantial proportion of the dosage form” may be considered to be at least 70%, e.g. at least 75%, 80%, 85%, 90% or 95% of the administered dosage form as measured by weight. An “insubstantial proportion of the target agent” may be considered to be no more than 25%, e.g. no more than 20%, 15%, 10%, or 5% of the administered dose as measured by weight. An “insubstantial proportion of the dosage form” may be considered to be no more than 25%, e.g. no more than 20%, 15%, 10%, or 5% of the administered dosage form as measured by weight

[0043] The time in which a substantial proportion of the target agent / dosage form will be resident (retained) in the stomach to which it has been administered will vary between subjects, the agent in question, the constituents and properties of the dosage form it is a part thereof and any extraneous liquids or solids consumed with the dosage form, but may be taken to be about 15 mins to about 240 mins, e.g. about 15 mins to about 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, 230, or 240 mins, or about 15, 20, 30, 40 50, 60, 70, 80, 90, 100, 110, 120, 130, 140, 150, 160, 170, 180, 190, 200, 210, 220, or 230 mins to about 240 mins, following entry to the stomach. Any range which may be constructed from the foregoing values is contemplated explicitly.

[0044] This residency / retention time may be viewed as the time in which a substantial proportion of the agent, or the dosage form of which it is a part thereof, transits the stomach to which is has been administered and enters the intestines essentially unchanged (i.e. not showing deleterious effects of the gastric environment described above).

[0045] Thus, “substantive protection from a gastric environment” may be considered to be prolonged protection, i.e. protection for a substantial proportion of the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer, or the dosage form of which it is a part thereof, against exposure to the gastric environment or the potentially deleterious actions of the gastric environment on the target agent which lasts for a time sufficient to allow a substantial proportion of the agent, or the dosage form of which it is a part thereof, to transit the stomach to which is has been administered and enter the intestines essentially unchanged.

[0046] Thus, the feature of “substantive protection from a gastric environment” may be considered to be met if a substantial proportion of the target agent (e.g. the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer), or the dosage form of which it is a part thereof, enters the intestines unchanged within about 240 mins of entering the stomach, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, or 60 mins of entering the stomach.

[0047] The term “gastric environment” refers to the physical and chemical conditions in the lumen of the stomach to which the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer are administered in accordance with the invention. The precise conditions will vary between subjects, but will typical have a pH of about 1.0 to about 3.5, e.g. about 1.2 to about 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, 3.4 or 3.5 or about 1.4, 1.6, 1.8, 2.0, 2.2, 2.4, 2.6, 2.8, 3.0, 3.2, or 3.4 to about 3.5. Any range which may be constructed from the foregoing values is contemplated explicitly. The acidification agent is typically hydrochloric acid. Digestive (gastric) enzymes will also be present e.g. proteases (e.g. pepsinogen I, II and III, pepsin and rennin) and lipases (gastric lipase). The term “gastric juice” may refer to the liquid content of the lumen of the stomach and can be taken as having the same physical and chemical properties.

[0048] In certain embodiments references to a gastric environment is a reference to the gastric environment of the subject undergoing treatment.

[0049] The “potentially deleterious actions of the gastric environment” therefore means any negative effects these conditions might have on the physical, chemical or pharmaceutical properties of polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer or the structural integrity of the dosage form in the absence of any protection against or mitigation thereof. For the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer this includes denaturation, degradation, precipitation, gelation or inactivation / deactivation of the pharmaceutical activity of the treated agent for any reason. For the dosage form this includes dissolution, dispersion, disintegration, disaggregation, fragmentation, decomposition or any sort of loss of or breakdown in structural cohesion or integrity. Protection from such actions may occur through any mechanism, but includes physical shielding, inhibition of gastric enzyme activity and / or local neutralisation of acidic conditions.

[0050] In certain embodiments, the feature of “substantive protection from a gastric environment” may be considered to be met if an insubstantial proportion of the target agent is denatured, degraded, precipitated, congealed or inactivated / deactivated within about 240 mins of entering the stomach, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40 or 30 mins of entering the stomach.

[0051] Likewise, in certain embodiments, the feature of “substantive protection from a gastric environment” may be considered to be met if an insubstantial proportion of the dosage form is lost through dissolution, dispersion, disintegration, disaggregation, fragmentation, decomposition, degradation or any sort of loss of or breakdown in structural cohesion or integrity within about 240 mins of entering the stomach, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40 or 30 mins of entering the stomach.

[0052] In certain embodiments denaturation, degradation, precipitation, gelation or inactivation / deactivation of the pharmaceutical or physiological activity of the treated agent is irreversible. In contrast, reversible denaturation, degradation, precipitation, gelation or inactivation / deactivation of the pharmaceutical or physiological activity of the treated agent means that the treated agent can return to its essentially normal structure and display essentially normal activity (physiological / pharmaceutical) upon transfer to a less chemically extreme environment, e.g. the blood circulation or other neutral or benign body fluid. Expressed numerically, a return to essentially normal activity may be considered to be recovery of at least 80%, e.g. at least 85%, 90%, 95% or 95% of the relevant physiological or pharmacological activity of the same amount of the untreated agent.

[0053] In certain embodiments the feature of “substantive protection from a gastric environment” may be considered to be met if an insubstantial proportion of the target agent is denatured, degraded, precipitated, congealed or inactivated / deactivated within about 240 mins of exposure to simulated gastric juice USP (consisting of, in 1000 ml water, 2.0 g NaCI, 3.2g purified pepsin (with activity 800 to 2500 units / mg of protein) and HCI (to pH 1.2)) at 37 °C with stirring at 100 rpm, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40 or 30 mins of exposure to simulated gastric juice under such conditions. Dissolution testing may be carried out in United States Pharmacopeia (USP) Apparatus I (100 rpm).

[0054] In certain embodiments the feature of “substantive protection from a gastric environment” may be considered to be met if an insubstantial proportion of the dosage form is lost through dissolution, dispersion, disintegration, disaggregation, fragmentation, decomposition or any sort of loss of or breakdown in structural cohesion or integrity within about 240 mins of exposure to simulated gastric juice USP (consisting of, in 1000 ml water, 2.0 g NaCI, 3.2g purified pepsin (with activity 800 to 2500 units / mg of protein) and HCI (to pH 1.2)) at 37 °C with stirring at 100 rpm, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40 or 30 mins of exposure to simulated gastric juice under such conditions. Dissolution testing may be carried out in United States Pharmacopeia (USP) Apparatus I (100 rpm).

[0055] In certain embodiments the above described methods comprise administering said polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal subject in one or more dosage forms, wherein the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, are not administered as part of one or more dosage forms with a structure which would provide to the polypeptide therapeutic agent, the alginate oligomer, and / or the gastrointestinal permeation enhancer which is a part thereof substantive protection from a gastric environment.

[0056] Viewed differently, the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer are administered to a stomach in a manner which renders them (e.g. as part of a dosage form which is) substantially susceptible to the potentially deleterious actions of a gastric environment, e.g. a manner which permits or allows exposure to the gastric environment and / or potentially deleterious actions of a gastric environment.

[0057] This may be expressed as being substantially susceptible to being destabilised (e.g. denatured, degraded, precipitated, congealed, or inactivated / deactivated for any reason for the agent, or dissolved, dispersed, disintegrated for the dosage form) in the gastric environment for the time in which a substantial proportion of the agent, e.g. the dosage form of which it is a part, is resident in the stomach to which is has been administered. It may further be expressed as being unprotected.

[0058] In certain embodiments the dosage form is a dosage form which will lose substantially all cohesion or structural integrity, e.g. is substantially dissolved, dispersed, disintegrated, disaggregated, fragmented, decomposed, or degraded within about 240 mins of entering the stomach, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40, 30, 20, 15, 10, or 5 mins of entering the stomach.

[0059] Likewise, in certain embodiments, the dosage form is a dosage form which would permit a substantial proportion of the target agent to be denatured, degraded, precipitated, congealed or inactivated / deactivated within about 240 mins of entering the stomach, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40, 30, 20, 15, 10, or 5 mins of entering the stomach.

[0060] In certain embodiments the dosage form is a dosage form which will lose substantially all cohesion or structural integrity (i.e. a substantial proportion of the dosage form will lose cohesion or structural integrity), e.g. is substantially dissolved, dispersed, disintegrated, disaggregated, fragmented, decomposed, or degraded within about 240 mins of exposure to simulated gastric juice USP (consisting of, in 1000 ml water, 2.0 g NaCI, 3.2g purified pepsin (with activity 800 to 2500 units / mg of protein) and HCI (to pH 1.2)) at 37 °C with stirring at 100 rpm, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40, 30, 20, 15, 10, or 5 mins of exposure to simulated gastric juice under such conditions. Dissolution testing may carried out in United States Pharmacopeia (USP) Apparatus I (100 rpm).

[0061] Likewise, in certain embodiments, the dosage form is a dosage form which would permit a substantial proportion of the target agent to be denatured, degraded, precipitated, congealed or inactivated / deactivated within about 240 mins of exposure to simulated gastric juice USP (consisting of, in 1000 ml water, 2.0 g NaCI, 3.2g purified pepsin (with activity 800 to 2500 units / mg of protein) and HCI (to pH 1.2)) at 37 °C with stirring at 100 rpm, e.g. within about 220, 200, 180, 160, 140, 120, 100, 80, 60, 40, 30, 20, 15, 10, or 5 mins of exposure to simulated gastric juice under such conditions. Dissolution testing may carried out in United States Pharmacopeia (USP) Apparatus I (100 rpm).

[0062] The dosage forms of use in the invention may take any arrangement common to oral, orogastric, nasogastric, or intragastric administration techniques. Thus, the dosage form may be any pharmaceutically acceptable composition, e.g. in the form of a solution, dispersion, emulsion, powder, tablet, capsule, gel, and the like. Conveniently, the dosage form will take the form of a tablet or a liquid or powder filled capsule. These are considered to be examples of a solid dosage form. In certain embodiments the dosage form has dimensions which allow it to be swallowed by the subject undergoing treatment. In certain embodiments the dosage form does not comprise, e.g. is not substantially made up of, an alginate oligomer in a solid, e.g. a gelled or partially gelled, form. In particular in certain embodiments the therapeutic polypeptide is not encapsulated by or otherwise associated with an alginate oligomer in a solid, e.g. a gelled or partially gelled, form such that the therapeutic polypeptide is substantively protected from the gastric environment. In certain embodiments the dosage form is not provided such that upon entry into the stomach any alginate oligomer in the dosage form does not encapsulate or otherwise associate with the polypeptide therapeutic agent, e.g. in a solid, in particular a gelled or partially gelled form, such that the therapeutic polypeptide is substantively protected from the gastric environment.

[0063] In certain embodiments the various types of components of the dosage form are not cross-linked to themselves and / or to one another. Such cross-links may be covalent or ionic, e.g. involving divalent cations. In certain embodiments, the alginate oligomer molecules in the dosage form are not cross-linked to one another. In certain embodiments, the alginate oligomer molecules in the dosage form are not cross-linked to other components in the dosage form, e.g. the polypeptide therapeutic agent.

[0064] In certain embodiments the polypeptide therapeutic agent and the alginate oligomer are not provided in the dosage as a preformed stable non-covalently bonded complex.

[0065] In certain embodiments the polypeptide therapeutic agent is not present as part of the dosage form as a particulate form thereof. In certain embodiments the alginate oligomer is not present in the dosage form as a particulate form thereof. In other embodiments the polypeptide therapeutic agent and / or the alginate oligomer and / or the gastrointestinal permeation enhancer are not present as part of the dosage form in or on a particle. In other embodiments the dosage form does not comprise particles.

[0066] References to particles above include microparticles and nanoparticles. Microparticles may be considered any particle with a particle size in the micrometre range, i.e. from about 1 pm to about 1000 pm, e.g. about 1 pm to about 900 pm, 800 pm, 700 pm, 600 pm, 500 pm, 400 pm, 300 pm, 200 pm, 100 pm, 50 pm, 40 pm, 30 pm , 20 pm, 10 pm, or 5 pm, or from about 1 pm, 5 pm, 10 pm, 20 pm, 30 pm, 40 pm, 50 pm, 100 pm, 200 pm, 300 pm, 400 pm, 500 pm, 600 pm, 700 pm, 800 pm, or 900 pm to about 1000 pm. Nanoparticles may be considered any particle with a particle size in the nanometre range, i.e. from about 1 nm to about 1000 nm, e.g. about 1 nm to about 900 nm, 800 nm, 700 nm, 600 nm, 500 nm, 400 nm, 300 nm, 200 nm, 100 nm or 50 nm, or from about 50 nm, 100 nm, 200 nm, 300 nm, 400 nm, 500 nm, 600 nm, 700 nm, 800 nm or 900 nm to about 1000 nm. Any ranges with endpoints which may be formed from any of the above values are expressly disclosed. In the context of nanoparticles, the term "particle size" refers to the size of a particle as measured using a dynamic light scattering method (e.g., quasielastic light scattering method). For example, particle sizes can be measured using dynamic light scattering instruments (e.g. Zetasizer Nano ZS model manufactured by Malvern Instruments Ltd. and ELS-8000 manufactured by Otsuka Electronics Co., Ltd.). The instruments measure Brownian motion of the particles and particle size is determined based on established dynamic light scattering methodological theory. In the context of microparticles, the term "particle size" refers to the size of a particle as measured using laser diffraction spectroscopy method. Commercial instruments are available and include the Mastersizer 3000 instrument manufactured by Malvern Instruments Ltd.

[0067] In certain embodiments the dosage form is not bioadhesive, or does not contain bioadhesive components. In certain embodiments the dosage form is not mucoadhesive or does not contain mucoadhesive components.

[0068] The polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer may together or separately be located in and / or on any part of the dosage form, i.e. present therein or thereon. They maybe intimately mixed or present in a plurality of discrete compartments, e.g. layers. Indeed, it is expressly contemplated that multi-layered dosage form may be provided with an alginate oligomer containing layer surrounding an inner compartment or layer containing the polypeptide therapeutic agent and / or the gastrointestinal permeation enhancer. A further arrangement is a multi-layered dosage form having an alginate oligomer containing outer layer, an innermost compartment or layer containing the polypeptide therapeutic agent and an intervening layer containing the gastrointestinal permeation enhancer. All other physical arrangements of these components, including alternating layers / compartments of two or more components are explicitly contemplated. The presence of excipients, e.g. any of those recited herein, alongside the polypeptide therapeutic agent, the alginate oligomer and / or the gastrointestinal permeation enhancer, if present, is explicitly contemplated. In these embodiments the excipients may vary between layers / compartments. In still further arrangements, layers of excipients, e.g. an outer coating layer may be present.

[0069] The dosage forms of which the therapeutic polypeptide, the alginate oligomer and optionally the gastrointestinal permeation enhancer of use in the invention are a part thereof do not carry a coating (or barrier, layer, or film) in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

[0070] Such a coating would be a layer of material in or on the dosage form, typically an outer or outermost layer, that would provide substantive protection from a gastric environment to the parts of the dosage form internal to the coating, e.g. the polypeptide therapeutic agent, the alginate oligomer, and / or the gastrointestinal permeation enhancer if used. Such coating would be formed from materials in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used which are protective vis a vis the gastric environment, but the presence of the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, in the coating is not excluded. In other embodiments the coating is not an alginate oligomer, or does not comprise an alginate oligomer.

[0071] Thus, these compositions will not have a so-called “enteric coating”, i.e. a coating (or barrier, layer, or film) which would remain substantially non-degraded in the stomach of the subject in the time it takes for such a composition to transit the stomach. Enteric coatings are insoluble in the stomach and prevent passage of gastric juice components, such as acids

[0072] Such coatings are typically prepared from polymers including fatty acids, waxes, shellac, plastics, and plant fibres. Specific examples thereof include but are not limited to methyl acrylate-methacrylic acid copolymers, methyl methacrylate-methacrylic acid copolymers, cellulose acetate succinate, cellulose acetate phthalate, hydroxypropyl methylcellulose phthalate, hydroxypropyl methylcellulose acetate succinate (hypromellose acetate succinate), polyvinyl acetate phthalate (PVAP), cellulose acetate trimellitate, and those available under the trade name Eudragit, and alginate polymer (i.e. alginates of greater than 30, 25, 20, or 15 kDa). Such coatings may be applied in conventional fashion and in conventional thicknesses / amounts. In certain embodiments the dosage form and / or the components thereof, e.g. the alginate oligomer, are not conjugated to a polyethylene glycol polymer (PEGylated).

[0073] In certain embodiments the dosage form may consist of the therapeutic polypeptide, the alginate oligomer and / or the gastrointestinal permeation enhancer.

[0074] It will be seen that the above defined features of the invention should not be construed to exclude the possibility that the structure of the dosage form may still provide a target agent or the dosage form of which it is a part thereof with protection from the gastric environment and / or the deleterious action of the gastric environment for a limited period of time or to a limited extent, e.g. for no more than 60 mins, or no more than 55, 50, 45, 40, 35, 30, 25, 20, 10 or 5 mins, of entering the stomach, but exposure to the gastric environment and / or the deleterious action of the gastric environment will occur thereafter and before gastric transit / residence / retention of the target agent or the dosage form of which it is a part thereof in complete.

[0075] In certain specific embodiments the dosage form may have a structure in which the alginate oligomer surrounds the polypeptide therapeutic agent and provides the above described limited protection to the polypeptide therapeutic agent for the time it takes for the dosage form to reach the surface of the gastric mucosa.

[0076] By "use together" or “administered together” or the like, it is meant that the at least two therapeutically active agents (that is the therapeutic polypeptide and the alginate oligomer), or the at least three (if a gastrointestinal permeation enhancer is also used), are used in combination to achieve the effect in question (e.g. increased systemic bioavailability, gastric uptake, absorption from the stomach, increased absorption from the stomach, improved effectiveness of the therapeutic polypeptide or treatment or prevention of a disease or condition or complication thereof which is responsive to the therapeutic polypeptide).

[0077] It is particularly meant that an effective (e.g. pharmaceutically effective) amount of the alginate oligomer is administered at the same or substantially the same time as or prior to administering an effective (e.g. pharmaceutically effective) amount of the therapeutic polypeptide, and optionally at the same or substantially the same time as or prior to administering an effective (e.g. pharmaceutically effective) amount of the gastrointestinal permeation enhancer. In other embodiments the oligomer is administered separately to and after the therapeutic polypeptide and / or the gastrointestinal permeation enhancer. The skilled person would readily be able to design a dosage regimen to maximise the effect of the alginate oligomer and therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer that are being used in the methods of the invention. "Use together" does not imply that the respective agents are present in the same dosage form, formulation or composition, and accordingly even if used, or administered, at the same or substantially the same time, the alginate oligomer and therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer, need not be present in the same dosage form, composition or formulation, but may be administered separately. Thus "separate" use / administration includes use / administration at the same or substantially the same time, or at different times, e.g. sequentially, or at different time intervals according to the desired dosage or usage regime. “Simultaneous” administration accordingly includes administration of the alginate oligomer and therapeutic polypeptide, and optionally the gastrointestinal permeation enhancer, within the same dosage form composition or formulation, or within separate compositions / formulations administered at the same or substantially the same time. Where at least three agents are being used in accordance with the invention, two may be administered in one dosage form / com position (e.g. the alginate oligomer and the therapeutic polypeptide, or the alginate oligomer and the gastrointestinal permeation enhancer, or the therapeutic polypeptide and the gastrointestinal permeation enhancer) and the third administered in a separate dosage form / composition. It may be advantageous if all three agents are administered as a single dosage form composition, e.g. as a solution or in tablet or capsule form.

[0078] Included within the scope of "substantially the same time" is application or administration of the therapeutic polypeptide immediately or almost immediately before or after the alginate oligomer, and / or optionally immediately or almost immediately before or after the gastrointestinal permeation enhancer. The term "almost immediately" may be read as including application or administration within one hour of the previous application or administration, preferably within 30, 20, 10, 5, 4, 3, 2 or 1 minutes. The therapeutic polypeptide can be applied or administered in a plurality of applications prior to, or with, or after the alginate oligomer and optionally the gastrointestinal permeation enhancer. The alginate oligomer can be applied or administered in a plurality of applications prior to, or with, or after the therapeutic polypeptide and optionally the gastrointestinal permeation enhancer.

[0079] Thus, the invention further provides a dosage form adapted for delivery to a stomach of a human or non-human animal subject, said composition comprising

[0080] (i) a polypeptide therapeutic agent,

[0081] (ii) an alginate oligomer; and

[0082] (iii) gastrointestinal permeation enhancer, wherein said dosage form does not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer which would provide substantive protection from a gastric environment.

[0083] The above detailed discussion of dosage forms of the invention applies mutatis mutandis to this aspect of the invention.

[0084] The dosage forms of which the therapeutic polypeptide, the alginate oligomer and optionally the gastrointestinal permeation enhancer of use in the invention are a part thereof may be administered to the stomach of the subject undergoing treatment by oral, orogastric, nasogastric, or intragastric routes. The same or different routes may be used for the various dosage forms being administered in accordance with the invention. It may be convenient to use the same route. Oral administration is preferred on account of its ease and comfort for the subject and hence increase likelihood of compliance.

[0085] It will be readily apparent that the methods of the invention do not further comprise separate administration of a compound or the use of a device which is able to protect the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, or the dosage form more generally, from the gastric environment.

[0086] Gastric uptake of an active or reversibly deactivated polypeptide therapeutic agent and / or absorption of an active or reversibly deactivated polypeptide therapeutic agent from a stomach may be measured by analysing the plasma levels of the active or reversibly deactivated polypeptide therapeutic agent in the time prior to gastric emptying.

[0087] Alternatively or additionally these phenomenon may be measured by analysing the comparative plasma levels of the active or reversibly deactivated polypeptide therapeutic agent in the splenic vein, which drains the gastric cavity, and the portal vein, which drains the gastrointestinal system. Gastric uptake / absorption from the stomach following administration to the stomach will show as increase plasma concentrations in the splenic vein as compared to the portal vein.

[0088] The methods of the invention may include a step following the administration of the polypeptide therapeutic agent together with an alginate oligomer, and optionally a gastrointestinal permeation enhancer, of measuring gastric uptake of the polypeptide therapeutic agent, or an active or reversibly deactivated form of the polypeptide therapeutic agent, and / or of measuring absorption of the polypeptide therapeutic agent, or an active or reversibly deactivated form of the polypeptide therapeutic agent, from a stomach. Any of the above described measuring techniques may be performed. These measurements may be performed within 360, 330, 300, 270, 240, 210, 180, 120, 60, 30, 20, 15, 10, or 5 mins of the administration of the polypeptide therapeutic agent, the alginate oligomer or the gastrointestinal permeation enhancer, whichever is last to be administered.

[0089] In accordance with the invention gastric uptake / absorption from the stomach is of the active form of the polypeptide therapeutic agent or a deactivated form which may be reversed. By this it is meant that the polypeptide therapeutic agent is taken up into the blood from the gastric milieu, e.g. into the splenic vein, in a form which retains the intrinsic therapeutic activity of the polypeptide, or in a form which reverts to a form displaying the intrinsic therapeutic activity of the polypeptide once in the blood stream of the subject or by the time it reaches its site of therapeutic action. In other words, the polypeptide therapeutic agent is taken up into the blood from the gastric milieu, e.g. into the splenic vein, in a form which may be therapeutically effective, or in a form which reverts to a therapeutically effective form once in the blood stream of the subject or by the time it reaches its site of therapeutic action. Thus, the polypeptide therapeutic agent is up taken in a substantially non-degraded, non-deactivated / inactive and / or non-denatured form, or at least a non-irreversibly deactivated / inactive and / or non-irreversibly denatured form.

[0090] As noted above, alginates typically occur as polymers of an average molecular mass of at least 35,000 Daltons, i.e. approximately 175 to approximately 190 monomer residues, although typically much higher and an alginate oligomer according to the present invention may be defined as a material obtained by fractionation (i.e. size reduction) of an alginate polymer, commonly a naturally occurring alginate. An alginate oligomer can be considered to be an alginate of an average molecular weight of less than 15,000 Daltons (i.e. less than approximately 100 monomer residues).

[0091] Viewed alternatively, an oligomer for use according to the invention will typically contain 2 to 100 monomer residues, more typically 3, 4, 5 or 6 to 100, and may contain 2, 3, 4, 5 or 6 to 75, 2, 3, 4, 5 or 6 to 50, 2, 3, 4, 5 or 6 to 40, 2, 3, 4, 5 or 6 to 35 or 2, 3, 4, 5 or 6 to 30 residues. Thus, an alginate oligomer for use according to the invention will typically have an average molecular weight of 350, 550, 700, 900 or 1000 to 15,000 Daltons, 350, 550, 700, 900 or 1000 to 10,000 Daltons, 350, 550, 700, 900 or 1000 to 8000 Daltons, 350, 550, 700, 900 or 1000 to 7000 Daltons, or 350, 550, 700, 900 or 1000 to 6,000 Daltons.

[0092] Alternatively put, the alginate oligomer may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn) of 2 to 100, preferably 2 to 75, preferably 2 to 50, more preferably 2 to 40, 2 to 35, 2 to 30, 2 to 28, 2 to 25, 2 to 22, 2 to 20, 2 to 18, 2 to 17, 2 to 15 or 2 to 12.

[0093] Other representative ranges (whether for the number of residues, DP or DPn) include any one of 3, 4, 5, 6, 7, 8, 9, 10 or 11 to any one of 50, 45, 40, 39, 38, 37, 36, 35, 34, 33, 32,

[0094] 31 , 30, 29, 28, 27, 26, 25, 24, 23, 22, 21 , 20, 19, 18, 17, 16, 15, 14, 13 or 12.

[0095] Other representative ranges (whether for the number of residues, DP or DPn) include any one of 8, 9, 10, 11 , 12, 13, 14 or 15 to any one of 50, 45, 40, 39, 38, 37, 36, 35, 34, 33,

[0096] 32, 31 , 30, 29, 28, 27, 26, 25, 24, 23, 22, 21 , 20, 19, 18, 17 or 16.

[0097] Other representative ranges (whether for the number of residues, DP or DPn) include any one of 11 , 12, 13, 14, 15, 16, 17 or 18 to any one of 50, 45, 40, 39, 38, 37, 36, 35, 34, 33, 32, 31 , 30, 29, 28, 27, 26, 25, 24, 23, 22, 21 , 20 or 19.

[0098] In general terms, an alginate oligomer will, as noted above, contain (or comprise) guluronate or guluronic acid (G) and / or mannuronate or mannuronic acid (M) residues or units. An alginate oligomer according to the invention will preferably be composed solely, or substantially solely (i.e. consist essentially of) uronate / uronic acid residues, more particularly solely or substantially solely of G and M residues or G residues, so long as at least 30% of the monomer residues are G residues. Alternatively expressed, in the alginate oligomer of use in the present invention, at least 80%, more particularly at least 85, 90, 95 or 99% of the monomer residues may be uronate / uronic acid residues, or, more particularly G and M residues or G residues, so long as at least 30% of the monomer residues are G residues. In other words, preferably the alginate oligomer will not comprise other residues or units (e.g. other saccharide residues, or more particularly other uronic acid / uronate residues).

[0099] The alginate oligomer is preferably a linear oligomer.

[0100] As already indicated, at least 30% of the monomer residues of the alginate oligomer are G residues (i.e. guluronate or guluronic acid). In other words the alginate oligomer will contain at least 30% guluronate (or guluronic acid) residues. Specific embodiments thus include alginate oligomers with (e.g. containing) 30 to 70% G (guluronate) residues or 70 to 100% G (guluronate) residues. Thus, a representative alginate oligomer for use according to the present invention may contain at least 70% G residues (i.e. at least 70% of the monomer residues of the alginate oligomer will be G residues).

[0101] Preferably at least 40%, 45%, 50%, 55% or 60%, more particularly at least 70% or 75%, even more particularly at least 80, 85, 90, 91 , 92, 93, 94, 95, 96, 97, 98 or 99% of the monomer residues are guluronate. In one embodiment the alginate oligomer may be an oligoguluronate (i.e. a homooligomer of G, or 100% G).

[0102] In a further preferred embodiment, the above described alginates of the invention have a primary structure wherein the majority of the G residues are in so called G-blocks. Preferably at least 50%, more preferably at least 70 or 75%, and most preferably at least 80, 85, 90, 92 or 95% of the G residues are in G-blocks. A G block is a contiguous sequence of at least two G residues, preferably at least 3 contiguous G residues, more preferably at least 4 or 5 contiguous G residues, most preferably at least 7 contiguous G residues.

[0103] In particular at least 90% of the G residues are linked 1-4 to another G residue. More particularly at least 95%, more preferably at least 98%, and most preferably at least 99% of the G residues of the alginate are linked 1-4 to another G residue. The alginate oligomer of use in the invention is preferably a 3- to 35-mer, more preferably a 3- to 28-mer, in particular a 4- to 25-mer, e.g. a 5- to 20-mer, especially a 6- to 22-mer, in particular an 8- to 20-mer, especially a 10- to 15-mer, e.g. having a molecular weight in the range 350 to 6400 Daltons or 350 to 6000 Daltons, preferably 550 to 5500 Daltons, preferably 750 to 5000 Daltons, and especially 750 to 4500 Daltons or 2000 to 3000 Daltons or 900 to 3500 Daltons. Other representative alginate oligomers include, as mentioned above, oligomers with 5, 6, 7, 8, 9, 10, 11 , 12 or 13 to 50, 45, 40, 35, 28, 25, 22 or 20 residues.

[0104] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 3-28, 4-25, 6-22, 8-20 or 10-15, or 5- 18 or 7-15 or 8-12, especially 10.

[0105] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 3-24, 4-23, 5-22, 6-21 , 7-20, 8-19, 9-

[0106] 18, 10-17, 11-16, 12-15 or 13-14 (e.g. 13 or 14).

[0107] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 4-25, 5-24, 6-23, 7-22, 8-21 , 9-20, IQ-

[0108] 19, 11-18, 12-17, 13-16, 14-15 (e.g. 14 or 15).

[0109] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 5-26, 6-25, 7-24, 8-23, 9-22, 10-21 , 11-20, 12-19, 13-18, 14-17 or 15-16 (e.g. 15 or 16).

[0110] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 4-50, 4-40, 4-35, 4-30, 4-28, 4-26, 4- 22, 4-20, 4-18, 4-16 or 4-14.

[0111] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 5-50, 5-40, 5-25, 5-22, 5-20, 5-18, 5- 23, 5-20, 5-18, 5-16 or 5-14. The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 6-50, 6-40, 6-35, 6-30, 6-28, 6-26, 6-

[0112] 24, 6-20, 6-19, 6-18, 6-16 or 6-14.

[0113] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 8-50, 8-40, 8-35, 8-30, 8-28, 8-25, 8- 22, 8-20, 8-18, 8-16 or 8-14.

[0114] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 9-50, 9-40, 9-35, 9-30, 9-28, 9-25, 9- 22, 9-20, 9-18, 9-16 or 9-14.

[0115] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 10-50, 10-40, 10-35, 10-30, 10-28, IQ-

[0116] 25, 10-22, 10-20, 10-18, 10-16 or 10-14.

[0117] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 11-50, 11-40, 11-35, 11-30, 11-28, 11- 25, 11-22, 11-20, 11-18, 11-16 or 11-14.

[0118] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 12-50, 12-40, 12-35, 12-30, 12-28, 12- 25, 12-22, 12-20, 12-18, 12-16 or 12-14.

[0119] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 13-50, 13-40, 13-35, 13-30, 13-28, 13- 25, 13-22, 13-20, 13-18, 13-16 or 13-14.

[0120] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 14-50, 14-40, 14-35, 14-30, 14-28, 14- 25, 14-22, 14-20, 14-18, 14-16 or 14-15.

[0121] The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 15-50, 15-40, 15-35, 15-30, 15-28, 15- 25, 15-22, 15-20, 15-18 or 15-16. The alginate oligomer of the invention may have a degree of polymerisation (DP), or a number average degree of polymerisation (DPn), of 18-50, 18-40, 18-35, 18-30, 18-28, 18- 25, 18-22 or 18-20.

[0122] Preferably the alginate oligomer of the invention is substantially free, preferably essentially free, of alginate oligomers having a degree of polymerisation outside of the ranges disclosed herein. This may be expressed in terms of the molecular weight distribution of the alginate oligomer of the invention, e.g. the percentage of each mole of the alginate oligomer being used in accordance with the invention which has a DP outside the relevant range. The molecular weight distribution is preferably such that no more than 10%, preferably no more than 9, 8, 7, 6, 5, 4, 3, 2, or 1% mole has a DP of three, two or one higher than the relevant upper limit for DPn. Likewise it is preferred that no more than 10%, preferably no more than 9, 8, 7, 6, 5, 4, 3, 2, or 1 % mole has a DP below a number three, two or one smaller than the relevant lower limit for DPn.

[0123] Suitable alginate oligomers are described in W02007 / 039754, W02007 / 039760, WO 2008 / 125828, and W02009 / 068841 , the disclosures of which are explicitly incorporated by reference herein in their entirety.

[0124] Representative suitable alginate oligomers have a DPnin the range 5 to 30, a guluronate / galacturonate fraction (FG) of at least 0.80, a mannuronate fraction (FM) of no more than 0.20, and at least 95 mole% of DP no more than 25.

[0125] Further suitable alginate oligomers have a number average degree of polymerization in the range 7 to 15 (preferably 8 to 12), a guluronate / galacturonate fraction (FG) of at least 0.85 (preferably at least 0.90), a mannuronate fraction (FM) of no more than 0.15 (preferably no more than 0.10), and having at least 95% mole with a degree of polymerization less than 17 (preferably less than 14).

[0126] Further suitable alginate oligomers have a number average degree of polymerization in the range 5 to 18 (especially 7 to 15), a guluronate / galacturonate fraction (FG) of at least 0.80 (preferably at least 0.85, especially at least 0.92), a mannuronate fraction (FM) of no more than 0.20 (preferably no more than 0.15, especially no more than 0.08), and having at least 95% mole with a degree of polymerization less than 20 (preferably less than 17). Further suitable alginate oligomers have a number average degree of polymerization in the range 5 to 18, a guluronate / galacturonate fraction (FG) of at least 0.92, a mannuronate fraction (FM) of no more than 0.08, and having at least 95% mole with a degree of polymerization less than 20.

[0127] Further suitable alginate oligomers have a number average degree of polymerization in the range 5 to 18 (preferably 7 to 15, more preferably 8 to 12, especially about 10), a guluronate / galacturonate fraction (FG) of at least 0.80 (preferably at least 0.85, more preferably at least 0.90, especially at least 0.92, most especially at least 0.95), a mannuronate fraction (FM) of no more than 0.20 (preferably no more than 0.15, more preferably no more than 0.10, especially no more than 0.08, most especially no more than 0.05), and having at least 95% mole with a degree of polymerization less than 20 (preferably less than 17, more preferably less than 14).

[0128] Further suitable alginate oligomers have a number average degree of polymerization in the range 7 to 15 (preferably 8 to 12), a guluronate / galacturonate fraction (FG) of at least 0.92 (preferably at least 0.95), a mannuronate fraction (FM) of no more than 0.08 (preferably no more than 0.05), and having at least 95% mole with a degree of polymerization less than 17 (preferably less than 14).

[0129] Further suitable alginate oligomers have a number average degree of polymerization in the range 5 to 18, a guluronate / galacturonate fraction (FG) of at least 0.80, a mannuronate fraction (FM) of no more than 0.20, and having at least 95% mole with a degree of polymerization less than 20.

[0130] Further suitable alginate oligomers have a number average degree of polymerization in the range 7 to 15, a guluronate / galacturonate fraction (FG) of at least 0.85, a mannuronate fraction (FM) of no more than 0.15, and having at least 95% mole with a degree of polymerization less than 17.

[0131] Further suitable alginate oligomers have a number average degree of polymerization in the range 7 to 15, a guluronate / galacturonate fraction (FG) of at least 0.92, a mannuronate fraction (FM) of no more than 0.08, and having at least 95% mole with a degree of polymerization less than 17. Further suitable alginate oligomers have a number average degree of polymerization in the range 5 to 20, a guluronate fraction (FG) of at least 0.85 and a mannuronate fraction (FM) of no more than 0.15.

[0132] It will thus be seen that a particular class of alginate oligomers favoured according to the present invention is alginate oligomers defined as so-called "high G" or "G-block" oligomers i.e. having a high content of G residues or G-blocks (e.g. wherein at least 70% of the monomer residues are G, preferably arranged in G-blocks). However, other types of alginate oligomer may also be used, including in particular "high M" or "M-block" oligomers or MG-block oligomers, as described further below. Accordingly, it is alginate oligomers with high proportions of a single monomer type, and with said monomers of this type being present predominantly in contiguous sequences of that monomer type, that represent oligomers that are particularly preferred, e.g. oligomers wherein at least 70% of the monomer residues in the oligomer are G residues linked 1-4 to another G-residue, or more preferably at least 75%, and most preferably at least 80, 85, 90, 92, 93, 94, 95, 96, 97, 98, 99% of the monomers residues of the oligomer are G residues linked 1-4 to another G residue. This 1-4 linkage of two G residues can be alternatively expressed as a guluronic unit bound to an adjacent guluronic unit.

[0133] In a further embodiment at least, or more particularly more than, 50% of the monomer residues of the alginate oligomer may be M residues (i.e. mannuronate or mannuronic acid). In other words, the alginate oligomer will contain at least or alternatively more than 50% mannuronate (or mannuronic acid) residues. Specific embodiments thus include alginate oligomers with (e.g. containing) 50 to 70% M (mannuronate) residues or e.g. 70 to 100% M (mannuronate) residues. Further specific embodiments also include oligomers containing 71 to 85% M residues or 85 to 100% M residues. Thus, a representative alginate oligomer for use according to this embodiment of the present invention will contain more than 70% M residues (i.e. more than 70% of the monomer residues of the alginate oligomer will be M residues).

[0134] In other embodiments at least 50% or 60%, more particularly at least 70% or 75%, even more particularly at least 80, 85, 90, 95 or 99% of the monomer residues are mannuronate. In one embodiment the alginate oligomer may be an oligomannuronate (i.e. a homooligomer of M, or 100% M). In a further embodiment, the above described alginates of the invention have a primary structure wherein the majority of the M residues are in so called M-blocks. In this embodiment preferably at least 50%, more preferably at least 70 or 75%, and most preferably at least 80, 85, 90 or 95% of the M residues are in M-blocks. An M block is a contiguous sequence of at least two M residues, preferably at least 3 contiguous M residues, more preferably at least 4 or 5 contiguous M residues, most preferably at least 7 contiguous M residues.

[0135] In particular, at least 90% of the M residues are linked 1-4 to another M residue. More particularly at least 95%, more preferably at least 98%, and most preferably at least 99% of the M residues of the alginate are linked 1-4 to another M residue.

[0136] Other preferred oligomers are alginate oligomers wherein at least 70% of the monomer residues in the oligomer are M residues linked 1-4 to another M-residue, or more preferably at least 75%, and most preferably at least 80, 85, 90, 92, 93, 94, 95, 96, 97, 98, 99% of the monomers residues of the oligomer are M residues linked 1-4 to another M residue. This 1-4 linkage of two M residues can be alternatively expressed as a mannuronic unit bound to an adjacent mannuronic unit.

[0137] In a still further embodiment, the alginate oligomers of the invention comprise a sequence of alternating M and G residues. A sequence of at least three, preferably at least four, alternating M and G residues represents an MG block. Preferably the alginate oligomers of the invention comprise an MG block. Expressed more specifically, an MG block is a sequence of at least three contiguous residues consisting of G and M residues and wherein each non-terminal (internal) G residue in the contiguous sequence is linked 1-4 and 4-1 to an M residue and each non-terminal (internal) M residue in the contiguous sequence is linked 1-4 and 4-1 to a G residue. Preferably the MG block is at least 5 or 6 contiguous residues, more preferably at least 7 or 8 contiguous residues.

[0138] In a further embodiment the minority uronate in the alginate oligomer (i.e. mannuronate or guluronate) is found predominantly in MG blocks. In this embodiment preferably at least 50%, more preferably at least 70 or 75% and most preferably at least 80, 85, 90 or 95% of the minority uronate monomers in the MG block alginate oligomer are present in MG blocks. In another embodiment the alginate oligomer is arranged such that at least 50%, at least 60%, at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99%, e.g. 100% of the G and M residues in the oligomer are arranged in MG blocks.

[0139] Although at its broadest, the invention extends to embodiments wherein at least 1% but less than 100% of the monomer residues of the oligomer are G residues (i.e. guluronate or guluronic acid), more particularly, and as defined further below, at least 30% of the monomer residues are G residues. Thus, at its broadest the MG block containing alginate oligomer may contain at least 1%, but less than 100%, guluronate (or guluronic acid) residues, but generally the MG block containing alginate oligomer will contain at least 30% (or at least 35, 40 or 45% or 50% G) but less than 100% G. Specific embodiments thus include MG block containing alginate oligomers with (e.g. containing) 1 to 30% G (guluronate) residues, 30 to 70% G (guluronate) residues or 70 to 99% G (guluronate) residues. Thus, a representative MG block containing alginate oligomer for use according to the present invention may contain more than 30%, but less than 70%, G residues (i.e. more than 30%, but less than 70%, of the monomer residues of the MG block alginate oligomer will be G residues).

[0140] Preferably more than 30%, more particularly more than 35% or 40%, even more particularly more than 45, 50, 55, 60 or 65%, but in each case less than 70%, of the monomer residues of the MG block containing alginate oligomer are guluronate. Alternatively, less than 70%, more preferably less than 65% or 60%, even more preferably less than 55, 50, 45, 40 or 35%, but in each case more than 30% of the monomer residues of the MG block containing alginate oligomer are guluronate. Any range formed by any combination of these values may be chosen. Therefore for instance the MG block containing alginate oligomer can have e.g. between 35% and 65%, 40% and 60% or 45% and 55% G residues.

[0141] In another embodiment the MG block containing alginate oligomer may have approximately equal amounts of G and M residues (e.g. ratios between 65% G / 35% M and 35% G / 65% M, for instance 60% G / 40% M and 40% G / 60% M; 55% G / 45% M and 45% G / 55% M; 53% G / 47% M and 47% G / 53% M; 51% G / 49% M and 49% G / 51% M; e.g. about 50% G and about 50% M) and these residues are arranged predominantly, preferably entirely or as completely as possible, in an alternating MG pattern (e.g. at least 50% or at least 60, 70, 80, 85, 90 or 95% or 100% of the M and G residues are in an alternating MG sequence). In certain embodiments the terminal uronic acid residues of the oligomers of the invention do not have a double bond, especially a double bond situated between the C4 and C5 atom. Such oligomers may be described as having saturated terminal uronic acid residues. Thus, in other embodiments the alginate oligomers of the invention have unsaturated terminal uronic acid residues. The skilled man would be able to prepare oligomers with saturated terminal uronic acid residues without undue burden. This may be through the use of production techniques which yield such oligomers, or by converting (saturating) oligomers produced by processes that yield oligomers with unsaturated terminal uronic acid residues.

[0142] As noted above, the monomeric residues in the alginate oligomer, may be the same or different and not all need carry electrically charged groups although it is preferred that the majority (e.g. at least 60%, preferably at least 80% more preferably at least 90%) do. It is preferred that a substantial majority, e.g. at least 80%, more preferably at least 90% of the charged groups have the same polarity. In the alginate oligomer, the ratio of hydroxyl groups to charged groups is preferably at least 2:1, more especially at least 3:1.

[0143] The alginate oligomer will typically carry a charge and so counter ions for the alginate oligomer may be any physiologically tolerable ion, especially those commonly used for charged drug substances, e.g. sodium, potassium, ammonium, chloride, mesylate, meglumine, etc. Ions which promote alginate gelation e.g. group 2 metal ions may also be used. Others may include the salt-forming ions mentioned below in the context of the therapeutic polypeptide.

[0144] While the alginate oligomer may be a synthetic material generated from the polymerisation of appropriate numbers of guluronate and mannuronate residues, the alginate oligomers of use in the invention may conveniently be obtained, produced or derived from natural sources such as those mentioned above, namely natural alginate source materials.

[0145] Polysaccharide to oligosaccharide cleavage to produce the alginate oligomer useable according to the present invention may be performed using conventional polysaccharide lysis techniques such as enzymatic digestion and acid hydrolysis. In one favoured embodiment acid hydrolysis is used to prepare the alginate oligomers on the invention. In other embodiments enzymic digestion is used with an additional processing step(s) to saturate the terminal uronic acids in the oligomers.

[0146] Oligomers may then be separated from the polysaccharide breakdown products chromatographically using an ion exchange resin or by fractionated precipitation or solubilisation or filtration. US 6,121 ,441 and WO 2008 / 125828, which are explicitly incorporated by reference herein in their entirety, describe a process suitable for preparing the alginate oligomers of use in the invention. Further information and discussion can be found in for example in “Handbooks of Hydrocolloids”, Ed. Phillips and Williams, ORC, Boca Raton, Florida, USA, 2000, which textbook is explicitly incorporated by reference herein in its entirety.

[0147] The alginate oligomers may also be chemically modified, including but not limited to modification to add charged groups (such as carboxylated or carboxymethylated glycans) and alginate oligomers modified to alter flexibility (e.g. by periodate oxidation).

[0148] Alginate oligomers (for example oligoguluronic acids) suitable for use according to the invention may conveniently be produced by acid hydrolysis of alginic acid from, but not limited to, Laminaria hyperbora and Lessonia nigrescens, dissolution at neutral pH, addition of mineral acid reduce the pH to 3.4 to precipitate the alginate oligomer (oligoguluronic acid), washing with weak acid, resuspension at neutral pH and freeze drying.

[0149] The alginates for production of alginate oligomers of the invention can also be obtained directly from suitable bacterial sources e.g. Pseudomonas aeruginosa or Azotobacter vinelandii.

[0150] In embodiments where alginate oligomers which have primary structures in which the majority of the G residues are arranged in G-blocks rather than as single residues are required, algal sources are expected to be most suitable on account of the fact that the alginates produced in these organisms tend to have these structures. The bacterial sources may be more suitable for obtaining alginate oligomers of different structures.

[0151] The molecular apparatus involved in alginate biosynthesis in Pseudomonas fluorescens and Azotobacter vinelandii has been cloned and characterised (WO 94 / 09124; Ertesvag, H., et al, Metabolic Engineering, 1999, Vol 1 , 262-269; WO 2004 / 011628; Gimmestad, M., et al (supra)-, Remminghorst and Rehm, Biotechnology Letters, 2006, Vol 28, 1701-1712; Gimmestad, M. et al, Journal of Bacteriology, 2006, Vol 188(15), 5551-5560).

[0152] The G content of alginates (for example an algal source material) can be increased by epimerisation, for example with mannuronan C-5 epimerases from A. vinelandii or other epimerase enzymes. Thus, for example in vitro epimerisation may be carried out with isolated epimerases from Pseudomonas or Azotobacter, e.g. AlgG from Pseudomonas fluorescens or Azotobacter vinelandii or the AlgE enzymes (AlgE1 to AlgE7) from Azotobacter vinelandii. The use of epimerases from other organisms that have the capability of producing alginate, particularly algae, is also specifically contemplated. The in vitro epimerisation of low G alginates with Azotobacter vinelandii AlgE epimerases is described in detail in Ertesvag et al (supra) and Strugala et al (Gums and Stabilisers for the Food Industry, 2004, 12, The Royal Society of Chemistry, 84 - 94).

[0153] To obtain G-block containing alginates or alginate oligomers, epimerisation with one or more Azotobacter vinelandii AlgE epimerases other than AlgE4 is preferred as these enzymes are capable of producing G block structures. On the other hand AlgE4 epimerase can be used to create alginates or alginate oligomers with alternating stretches of M / G sequence or primary structures containing single G residue as it has been found that this enzyme seems preferentially to epimerise individual M residues so as to produce single G residues linked to M residues rather than producing G blocks. Particular primary structures can be obtained by using different combinations of these enzymes.

[0154] Mutated versions of these enzymes or homologues from other organisms are also specifically contemplated as of use. WO 94 / 09124 describes recombinant or modified mannuronan C-5 epimerase enzymes (AlgE enzymes) for example encoded by epimerase sequences in which the DNA sequences encoding the different domains or modules of the epimerases have been shuffled or deleted and recombined. Alternatively, mutants of naturally occurring epimerase enzymes, (AlgG or AlgE) may be used, obtained for example by site directed or random mutagenesis of the AlgG or AlgE genes.

[0155] A different approach is to create Pseudomonas and Azotobacter organisms that are mutated in some or all of their epimerase genes in such a way that those mutants produce alginates of the required structure for subsequent alginate oligomer production, or even alginate oligomers of the required structure and size (or molecular weight). The generation of a number of Pseudomonas fluorescens organisms with mutated AlgG genes is described in detail in WO 2004 / 011628 and Gimmestad, M., et al, 2003 (supra). The generation of a number of Azotobacter vinelandii organisms with mutated AlgE genes is disclosed in Gimmestad, M., et al, 2006 (supra). The skilled man would be able to use this teaching to produce new mutants that could be used to give rise to the alginate oligomers of the invention without undue burden.

[0156] A further approach is to delete or inactivate the endogenous epimerase genes from an Azotobacter or a Pseudomonas organism and then to introduce one or more exogenous epimerase genes, which may or may not be mutated (i.e. may be wild-type or modified) and the expression of which may be controlled, for example by the use of inducible or other "controllable promoters". By selecting appropriate combinations of genes, alginates of predetermined primary structure can be produced.

[0157] A still further approach would be to introduce some or all of the alginate biosynthesis machinery of Pseudomonas and / or Azotobacter into a non-alginate producing organism (e.g. E. coll) and to induce the production of alginate from these genetically modified organisms.

[0158] When these culture-based systems are used, the primary structure of the alginate or alginate oligomer products can be influenced by the culture conditions. It is well within the capabilities of the skilled man to adjust culture parameters such as temperature, osmolarity, nutrient levels / sources and atmospheric parameters in order to manipulate the primary structure of the alginates produced by a particular organism.

[0159] References to "G residues / G" and "M residues / M" or to guluronic acid or mannuronic acid, or guluronate or mannuronate are to be read interchangeably as references to guluronic acid / guluronate and mannuronic acid / mannuronate (specifically a-L-guluronic acid / guluronate and p-D-mannuronic acid / mannuronate), and further include derivatives thereof in which one or more available side chains or groups have been modified without resulting in a capacity to increase systemic bioavailability, gastric uptake, absorption from the stomach, increased absorption from the stomach, improved effectiveness of the therapeutic polypeptide or treatment or prevention of a disease or condition or complication thereof which is responsive to the therapeutic polypeptide) that is substantially lower than that of the unmodified oligomer. Common saccharide modifying groups would include acetyl, sulphate, amino, deoxy, alcohol, aldehyde, ketone, ester and anhydro groups. Any of these groups may be used to modify the alginate oligomers according to the present invention. The alginate oligomers may also be chemically modified to add charged groups (such as carboxylated or carboxymethylated glycans), and to alter flexibility (e.g. by periodate oxidation). The skilled person would be aware of still further chemical modifications that can be made to the monosaccharide subunits of oligosaccharides and these can be applied to the alginate oligomers of the invention. In other embodiments the alginate oligomers are unmodified, i.e. consist of unmodified G and / or M residues.

[0160] The invention encompasses the use of a single alginate oligomer or a mixture (multiplicity / plurality) of different alginate oligomers. Thus, the methods, uses and compositions of the invention may involve at least one, or one or more, alginate oligomers. Thus, for example, a combination of different alginate oligomers (e.g. two, three, four, five or more) may be used. In this regard, a combination of alginate oligomers may be selected that together give a profile of properties advantageous to the practice of the invention. This may be a combination of different oligomer sizes, different G and M contents and / or different monomer arrangements. References herein to “an” or “the” alginate oligomer should be construed as extending to such embodiments, unless context specifically dictates otherwise. In particular, compositions described herein as “consisting of’ a set of components of which “an alginate oligomer” is one, include combinations of alginate oligomers as that aforementioned component.

[0161] In certain embodiments the alginate oligomer is not an alginate which acts as a gastrointestinal epithelial barrier (epithelium) permeation enhancer in the stomach of the subject. In certain embodiments the alginate oligomer is not an alginate which acts as a gastrointestinal epithelial barrier (epithelium) permeation enhancer in any part of the Gl tract of the subject.

[0162] The therapeutic polypeptide, which term includes therapeutic proteins and therapeutic peptides, polypeptide therapeutic agents and polypeptide therapeutics and the like, may be any peptide or polypeptide capable or exerting a therapeutic effect in an animal subject, either directly or indirectly. The polypeptide can therefore be an activator of a signalling pathway that results in physiological effects, or may be a mediator of such a pathway through effects on the intermediates of such pathways. The polypeptide can exert effects by promoting or interfering with physiological reactions or interaction between biological molecules in the subject, or may be an enzyme which can promote physiological effects through its activity on the components of the cells of the subject or the biological molecules therein. This is not an exhaustive list.

[0163] The polypeptide, which term includes peptides, oligopeptides and proteins, may be a polypeptide found naturally in the subject or other animals or may be a fragment, analogue and / or derivative thereof. The polypeptide may be an artificial construct comprising naturally occurring amino acid sequences or fragments thereof, or man-made amino acid sequences. The amino acid units may be those found in naturally occurring proteins, or may be artificial amino acids or modified forms of natural amino acids, e.g. D forms. The polypeptide may be a protein with a natural physiological functional or comprise an amino acid sequence that has other biological effects when introduced into physiological systems, e.g. an antigen. Antigens may be from parasitic or infective species optionally conjugated to an immunogenic carrier. Such species may for example be bacteria, viruses, yeasts or fungi.

[0164] The therapeutic polypeptide may be of any size, though typically it will be of at least 500 Da, e.g. at least 750 Da, 1 kDa, 1.5 kDa, 2 kDa, 5kDa, 10 kDa, 20 kDa, 50kDa or 100 kDa. In other embodiments it will be less than 2 MDa, e.g. less than 1.5MDa, 1 MDa, 500kDa, or 200 kDa. Any range with endpoints constructed from any of these values is expressly contemplated.

[0165] Thus, the therapeutic polypeptide may be, or be an analogue of, peptide hormones / growth factors (e.g. insulin, glucagon, glucagon-like peptide-1, somatostatin, angiotensin II endothenlin, gastrin, growth hormone, gonadotrophin, erythropoietin, colony-stimulating factors (e.g. G-CSF), VEGF, EGF, HGF, PDGF, FGF, neurotrophins (e.g. nerve growth factor (NGF), brain-derived neurotrophic factor (BDNF), neurotrophin-3, neurotrophin-4), cytokines (e.g. TNF, IL-1, IL-6, IL-8, IL-10, IFN-y, IFN-a, IFN-p, IFN-E, IFN-K and IFN-w)), blood factors (e.g. Factor VII, Factor VIII and Factor IX), and enzymes (e.g. glucocerebrosidases, Cas9, Cas 12, Cas 13). The amino acid sequences for such peptides are available from the technical literature. Further specific examples include adrenocorticotropic hormone (ACTH), corticotropinreleasing factor, angiotensin, calcitonin, insulin, glucagon, glucagon-like peptide-1, glucagon-like peptide-2, insulin-like growth factor, insulin-like growth factor-2, gastric inhibitory peptide, growth hormone releasing factor, pituitary adenylate cyclase activating peptide, secretin, enterogastrin, somatostatin, somatotropin, somatomedin, parathyroid hormone, thrombopoietin, follicle-stimulating hormone, erythropoietin, hypothalamic releasing factors, prolactin, thyroid stimulating hormones, endorphins, enkephalins, vasopressin, oxytocin, interferon, and analogues thereof, superoxide dismutase, Cas9, Cas 12, Cas 13, asparaginase, arginase, arginine deaminase, adenosine deaminase and ribonuclease. In certain embodiments the therapeutic polypeptide is not angiotensin, calcitonin, insulin, insulin-like growth factor, or insulin-like growth factor-2.

[0166] In certain embodiments the polypeptide therapeutic agent is not lysozyme, or a lysosome derived polypeptide, or a lysosome, or another enzyme, e.g. L-asparagase.

[0167] In other embodiments the polypeptide may be or comprise an immunoglobulin amino acid sequence, e.g. an amino sequence derived from IgG, IgA, IgM, IgE, or IgD. The immunoglobulin amino acid sequence may be a fragment, e.g. Fc, Fv, Fab, Fab2, scFV, and variations. In certain embodiments the therapeutic polypeptide may be a therapeutic antibody, in particular a monoclonal antibody. Examples of therapeutic antibodies include alemtuzumab, bevacizumab, cetuximab, ofatumumab, panitumumab, rituximab, trastuzumab, ipilimumab, nivolumab, pembrolizumab, atezolizumab, avelumab, durvalumab, cemiplimab, sutimlimab, anifrolumab, bimekizumab, tralokinumab, evinacumab, aducanumab, ansuvimab, atoltivimab, teprotumumab, eptinezumab, crizanlizumab, brolucizumab, risankizumab, romosozumab, galcanezumab, erenumab, ibalizumab, emicizumab, benralizumab, ocrelizumab, sarilumab, dupilumab, bezlotoxumab, ixekizumab, alirocumab, vedolizumab, tocilizumab, canakinumab, infliximab, adalimumab, omalizumab, efalizumab, golimumab, ustekinumab, certolizumab pegol, ibritumomab or tositumomab.

[0168] In other embodiments the polypeptide may be a polypeptide antibiotic, e.g. anti-infective and antitumor antibiotics, examples of which include actinomycin, gramicidin, tyrocidine, bleomycin, bacitracin, colistin, and polymyxin B. In other embodiments the polypeptide may be an antimicrobial peptide or protein, e.g. a host defence peptide or an innate immune peptide. Such peptides are natural or synthetic peptides that have antibacterial, antiviral, antifungal and / or antiparasitic activity. Natural examples may be found in the Antimicrobial Peptide Database hosted by the University of Nebraska Medical Center (aps.unmc.edu / home).

[0169] The term “polypeptide therapeutic agent” and the like encompasses peptides which carry a non-peptide chemical group, e.g. a carbohydrate, lipid, nucleic acid or polyol group. In certain embodiments the polypeptide may be an acylated or PEGylated polypeptide, e.g. an acylated or PEGylated form of any of those disclosed above which is designed to have an increased plasma half-life.

[0170] In further embodiments the polypeptide may be a fusion or chimeric protein of two or more polypeptides or fragments thereof, e.g. any of the specific examples thereof fused to albumin or Fc, or fragments thereof which increase plasma half-life.

[0171] In certain specific embodiments the therapeutic polypeptide may be an incretin peptide or analogue / mimetic thereof, e.g. glucagon, glucagon-like protein 1, gastric inhibitory peptide (glucose-dependent insulinotropic polypeptide (GIP)) and exendin-4 peptide. Incretins are a group of metabolic hormones that stimulate a decrease in blood glucose levels. Incretins are released after eating and augment the secretion of insulin released from pancreatic beta cells of the islets of Langerhans by a blood glucose-dependent mechanism. Such peptides or analogues / mimetics thereof may be considered as agonists for the glucagon receptor, the glucose-dependent insulinotropic polypeptide (GIP) receptor and / or the and glucagon-like peptide- 1 (GLP-1) receptor. In certain embodiments, the therapeutic polypeptide may be dual incretin peptide mimetic compound that is an agonist for the receptors for GIP and GLP-1. The therapeutic polypeptide may be a triple incretin peptide mimetic compound that is an agonist for the receptors for GIP, GLP-1 , and glucagon. In more preferred embodiments the polypeptide is an agonist for the human forms of the above receptors.

[0172] Thus, in certain specific embodiments the therapeutic polypeptide may be dulaglutide (Trulicity), exenatide (Byetta), liraglutide (Victoza), semaglutide (Ozempic, Wegovy and Rybelsus), tirzepatide (Mounjaro), albiglutide (Eperzan / Tanzeum), lixisenatide (Lyxumia / Adlyxin), polyethylene glycol loxenatide (Fulaimei) and LY3437943 (retatrutide). Likewise, in certain specific embodiments the therapeutic polypeptide may be cotadutide; taspoglutide; langlenatide; beinaglutide; efpeglenatide; LY3502970 (Eli Lilly); LY3537031 (Eli Lilly); LY3493269 (Eli Lilly); HM12525A / JNJ-64565111 (Efmopegdutide; Hanmi Pharmaceuticals); MOD6030 / 1; Prolor / OPKO Biological); SAR425899 (Sanofi);

[0173] MEDI0382 (Medlmmune); MK8521 (Merck); ZP2929 / BI 456906 (Zealand-Boehringer); NN9709 / NNC0090-2746 / MAR709 / RG7697 / R06811135 (Novo Nordisk); SAR441255 (Sanofi); C2816 (Medimmune); ZP3022 (Zealand); NNC 9204-1177 (NN9277) (Novo Nordisk); LY3305677 (Eli Lilly); JNJ-54728518 (Janssen); LY2944876 / TT-401 (Transition Therapeutics); CPD86 (Eli Lilly); SAR438335 (Sanofi); ZP-l-98 (Zealand); ZP-DI-70 (Zealand); HM15211 (Hanmi Pharmaceuticals); NN9423 / MAR423 (Novo Nordisk / Marcadia), PB-719 (PegBio); and DD01 (D&D Pharma).

[0174] In certain specific embodiments the therapeutic polypeptide may be the incretin analogues disclosed in WO 2019 / 125929 and WO2019125938, which are incorporated herein by reference.

[0175] In certain specific embodiments the therapeutic polypeptide may be an oxyntomodulin peptide or analogue / mimetic thereof, e.g. mazdutide (LY3305677).

[0176] In certain specific embodiments the therapeutic polypeptide may be any one of the polypeptide incretin analogues referred to in WO 2015 / 185640, WO 2015 / 086733, WO 2015 / 155139, WO 2013 / 164483 or WO 2015 / 086728, which are incorporated herein by reference.

[0177] In certain specific embodiments the therapeutic polypeptide may be any one of the polypeptide incretin analogues referred to in WO 93 / 19175, WO 96 / 29342, WO 98 / 08871, WO 99 / 43707, WO 99 / 43706, WO 99 / 43341, WO 99 / 43708, WO 2005 / 027978, WO 2005 / 058954, WO 2005 / 058958, WO 2006 / 005667, WO 2006 / 037810, WO 2006 / 037811, WO 2006 / 097537, WO 2006 / 097538, WO 2008 / 023050, WO 2009 / 030738, WO 2009 / 030771 , or WO 2009 / 030774, each of which is incorporated herein by reference.

[0178] The polypeptide therapeutic may be a fusion protein formed of any of the polypeptides, especially the incretin analogues, referred to herein. In these embodiments the methods of the invention may be directed to the treatment of any disease / disorder involving GLP-1 , GIP or glucagon (including any disease / disorder involving, or mediated by, a deficiency of GLP-1 , GIP or glucagon or deficient GLP-1 , GIP or glucagon signalling). Thus, in these embodiments, the methods of the invention may be directed to the treatment of excess body weight, obesity, diabetes mellitus type II, insulin resistance, prediabetes, gestational diabetes, diabetes mellitus type I, hyperlipemia, metabolic syndrome, cardiovascular diseases (including atherosclerosis, myocardial infarction, coronary heart disease, stroke, heart insufficiency, heart failure (acute or chronic), coronary artery disease, cardiomyopathy, reperfusion injury, cerebral ischemia, left ventricular hypertrophy, arrhythmia, cardiac dysrhythmia, syncope, angina pectoris, stenosis, or restenosis coronary artery diseases), hypertension, fatty liver disease, non-alcoholic steatohepatitis (NASH), chronic kidney disease and polycystic ovary syndrome (PCOS), neuronal dysfunction (e.g. dementia, Alzheimer’s and Parkinson’s Diseases), and to the treatment of conditions and complications associated with (attributed to / caused by) such disorders.

[0179] Common side effects observed with polypeptide incretin analogues may be nausea, vomiting, diarrhoea, abdominal pain and constipation. These effects might be reduced in accordance with the invention because the invention is expected to allow the use of lower doses.

[0180] GIP is a 42-amino acid gastrointestinal regulatory peptide that plays a physiological role in glucose homeostasis by stimulating insulin secretion from pancreatic beta cells in the presence of glucose and protecting pancreatic beta cells. GLP-1 is a 37- amino acid peptide that stimulates insulin secretion, protects pancreatic beta cells, and inhibits glucagon secretion, gastric emptying and food intake which leads to weight loss. GIP and GLP-1 are known as incretins; incretin receptor signalling exerts physiologically relevant action critical for glucose homeostasis. In normal physiology, GIP and GLP-1 are secreted from the gut following a meal, and these incretins enhance the physiological response to food including sensation of satiety, insulin secretion, and nutrient disposal. T2D patients have impaired incretin responses.

[0181] Human GLP-1 is a 37 amino acid residue peptide originating from preproglucagon which is synthesised inter alia in the L-cells in the distal ileum, in the pancreas and in the brain. Human GLP-1 (7-37) has the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG. Processing of preproglucagon to give GLP-1 (7-36)amide, GLP-1(7-37) and GLP-2 occurs mainly in the L-cells. A simple system is used to describe fragments and analogues of this peptide. Thus, for example, Gly8-GLP-1(7-37) designates a fragment of GLP-1 formally derived from GLP-1 by deleting the amino acid residues Nos. 1 to 6 and substituting the naturally occurring amino acid residue in position 8 (Ala) by Gly. Similarly, Lys34(N£- tetradecanoyl)-GLP-1 (7-37) designates GLP-1 (7-37) wherein the e-amino group of the Lys residue in position 34 has been tetradecanoylated. Where reference in this text is made to C-terminally extended GLP1 analogues, the amino acid residue in position 38 is Arg unless otherwise indicated, the optional amino acid residue in position 39 is also Arg unless otherwise indicated and the optional amino acid residue in position 40 is Asp unless otherwise indicated. Also, if a C-terminally extended analogue extends to position 41, 42, 43, 44 or 45, the amino acid sequence of this extension is as in the corresponding sequence in human preproglucagon unless otherwise indicated. Likewise for N-terminally extended GLP1 analogues the amino acid sequence of this extension is as in the corresponding sequence in human preproglucagon.

[0182] The term "GLP-1 agonist" as used herein refers to a compound, which fully or partially activates the human GLP-1 receptor, it is thus interchangeable with the term "GLP-1 receptor agonist". In some embodiments the "GLP-1 agonist" binds to a GLP-1 receptor, e.g., with an affinity constant (KD) or activate the receptor with a potency (ECso ) of below 1 pM, e.g. below 100 nM as measured by methods known in the art (see e.g. WO 98 / 08871) and exhibits insulinotropic activity, where insulinotropic activity may be measured in vivo or in vitro assays known to those of ordinary skill in the art. For example, the GLP-1 agonist may be administered to an animal with increased blood glucose (e.g. obtained using an Intravenous Glucose Tolerance Test (IVGTT), a person skilled in the art will be able to determine a suitable glucose dosage and a suitable blood sampling regime, e.g. depending on the species of the animal, for the IVGTT) and the plasma insulin concentration measured over time.

[0183] The terms "GIP agonist" and “glucagon agonist” may be interpreted analogously.

[0184] In some embodiments the GLP-1 agonist is a GLP-1 analogue, optionally comprising one substituent. The term "analogue" as used herein referring to a GLP-1 peptide (hereafter "peptide") means a peptide wherein at least one amino acid residue of the peptide has been substituted with another amino acid residue and / or wherein at least one amino acid residue has been deleted from the peptide and / or wherein at least one amino acid residue has been added to the peptide and / or wherein at least one amino acid residue of the peptide has been modified. Such addition or deletion of amino acid residues may take place at the N-terminal of the peptide and / or at the C-terminal of the peptide.

[0185] GLP-1 analogues include fusion proteins comprising one or more copies of GLP-1 , or substitution variants thereof, and one or more additional polypeptides, e.g. albumin. This includes albiglutide, a peptide consisting of 645 proteinogenic amino acids with 17 disulfide bridges linking amino acids 113-122, 135-151 , 150-161 , 184-229, 228-237, 260- 306, 305-313, 325-339, 338-349, 376-421 , 420-429, 452-498, 497-508, 521-537, 536- 547, 574-619, 618-627. Amino acids 1-30 and 31-60 constitute two copies of modified human GLP-1 , the alanine at position 2 having been exchanged for a glycine, and the remaining sequence encoding human albumin.

[0186] In some embodiments the GLP-1 agonist is a derivative of GLP-1 or a GLP-1 analogue. In the present text, the parent peptide from which such a derivative is formally derived is in some places referred to as the "GLP-1 moiety" of the derivative. The GLP-1 moiety may be a natural GLP-1 amino acid sequence, a fragment thereof, or an analogue of such amino acid sequences. The term "derivative" is used in the present context of GLP-1 peptides and analogues thereof to designate a peptide in which one or more of the amino acid residues of the parent peptide have been chemically modified, e.g. by alkylation, acylation, ester formation or amide formation.

[0187] In some embodiments the GLP-1 agonist is a derivative of exendin-4. This includes lixisenatide, a C-terminal amide modified peptide consisting of the first 39 amino acids in the sequence of Heloderma suspectum exendin-4 with the proline at position 38 omitted and six lysine residues added to the C terminus.

[0188] In some embodiments the GLP-1 agonist is a derivative of GIP. Human GIP has the sequence: YAEGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ

[0189] One such example is LY3437943 (retatrutide), a peptide consisting of 39 amino acids engineered from the amino acid sequence of human GIP with three non-coded amino acid substitutions ( Aib (a-amino isobutyric acid) at positions 2 and 20, and aMeL (a-methyl-L- leucine) at position 13) and a C20 fatty diacid moiety conjugated via an AEEA y Glu linker at the position 17 lysine residue (Coskun et al, Clinical and Translational Report; Volume 34 (9), 1234-1247; WO2019125938).

[0190] In certain specific embodiments the therapeutic polypeptide may be liraglutide and structurally related analogues thereof. Liraglutide has the structure of Formula I and as shown in Figure 16A

[0191] (Formula I)

[0192] In certain embodiments, the therapeutic polypeptide may be a GLP-1 derivative as described in WO 98 / 08871 , e.g. a GLP-1 derivative wherein at least one amino acid residue of the parent peptide has a lipophilic substituent attached with the proviso that if only one lipophilic substituent is present and this substituent is attached to the N-terminal or to the C-terminal amino acid residue of the parent peptide then this substituent is an alkyl group or a group which has an w-carboxylic acid group.

[0193] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative having only one lipophilic substituent.

[0194] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative having only one lipophilic substituent which substituent is an alkyl group or a group which has an w-carboxylic acid group and is attached to the N-terminal amino acid residue of the parent peptide.

[0195] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative having only one lipophilic substituent which substituent is an alkyl group or a group which has an w-carboxylic acid group and is attached to the C-terminal amino acid residue of the parent peptide. In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative having only one lipophilic substituent which substituent can be attached to any one amino acid residue which is not the N-terminal or C-terminal amino acid residue of the parent peptide.

[0196] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein two lipophilic substituents are present.

[0197] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein two lipophilic substituents are present, one being attached to the N-terminal amino acid residue while the other is attached to the C-terminal amino acid residue.

[0198] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein two lipophilic substituents are present, one being attached to the N-terminal amino acid residue while the other is attached to an amino acid residue which is not the N-terminal or the C-terminal amino acid residue.

[0199] In another embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein two lipophilic substituents are present, one being attached to the C-terminal amino acid residue while the other is attached to an amino acid residue which is not the N-terminal or the C-terminal amino acid residue.

[0200] In a further embodiment, the therapeutic polypeptide may be a derivative of GLP-1 (7-C), wherein C is selected from the group consisting of 38, 39, 40, 41 , 42, 43, 44 and 45 which derivative has just one lipophilic substituent which is attached to the C-terminal amino acid residue of the parent peptide.

[0201] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the lipophilic substituent comprises from 4 to 40 carbon atoms, e.g. from 8 to 25 carbon atoms.

[0202] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to an amino acid residue in such a way that a carboxyl group of the lipophilic substituent forms an amide bond with an amino group of the amino acid residue. In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to an amino acid residue in such a way that an amino group of the lipophilic substituent forms an amide bond with a carboxyl group of the amino acid residue.

[0203] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer.

[0204] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent, optionally via a spacer, is attached to the e-amino group of a Lys residue contained in the parent peptide.

[0205] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an unbranched alkane a, co-dicarboxylic acid group having 1 to 7 methylene groups, preferably two methylene groups which spacer forms a bridge between an amino group of the parent peptide and an amino group of the lipophilic substituent.

[0206] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an amino acid residue except Cys, or a dipeptide such as Gly-Lys. In the present text, the expression "a dipeptide such as Gly-Lys" is used to designate a dipeptide wherein the C- terminal amino acid residue is Lys, His or Trp, preferably Lys, and wherein the N-terminal amino acid residue is selected from the group consisting of Ala, Arg, Asp, Asn, Gly, Glu, Gin, He, Leu, Vai, Phe and Pro.

[0207] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an amino acid residue except Cys, or is a dipeptide such as Gly-Lys and wherein a carboxyl group of the parent peptide forms an amide bond with an amino group of a Lys residue or a dipeptide containing a Lys residue, and the other amino group of the Lys residue or a dipeptide containing a Lys residue forms an amide bond with a carboxyl group of the lipophilic substituent. In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an amino acid residue except Cys, or is a dipeptide such as Gly-Lys and wherein an amino group of the parent peptide forms an amide bond with a carboxylic group of the amino acid residue or dipeptide spacer, and an amino group of the amino acid residue or dipeptide spacer forms an amide bond with a carboxyl group of the lipophilic substituent.

[0208] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an amino acid residue except Cys, or is a dipeptide such as Gly-Lys and wherein a carboxyl group of the parent peptide forms an amide bond with an amino group of the amino acid residue spacer or dipeptide spacer, and the carboxyl group of the amino acid residue spacer or dipeptide spacer forms an amide bond with an amino group of the lipophilic substituent.

[0209] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein a lipophilic substituent is attached to the parent peptide by means of a spacer which is an amino acid residue except Cys, or is a dipeptide such as Gly-Lys, and wherein a carboxyl group of the parent peptide forms an amide bond with an amino group of a spacer which is Asp or Glu, or a dipeptide spacer containing an Asp or Glu residue, and a carboxyl group of the spacer forms an amide bond with an amino group of the lipophilic substituent.

[0210] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which comprises a partially or completely hydrogenated cyclopentanophenathrene skeleton.

[0211] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a straight-chain or branched alkyl group.

[0212] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is the acyl group of a straight-chain or branched fatty acid.

[0213] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is an acyl group selected from the group consisting of CH3(CH2)nCO-, wherein n is an integer from 4 to 38, preferably an integer from 4 to 24, e.g. selected from the group consisting of CH3(CH2)eCO-, CH3(CH2)sCO-, CH3(CH2)IOCO-, CH3(CH2)i2CO-, CH3(CH2)i4CO-, CH3(CH2)i6CO-, CH3(CH2)i8CO-, CH3(CH2)2OCO-, and CH3(CH2)22CO-,

[0214] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is an acyl group of a straight-chain or branched alkane a,w- dicarboxylic acid.

[0215] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is an acyl group selected from the group consisting of HOOC(CH2)mCO-, wherein m is an integer from 4 to 38, preferably an integer from 4 to 24, e.g. selected from the group consisting of HOOC(CH2)i4CO-, HOOC(CH2)i4CO-, HOOC(CH2)I6CO-, HOOC(CH2)I8CO-, HOOC(CH2)2OCO-, and HOOC(CH2)22CO-,

[0216] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula CH3(CH2)p((CH2)qCOOH)CHNHCO(CH2)2CO-, wherein p and q are integers and p+q is an integer of from 8 to 33, preferably from 12 to 28.

[0217] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula

[0218] CH3(CH2)rCONHCH(COOH)(CH2)2CO-, wherein r is an integer of from 10 to 24.

[0219] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula

[0220] CH3(CH2)SCONHCH((CH2)2COOH)CO-, wherein s is an integer of from 8 to 24.

[0221] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula COOH(CH2)tCO- wherein t is an integer of from 8 to 24.

[0222] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula -NHCH(COOH)(CH2)4NHCO(CH2)UCH3, wherein u is an integer of from 8 to 18. In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula -NHCH(COOH)(CH2)4NHCOCH((CH2)2COOH)NH-CO(CH2)WCH3, wherein w is an integer of from 10 to 16.

[0223] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula -NHCH(COOH)(CH2)4NHCO(CH2)2CH(COOH)NHCO(CH2)XCH3, wherein x is an integer of from 10 to 16.

[0224] In a further embodiment, the the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which is a group of the formula -NHCH(COOH)(CH2)4NHCO(CH2)2CH(COOH)NHCO(CH2)yCH3, wherein y is zero or an integer of from 1 to 22.

[0225] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative having a lipophilic substituent which can be negatively charged. Such a lipophilic substituent can for example be a substituent which has a carboxyl group.

[0226] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative the parent peptide of which is selected from the group consisting of GLP-1 (1-45) or an analogue thereof.

[0227] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative derived from a GLP-1 fragment selected from the group consisting of GLP-1 (7-35), GLP-1 (7-36), GLP-1 (7-36)amide, GLP-1 (7-37), GLP-1 (7-38), GLP-1 (7-39), GLP-1 (7-40) and GLP1 (7- 41) or an analogue thereof.

[0228] In a further embodiment, the therapeutic polypeptide may be a GLP-1 analogue derived from a GLP-1 analogue selected from the group consisting of GLP-1 (1-35), GLP-1 (1-36), GLP-1 (1-36)amide, GLP-1 (1-37), GLP-1 (1-38), GLP-1 (1-39), GLP-1 (1-40) and GLP-1(1- 41) or an analogue thereof. In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any a-amino acid residue.

[0229] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the designation analogue comprises derivatives wherein a total of up to fifteen, preferably up to ten amino acid residues have been exchanged with any a-amino acid residue which can be coded for by the genetic code.

[0230] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the designation analogue comprises derivatives wherein a total of up to six amino acid residues have been exchanged with another a-amino acid residue which can be coded for by the genetic code.

[0231] In a further embodiment, the therapeutic polypeptide may be a GLP-1 (A-B) derivative wherein A is an integer from 1 to 7 and B is an integer from 38 to 45 or an analogue thereof comprising one lipophilic substituent attached to the C-terminal amino acid residue and, optionally, a second lipophilic substituent attached to one of the other amino acid residues.

[0232] In a further embodiment, a parent peptide for a GLP-1 derivative of use in the invention is selected from the group consisting of Arg26-GLP-1 (7-37); Arg34-GLP- 1 (7-37); Lys36- GLP-1 (7-37); Arg26,34Lys36-GLP-1 (7-37); Arg26,34Lys38GLP-1 (7-38); Arg26,34Lys39- GLP-1 (7-39); Arg26,34Lys40-GLP- 1 (7-40); Arg26Lys36-GLP- 1 (7-37); Arg34Lys36-GLP- 1 (7-37); Arg26Lys39-GLP1 (7-39); Arg34Lys40-GLP- 1 (7-40); Arg26,34Lys36,39-GLP-1(7- 39); Arg26,34Lys36,40-GLP-1 (7-40); Gly8Arg26-GLP-1 (7-37); Gly8Arg34-GLP-1 (7-37); Gly8Lys36-GLP-1 (7-37); Gly8Arg26,34Lys36-GLP-1 (7-37); Gly8Arg26,34Lys39-GLP-1 (7- 39); Gly8Arg26,34Lys40-GLP-1 (7-40); Gly8Arg26Lys36-GLP- 1 (7-37); Gly8Arg34Lys36- GLP-1 (7-37); Gly8Arg26Lys39-GLP-1 (7-39); Gly8Arg34Lys40-GLP1 (7-40);

[0233] Gly8Arg26,34Lys36,39-GLP-1 (7-39) and Gly8Arg26,34Lys36,40-GLP-1 (7-40).

[0234] In a further embodiment, a parent peptide for a GLP-1 derivative of use in the invention is selected from the group consisting of Arg26,34Lys38GLP-1 (7-38); Arg26,34Lys39GLP- 1 (7-39); Arg26,34Lys40GLP-1 (7-40); Arg26,34Lys41 GLP-1 (7-41); Arg26,34Lys42GLP- 1 (7-42); Arg26,34Lys43GLP-1 (7-43); Arg26,34Lys44GLP-1 (7-44); Arg26,34Lys45GLP- 1(7-45); Arg26,34Lys38GLP-1(1-38); Arg26,34Lys39GLP-1(1-39); Arg26,34Lys40GLP- 1(1-40); Arg26,34Lys41GLP-1(1-41); Arg26,34Lys42GLP-1(1-42); Arg26,34Lys43GLP- 1(1-43); Arg26,34Lys44GLP-1(1-44); Arg26,34Lys45GLP-1(1-45); Arg26,34Lys38GLP- 1(2-38); Arg26,34Lys39GLP-1(2-39); Arg26,34Lys40GLP-1(2-40); Arg26,34Lys41GLP- 1(2-41); Arg26,34Lys42GLP-1(2-42); Arg26,34Lys43GLP-1(2-43); Arg26,34Lys44GLP- 1(2-44); Arg26,34Lys45GLP-1(2-45); Arg26,34Lys38GLP-1(3-38); Arg26,34Lys39GLP- 1(3-39); Arg26,34Lys40GLP-1(3-40); Arg26,34Lys41GLP-1(3-41); Arg26,34Lys42GLP- 1(3-42); Arg26,34Lys43GLP-1(3-43); Arg26,34Lys44GLP-1(3-44); Arg26,34Lys45GLP- 1(3-45); Arg26,34Lys38GLP-1(4-38); Arg26,34Lys39GLP-1(4-39); Arg26,34Lys40GLP- 1(4-40); Arg26,34Lys41 GLP-1 (4-41); Arg26,34Lys42GLP-1(4-42); Arg26,34Lys43GLP- 1(4-43); Arg26,34Lys44GLP-1(4-44); Arg26,34Lys45GLP-1(4-45); Arg26,34Lys38GLP- 1(5-38); Arg26,34Lys39GLP-1(5-39); Arg26,34Lys40GLP-1(5-40); Arg26,34Lys41GLP- 1(5-41); Arg26,34Lys42GLP-1(5-42); Arg26,34Lys43GLP-1(5-43); Arg26,34Lys44GLP- 1(5-44); Arg26,34Lys45GLP-1(5-45); Arg26,34Lys38GLP-1(6-38); Arg26,34Lys39GLP- 1(6-39); Arg26,34Lys40GLP-1(6-40); Arg26,34Lys41GLP-1(6-41); Arg26,34Lys42GLP- 1(6-42); Arg26,34Lys43GLP-1(6-43); Arg26,34Lys44GLP-1(6-44); Arg26,34Lys45GLP- 1(6-45); Arg26Lys38GLP1(1-38); Arg34Lys38GLP-1(1-38); Arg26,34Lys36,38GLP-1(1- 38); Arg26Lys38GLP- 1(7-38); Arg34Lys38GLP-1(7-38); Arg26,34Lys36,38GLP-1(7-38); Arg26, 34Lys38GLP- 1 (7-38) ; Arg26Lys39G LP1 (1-39) ; Arg34Lys39G LP- 1 (1-39) ;

[0235] Arg26,34Lys36,39GLP-1 (1-39); Arg26Lys39GLP-1 (7-39); Arg34Lys39GLP-1 (7-39) and Arg26,34Lys36,39GLP-1 (7-39).

[0236] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the parent peptide is selected from the group consisting of Arg26-GLP- 1(7-37), Arg34- GLP-1 (7-37), Lys36-GLP-1 (7-37), Arg26,34Lys36-GLP-1 (7-37), Arg26Lys36-GLP-1 (7-

[0237] 37), Arg34Lys36-GLP-1 (7-37), Gly6Arg26-GLP-1 (7-37), Gly8Arg34-GLP-1 (7-37), Gly8Lys36-GLP-1 (7- 37), Gly8Arg26,34Lys-GLP-1 (7-37), Giy8Arg26Lys36-GLP-1 (7-37) and Gly8Arg34Lys36-GLP-1 (7-37).

[0238] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the parent peptide is selected from the group consisting of Arg26Lys38-GLP- 1(7-38), Arg26,34Lys38-GLP-1 (7-38), Arg26,34Lys36,38-GLP-1 (7-38), Gly8Arg26Lys38-GLP-1 (7-

[0239] 38) and Gly8Arg26,34Lys36,38-GLP-1(7-38). In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the parent peptide is selected from the group consisting of Arg26Lys39-GLP- 1(7-39), Arg26,34Lys36,39-GLP-1 (7-39), Gly8Arg26Lys39-GLP-1 (7-39) and Gly8Arg26, 34Lys36, 39-G LP- 1 (7-39) .

[0240] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative wherein the parent peptide is selected from the group consisting of Arg34Lys40-GLP- 1(7-40), Arg26,34Lys36,40-GLP-1(7-40), Gly8Arg34Lys40-GLP-1(7-40) and Gly8Arg26,34Lys36,40-GLP-1(7-40),

[0241] In a further embodiment, the therapeutic polypeptide may be a GLP-1 derivative which is selected from the group consisting of:

[0242] Lys26(N£-tetradecanoyl)-G LP- 1 (7-37) ;

[0243] Lys34(N£-tetradecanoyl)-GLP-1 (7-37);

[0244] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-37);

[0245] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-37) ;

[0246] Gly8Lys34(N£-tetradecanoyl)-G LP- 1 (7-37) ;

[0247] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-37);

[0248] Arg26Lys34(N£-tetradecanoyl)-GLP-1(7-37);

[0249] Lys26(N£-tetradecanoyl)-G LP- 1 (7-38) ;

[0250] Lys34(N£-tetradecanoyl)-GLP-1 (7-38);

[0251] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-38);

[0252] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-38) ;

[0253] Gly8Lys34(N£-tetradecanoyl)-G LP- 1 (7-38) ;

[0254] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-38);

[0255] Arg26Lys34(N£-tetradecanoyl)-GLP-1(7-38);

[0256] Lys26(N£-tetradecanoyl)-GLP- 1(7-39);

[0257] Lys34(N£-tetradecanoyl)-GLP-1 (7-39);

[0258] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-39);

[0259] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-39) ;

[0260] GlyaLys34(N£-tetradecanoyl)-GLP-1 (7-39);

[0261] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-39);

[0262] Arg26Lys34(N£-tetradecanoyl)-GLP-1(7-39);

[0263] Lys26(N£-tetradecanoyl)-G LP- 1 (7-40) ; Lys34(N£-tetradeca noyl)-GLP-1 (7-40);

[0264] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-40);

[0265] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-40) ;

[0266] Gly8Lys34(N£-tetradecanoyl)-G LP- 1 (7-40) ;

[0267] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1 (7-40);

[0268] Arg26Lys34(N£-tetradecanoyl)-GLP-1 (7-40);

[0269] Lys26(N£-tetradecanoyl)-G LP- 1 (7-36) ;

[0270] Lys34(N£-tetradecanoyl)-G LP- 1 (7-36) ;

[0271] Lys26,34-bis(N£-tetradecanoyl)-GLP-1 (7-36);

[0272] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-36) ;

[0273] Gly8Lys34(N£-tetradecanoyl)-G LP- 1 (7-36) ;

[0274] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1 (7-36);

[0275] Arg26Lys34(N£-tetradecanoyl)-GLP-1 (7-36);

[0276] Lys26(N£-tetradecanoyl)-G LP- 1 (7-35) ;

[0277] Lys34(N£-tetradecanoyl)-GLP-1 (7-35);

[0278] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-35);

[0279] Gly8Lys26(N£-tetradecanoyl)-G LP- 1 (7-35) ;

[0280] Gly8Lys34(N£-tetradecanoyl)-G LP- 1 (7-35) ;

[0281] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1 (7-35);

[0282] Arg26Lys34(N£-tetradecanoyl)-GLP-1 (7-35);

[0283] Lys26(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0284] Lys34(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0285] Lys26,34-bis(N£-tetradecanoyl)-GLP-1(7-36)amide;

[0286] Gly8Lys26(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0287] Gly8Lys34(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0288] Gly8Lys26,34-bis(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0289] Arg26Lys34(N£-tetradecanoyl)-GLP-1 (7-36)amide;

[0290] Gly8Arg26Lys34(N£-tetradecanoyl)-GLP-1(7-37);

[0291] Lys26(N£-tetradecanoyl)Arg34-GLP-1 (7-37);

[0292] Gly8Lys26(N£-tetradecanoyl)Arg34-GLP-1(7-37);

[0293] Arg26,34Lys36(N£-tetradecanoyl)-GLP-1 (7-37);

[0294] Gly8Arg26, 34Lys36(N£-tetradecanoyl)-G LP- 1 (7-37) ;

[0295] Gly8Arg26Lys34(N£-tetradecanoyl)-G LP- 1 (7-38) ;

[0296] Lys26(N£-tetradecanoyl)Arg34-GLP-1 (7-38); Gly8Lys26(N£-tetradecanoyl)Arg34-GLP-1(7-38);

[0297] Arg26,34Lys36(N£-tetradecanoyl)-GLP-1 (7-38);

[0298] Arg26,34 Lys38(N£-tetradecanoyl)-GLP-1 (7-38);

[0299] Gly8Arg26, 34Lys36(N£-tetradecanoyl)-G LP- 1 (7-38) ;

[0300] Gly8Arg26Lys34(N£-tetradecanoyl)-GLP-1(7-39);

[0301] Lys26(N£-tetradecanoyl)Arg34-GLP-1(7-39);

[0302] Gly8Lys26(N£-tetradecanoyl)Arg34-GLP-1(7-39);

[0303] Arg26,34Lys(N£-tetradecanoyl)-GLP-1 (7-39);

[0304] Gly8Arg26, 34Lys36(N£-tetradecanoyl)-G LP- 1 (7-39) ;

[0305] Gly8Arg26LysY(N£-tetradecanoyl)-GLP-1 (7-40);

[0306] Lys26(N£-tetradecanoyl)Arg34-GLP-1 (7-40);

[0307] Gly8Lys26(N£-tetradecanoyl)Arg34-GLP-1(7-40);

[0308] Arg26,34Lys36(N£-tetradecanoyl)-GLP-1 (7-40);

[0309] Gly8Arg26.34(N£-tetradecanoyl)-GLP-1 (7-40);

[0310] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0311] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0312] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0313] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0314] Gly8Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0315] Gyl8Lys26.34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0316] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0317] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0318] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0319] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0320] Gly2Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0321] Gly8Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0322] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0323] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0324] Lys26,34-bis(N£-(co-carboxynonadecanoyl))-GLP-1 (7-39);

[0325] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0326] Gly8Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0327] Gly8Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0328] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0329] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (740);

[0330] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40); Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0331] Gly8Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0332] Gly8Lys26.34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0333] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0334] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0335] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0336] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0337] Gly8Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0338] Gly8Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36);

[0339] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36)amide;

[0340] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36)amide;

[0341] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36)amide;

[0342] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36)amide;

[0343] Gly8Lys(N£-(w-carboxynonadecanoyl))-GLP-1(7-36)amide;

[0344] Gyl8Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-36)amide;

[0345] Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0346] Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0347] Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0348] Gly8Lys26(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0349] Gly8Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0350] Gly8Lys26,34-bis(N£-(w-carboxynonadecanoyl))-GLP-1 (7-35);

[0351] Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1(7-37);

[0352] Gly8Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0353] Lys26(N£-(w-carboxynonadecanoyl))Arg34-GLP- 1(7-37);

[0354] Gly8Lys26(N£-(w-carboxynonadecanoyl))Arg34-GLP-1 (7-37);

[0355] Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-37);

[0356] Gly8Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1(7-37);

[0357] Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1(7-38);

[0358] Gly8Arg26Lys34(N£-((w-carboxynonadecanoyl))-GLP-1 (7-38);

[0359] Lys26(N£-(w-carboxynonadecanoyl))Arg34-GLP- 1(7-38);

[0360] Gly8Lys26(N£-(O-carboxynonadecanoyl))Arg34-GLP-1 (7-38);

[0361] Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0362] Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0363] Gly8Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-38);

[0364] Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1(7-39); Gly8Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0365] Lys26(N£-(w-carboxynonadecanoyl))Arg34-G LP-1 (7-39);

[0366] Gly8Lys26(N£-(w-carboxynonadecanoyl))Arg34-GLP-1 (7-39);

[0367] Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-39);

[0368] Gly8Arg26.34Lys38(N£-(w-carboxynonadecanoyl))-GLP-1(7-39);

[0369] Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1(7-40);

[0370] Gly8Arg26Lys34(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0371] Lys28(N£-(w-carboxynonadecanoyl))Arg34-G LP-1 (7-40);

[0372] Gly8Lys26(N£-(w-carboxynonadecanoyl))Arg34-GLP-1 (7-40);

[0373] Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1 (7-40);

[0374] Gly8Arg26,34Lys36(N£-(w-carboxynonadecanoyl))-GLP-1(7-40);

[0375] Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0376] Lys34(N"-(7-deoxycholoyl ))-G LP-1 (7-37);

[0377] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-37);

[0378] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0379] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0380] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0381] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0382] Lys26(N£-(7-deoxycholoyl)-G LP-1 (7-38);

[0383] Lys34(N£-(7-deoxycholoyl)-G LP-1 (7-38);

[0384] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-38);

[0385] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0386] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0387] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0388] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0389] Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0390] Lys34(N"-(7-deoxycholoyl))-GLP-1 (7-39);

[0391] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-39);

[0392] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0393] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0394] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0395] Arg26Lys34(N£-(7-deoxycholoyl)-GLP-1 (7-39);

[0396] Lys26(N£-(7-deoxycholoyl))-G LP-1 (7-40);

[0397] Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0398] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-40); Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0399] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0400] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0401] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0402] Lys26(N£-(7-deoxychoioyl))-GLP-1 (7-36);

[0403] Lys34(N£-(7-deoxycholoyl))-GLP- 1 (7-36);

[0404] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-36);

[0405] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-36);

[0406] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-36);

[0407] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-36);

[0408] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-36);

[0409] Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0410] Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0411] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-35);

[0412] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0413] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0414] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0415] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-35);

[0416] Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0417] Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0418] Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1(7-36)amide;

[0419] Gly8Lys26(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0420] Gly8Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0421] Gly8Lys26,34-bis(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0422] Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1 (7-36)amide;

[0423] Gly8Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1(7-37);

[0424] Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1 (7-37);

[0425] Gly8Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1(7-37);

[0426] Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0427] Gly8Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-37);

[0428] Lys26(N£-(choloyl))-GLP-1 (7-37);

[0429] Lys34(N£-(choloyl))-GLP-1 (7-37);

[0430] Lys26,34-bis(N£-(choloyl))-GLP-1 (7-37);

[0431] Gly8Lys26(N£-(choloyl ))-GLP-1 (7-37);

[0432] Gly8Lys34(N£-(choloyl))-GLP-1 (7-37); Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-37);

[0433] Arg26Lys34(N£-(choloyl))-GLP-1 (7-37);

[0434] Gly8Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1(7-38);

[0435] Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1 (7-38);

[0436] Gly8Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1(7-38);

[0437] Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0438] Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0439] Gly8Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-38);

[0440] Lys26(N£-(choloyl))-GLP-1 (7-38);

[0441] Lys34(N£-(choloyl))-GLP-1 (7-38);

[0442] Lys26,34-bis(N£-(choloyl))-GLP-1(7-38);

[0443] Gly8Lys26(N£-(choloyl))-GLP-1 (7-38);

[0444] Gly8Lys34(N£-(choloyl))-GLP-1 (7-38);

[0445] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-38);

[0446] Arg26Lys34(N£-(choloyl))-GLP-1 (7-38);

[0447] Gly8Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1(7-39);

[0448] Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1 (7-39);

[0449] Gly8Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1(7-39);

[0450] Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0451] Gly8Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-39);

[0452] Lys26(N£-(choloyl))-GLP-1 (7-39);

[0453] Lys34(N£-(choloyl))-GLP-1 (7-39);

[0454] Lys26,34-bis(N£-(choloyl))-GLP-1(7-39);

[0455] Gly8Lys26(N£-(choloyl))-GLP-1(7-39);

[0456] Gly8Lys34(N£-(choloyl))-GLP-1 (7-39);

[0457] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-39);

[0458] Arg26Lys34(N£-(choloyl))-GLP-1 (7-39),

[0459] Gly8Arg26Lys34(N£-(7-deoxycholoyl))-GLP-1(7-40);

[0460] Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1 (7-40);

[0461] Gly8Lys26(N£-(7-deoxycholoyl))Arg34-GLP-1(7-40);

[0462] Arg26,34Lys36(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0463] Gly8Arg26,34Lys38(N£-(7-deoxycholoyl))-GLP-1 (7-40);

[0464] Lys26(N£-(choloyl))-G LP-1 (740);

[0465] Lys34(N£-(choloyl) )-GLP-1 (740);

[0466] Lys26,34-bis(N£-(choloyl))-GLP-1(7-40); Gly8Lys26(N£-(choloyl))-GLP-1 (7-40);

[0467] Gly8Lys34(N£-(choloyl))-GLP-1 (7-40);

[0468] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-40);

[0469] Arg26Lys34(N£-(choloyl))-GLP-1 (7-40);

[0470] Lys26(N£-(choloyl))-GLP-1 (7-36);

[0471] Lys34(N£-(choloyl))-GLP-1 (7-36);

[0472] Lys26,34-bis(N£-(choloyl))-GLP-1(7-36);

[0473] Gly8Lys26(N£-(choloyl))-GLP-1 (7-36);

[0474] Gly8Lys34(N£-(choloyl))-GLP-1 (7-36);

[0475] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-36);

[0476] Arg26Lys34(N£-(choloyl))-GLP-1 (7-36);

[0477] Lys26(N£-(choloyl))-GLP-1 (7-35);

[0478] Lys34(N£-(choloyl))-GLP-1 (7-35);

[0479] Lys26,34-bis(N£-(choloyl))-GLP-1(7-35);

[0480] Gly8Lys26(N£-(choloyl))-GLP-1 (7-35);

[0481] Gly8Lys34(N£-(choloyl))-GLP-1 (7-35);

[0482] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-35);

[0483] Arg26Lys34(N£-(choloyl))-GLP-1 (7-35);

[0484] Lys26(N£-(choloyl))-GLP-1 (7-36)amide;

[0485] Lys34(N£-(choloyl))-GLP-1 (7-36)amide;

[0486] Lys26,34-bis(N£-(choloyl))-GLP-1(7-36)amide;

[0487] Gly8Lys26(N-(choloyl))-GLP-1 (7-36)amide;

[0488] Gly8Lys34(N£-(choloyl))-GLP-1 (7-36)amide;

[0489] Gly8Lys26,34-bis(N£-(choloyl))-GLP-1 (7-36)amide;

[0490] Arg26Lys34(N£-(choloyl))-GLP-1 (7-36)amide;

[0491] Gly8Arg26Lys34(N£-(choloyl))-GLP-1(7-37);

[0492] Lys26(N£-(choloyl))Arg34-GLP-1 (7-37);

[0493] Gly8Lys26(N£-(choloyl))ArS34-GLP-1 (7-37);

[0494] Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-37);

[0495] Gly8Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-37);

[0496] Lys26(N£-(lithocholoyl))-GLP-1 (7-37);

[0497] Lys34(N£-(lithocholoyl))-GLP-1 (7-37);

[0498] Lys26,34-bis(N£-(lithocholoyl))-GLP-1(7-37);

[0499] Gly8Lys26(N£-lithocholoyl))-GLP-1 (7-37);

[0500] Gly8Lys34(N£-(lithocholoyl)-GLP-1 (7-37); Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-37);

[0501] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-37);

[0502] Gly8Arg26Lys34(N£-(choloyl))-GLP-1(7-38);

[0503] Lys26(N£-(choloyl))Arg34-GLP-1 (7-38);

[0504] Gly8Lys26(N£-(choloyl))Arg34-GLP-1(7-38);

[0505] Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-38);

[0506] Arg26,34Lys38(N£-(choloyl))-GLP-1 (7-38);

[0507] Gly8Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-38);

[0508] Lys26(N£-(lithocholoyl))-GLP-1 (7-38);

[0509] Lys34(N£-(lithocholoyl))-GLP-1 (7-38);

[0510] Lys26,34-bis(N£-(lithocholoyl))-GLP-1(7-38);

[0511] Gly8Lys26(N£-(lithocholoyl))-GLP-1 (7-38);

[0512] Gly8Lys34(N£-(lithocholoyl))-GLP-1 (7-38);

[0513] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-38);

[0514] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-38);

[0515] Gly8Arg26Lys34(N£-(choloyl))-GLP-1(7-39);

[0516] Lys26(N£-(choloyl))Arg34-GLP-1 (7-39);

[0517] Gly8Lys26(N£-(choloyl))Arg34-GLP-1(7-39);

[0518] Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-39);

[0519] Gly8Arg26.34Lys36(N£-(choloyl))-GLP-1 (7-39);

[0520] Lys26(N£-(lithocholoyl))-GLP-1 (7-39);

[0521] Lys34(N£-(lithocholoyl))-GLP-1 (7-39);

[0522] Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-39);

[0523] Gly8Lys26(N£-(lithocholoyl))-GLP-1 (7-39);

[0524] Gly8Lys34(N£-(lithocholoyl))-GLP-1 (7-39);

[0525] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-39);

[0526] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-39);

[0527] Gly8Arg26Lys34(N£-(choloyl))-GLP-1 (7-40);

[0528] Lys26(N£-(choloyl))Arg34-GLP-1 (7-40);

[0529] Gly8Lys26(N£-(choloyl))Arg34-GLP-1(7-40);

[0530] Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-40);

[0531] Arg26,34Lys38(N£-(choloyl))-GLP-1 (7-40);

[0532] Gly8Arg26,34Lys36(N£-(choloyl))-GLP-1 (7-40);

[0533] Lys26(N£-(lithocholoyl))-GLP-1 (7-40);

[0534] Lys34(N£-(lithocholoyl))-GLP-1 (7-40); Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-40);

[0535] Gly8Lys26(N£-(lithocholoyl))-GLP-1 (7-40);

[0536] Gly8Lys34(N£-(lithocholoyl))-GLP-1 (7-40);

[0537] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-40);

[0538] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-37);

[0539] Lys26(N£-(lithocholoyl))-GLP-1 (7-36);

[0540] Lys34(N£-(lithocholoyl))-GLP-1 (7-36);

[0541] Lys26,34-bis(N£-(lithocholoyl))-GLP-1(7-36);

[0542] Gly8Lys26(N£-lithocholoyl))-GLP-1 (7-36);

[0543] Gly8Lys34(N£-(lithocholoyl))-GLP-1 (7-36);

[0544] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1-(7-36);

[0545] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-36),

[0546] Lys26(N£-(lithocholoyl))-GLP-1 (7-35);

[0547] Lys34(N£-(lithocholoyl))-GLP-1 (7-35);

[0548] Lys26,34-bis(N£-(lithocholoyl))-GLP-1(7-35);

[0549] Gly8Lys26(N£-(lithocholoyl))-GLP-1 (7-35);

[0550] Gly8Lys34(N£-(lithocholoyl))-GLP-1 (7-35);

[0551] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-35);

[0552] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-35);

[0553] Lys26(N£-(lithocholoyl))-GLP-1-(7-36)amide;

[0554] Lys34(N-(lithocholoyl))-GLP-1 (7-36)amide;

[0555] Lys26,34-bis(N£-(lithocholoyl))-GLP-1(7-36)amide;

[0556] Gly8Lys26(N£-(lithocholoyl))-GLP-1 (7-36)amide;

[0557] Gly8Lys34(N£-(lithocholoyl)-GLP-1 (7-36)amide;

[0558] Gly8Lys26,34-bis(N£-(lithocholoyl))-GLP-1 (7-36)amide;

[0559] Arg26Lys34(N£-(lithocholoyl))-GLP-1 (7-36)amide;

[0560] Gly8Arg26Lys34(N£-(lithocholoyl))-GLP-1(7-37);

[0561] Lys26(N£-(lithocholoyl))Arg34-GLP-1 (7-37);

[0562] Gly8Lys26(N£-(lithocholoyl))Arg34-GLP-1(7-37);

[0563] Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-37);

[0564] Gly8Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-37);

[0565] Gly8Arg26Lys34(N£-(lithocholoyl))-GLP-1(7-38);

[0566] Lys26(N£-(lithocholoyl))AFS34-GLP-1 (7-38);

[0567] Gly8Lys26(N£-(lithocholoyl))Arg34-GLP-1(7-38);

[0568] Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-38); Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-38);

[0569] Gly8Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-38);

[0570] Gly8Arg26Lys34(N£-(lithocholoyl))-GLP-1(7-39);

[0571] Lys26(N£-(lithocholoyl))Arg34-GLP-1 (7-39);

[0572] Gly8Lys26(N£-(lithocholoyl))Arg34-GLP-1(7-39);

[0573] Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-39);

[0574] Gly8Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-39);

[0575] Gly8Arg26Lys34(N£-(lithocholoyl))-GLP-1(7-40);

[0576] Lys26(N£-(lithocholoyl))Arg34-GLP-1 (7-40);

[0577] Gly8Lys26(N£-(lithocholoyl))Arg34-GLP-1(7-40);

[0578] Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-40) and Gly8Arg26,34Lys36(N£-(lithocholoyl))-GLP-1 (7-40).

[0579] In certain embodiments the therapeutic polypeptide may be a GLP-1 agonist disclosed in WO 2012 / 080471 or WO 2013 / 189988, e.g. semaglutide and structurally related analogues thereof. Semaglutide has the structure shown in Formula II and Figure 16B

[0580] (Formula II)

[0581] In some embodiments a simple nomenclature is used to describe the GLP-1 agonist, e.g., [AibS] GLP-1 (7-37) designates an analogue of GLP-1 (7-37) wherein the naturally occurring Ala in position 8 has been substituted with Aib. In some embodiments the GLP- 1 agonist comprises a maximum of twelve, such as a maximum of 10, 8 or 6, amino acids which have been altered, e.g., by substitution, deletion, insertion and / or modification, compared to e.g. GLP-1 (7-37). In some embodiments the analogue comprises up to 10 substitutions, deletions, additions and / or insertions, such as up to 9 substitutions, deletions, additions and / or insertions, up to 8 substitutions, deletions, additions and / or insertions, up to 7 substitutions, deletions, additions and / or insertions, up to 6 substitutions, deletions, additions and / or insertions, up to 5 substitutions, deletions, additions and / or insertions, up to 4 substitutions, deletions, additions and / or insertions or up to 3 substitutions, deletions, additions and / or insertions, compared to e.g. GLP-1 (7-37).

[0582] Unless otherwise stated the GLP-1 comprises only L-amino acids.

[0583] In some embodiments the term “GLP-1 agonist”, “GLP-1 receptor agonist”, "GLP-1 analogue" or "analogue of GLP-1" as used interchangeably herein refers to a peptide, or a compound, which is a variant of the human Glucagon-Like Peptide-1 (GLP-1 (7-37)). GLP- 1 (7-37) has the sequence HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG. In some embodiments the term "variant" refers to a compound which comprises one or more amino acid substitutions, deletions, additions and / or insertions.

[0584] In one embodiment the GLP-1 agonist exhibits at least 60%, 65%, 70%, 80% or 90% sequence identity to GLP-1 (7-37) over the entire length of GLP-1 (7-37). As an example of a method for determination of sequence identity between two analogues the two peptides [Aib8]GLP-1 (7-37) and GLP-1 (7-37) are aligned. The sequence identity of [Aib8]GLP-1 (7- 37) relative to GLP-1 (7-37) is given by the number of aligned identical residues minus the number of different residues divided by the total number of residues in GLP-1 (7-37). Accordingly, in said example the sequence identity is (31 -1 ) / 31 .

[0585] In one embodiment the C-terminal of the GLP-1 agonist is an amide.

[0586] In some embodiments the GLP-1 agonist is GLP-1 (7-37) or GLP-1 (7-36)amide. In some embodiments the GLP-1 agonist is exendin-4, the sequence of which is HGEGTFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS.

[0587] In some embodiments the GLP-1 agonist comprises one substituent which is covalently attached to the peptide. In some embodiments the substituent comprises a fatty acid or a fatty diacid. In some embodiments the substituent comprises a C16, C18 or C20 fatty acid. In some embodiments the substituent comprises a C16, C18 or C20 fatty diacid. In some embodiments the substituent comprises formula (X) (X), wherein n is at least 13, such as n is 13, 14, 15, 16, 17, 18 or

[0588] 19. In some embodiments the substituent comprises formula (X), wherein n is in the range of 13 to 19, such as in the range of 13 to 17. In some embodiments the substituent comprises formula (X), wherein n is 13, 15 or 17. In some embodiments the substituent comprises formula (X), wherein n is 13. In some embodiments the substituent comprises formula (X), wherein n is 15. In some embodiments the substituent comprises formula (X), wherein n is 17. In some embodiments the substituent comprises one or more 8-amino- 3,6-dioxaoctanoic acid (OEG), such as two OEG.

[0589] In some embodiments the substituent is [2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4- (17- carboxyheptadecanoylamino) butyrylamino]ethoxy}ethoxy)acetylamino] eth- oxyjeth oxy) acetyl] .

[0590] In some embodiments the substituent is [2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4- ({trans-4-[(19-carboxynonadecanoylamino)methyl]cyclohexanecarbonyl} ami- no)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] .

[0591] In some embodiments the GLP-1 agonist is semaglutide, also known as N- epsilon26-[2- (2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxyheptadecanoylamino) bu- tyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1(7-37), which may be prepared as described in W02006 / 097537, Example 4, which is incorporated herein by reference.

[0592] In some embodiments the GLP-1 agonist is in the form of a pharmaceutically acceptable salt, amide, or ester thereof. In some embodiments the GLP-1 agonist comprises one or more pharmaceutically acceptable counter ions.

[0593] In some embodiments the dosage of GLP-1 agonist is in the range of 0.01 mg to 100 mg. In some embodiments a composition for administering the GLP-1 agonist comprises an amount of a GLP-1 agonist in the range of 0.1 to 40 mg or 1 to 20 mg. In some embodiments the composition comprises an amount of a GLP-1 agonist in the range of 5 to 20 mg, such as in the range of 5 to 15 mg, such as 5 mg, such as 10 mg, such as 15 mg, such as 20 mg.

[0594] In some embodiments the composition comprises an amount of a GLP-1 agonist in the range of 0.05 to 25 pmol, such as in the range of 0.5 to 2.5 pmol. In some embodiments the GLP-1 agonist is selected from one or more of the GLP-1 agonists mentioned in W093 / 19175, W096 / 29342, WO98 / 08871 , WO99 / 43707, WO99 / 43706, W099 / 43341 , WO99 / 43708, WG2005 / 027978, WG2005 / 058954, WG2005 / 058958, WG2006 / 005667, WG2006 / 037810, WG2006 / 037811 , WG2006 / 097537, WG2006 / 097538, WG2008 / 023050, WG2009 / 030738, WG2009 / 030771 , WG2009 / 030774, WO 2011 / 080102, WO 2011 / 080103, WO 2012 / 062803, WO 2012 / 062804, WO 2012 / 140117, WO 2014 / 005858, WO 2014 / 177683, WO 2015 / 000942, all of which are incorporated herein by reference.

[0595] In some embodiments the GLP-1 agonist is a structural analogue of semaglutide, e.g. selected from the group consisting of:

[0596] N-epsilon37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1 -(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino) ethoxy]ethoxy}acetyl [desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1 (7-37)amide;

[0597] N-epsilon26{2-[2-(2-{2- [2-((R)-3-carboxy-3-{[1 -(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino} propionylamino)ethoxy]ethoxy}acetylamino)ethoxy] ethoxyjacetyl [desaminoHis7, Arg34] GLP-1 -(7-37);

[0598] N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1 -(19-carboxy- nonadecanoyl) piperidine-4- carbonyl]amino}propionylamino)ethoxy] ethoxy} acetylamino)ethoxy] ethoxy}acetyl[Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0599] N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-carboxyheptadecanoyl)piperidin-4- ylcarbonylamino]3-carboxypropionylamino)ethoxy)ethoxy]acetylamino)ethoxy] ethoxy)acetyl] [,DesaminoHis7, Glu22 Arg26, Arg 34, Phe(m-CF3)28]GLP-1-(7-37)amide;

[0600] N-epsilon26-[(S)-4-carboxy-4-({trans-4-[(19-carboxynonadecanoylamino)methyl] cyclohexanecarbonyl}amino)butyryl] [Aib8,Arg34]GLP-1-(7-37);

[0601] N-epsilon26-{4-[(S)-4- carboxy-4-({trans-4-[(19-carboxynonadecanoylamino) methyl]cyclohexanecarbonyl} amino)butyrylamino]butyryl}[Aib8,Arg34]GLP-1-(7-37); N-epsilon26-[2-(2-{2-[(S)-4- carboxy-4-({trans-4-[(19-carboxy-nonadecanoylamino) methyl]cyclohexanecarbonyl} amino)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP- 1-(7-37);

[0602] N-epsilon26-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy} ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37)amide;

[0603] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy- 4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino) butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl][Aib8,Glu22,Arg26, Arg34,Lys37]GLP-1-(7-37)amide;

[0604] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino) butyrylamino] ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0605] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({4-[(trans-19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino) butyryla- mino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Arg26,Arg34,Lys 37]GLP-1-(7-37)amide;

[0606] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino) butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg2 6,Arg34,Lys37]GLP-1-(7-37);

[0607] N-epsilon26[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({4-[(19- carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino] ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl[Aib8, Lys 26]GLP-1 (7-37)amide;

[0608] N-epsilon26 [2-(2-[2-(2-[2-(2-((S)-2-[trans-4-((9-carboxynonadecanoylamino] methyl) cyclohexyl carbonylamino]-4-carboxybutanoylamino)ethoxy)ethoxy] acetylamino)ethoxy]ethoxy)acetyl] [Aib8, Lys26] GLP-1 (7-37)amide; N-epsilon37-[2-(2-{2-[2-(2-{2- [(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexane-carbonyl} amino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Arg26,Arg34,Lys37]GLP-1-(7-37);

[0609] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl} amino)butyrylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37);

[0610] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{4-[4-(16-(1 H-tetrazol-5-yl)- hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)butyrylamino] ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7- 37);

[0611] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoyl-sulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);

[0612] N-epsilon26-[2-(2-{2- [(S)-4-carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1 H-tetrazol-5- yl)hexadecanoyl-sulfamoyl)butyrylamino]hexanoylamino} butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37);

[0613] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4- carboxy-4-{4-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]butyrylamino}butyrylamino)butyrylamino] ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7- 34);

[0614] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol- 5- yl)hexadecanoylsulfamoyl)butyrylamino]-dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34);

[0615] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-34); N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoyl-sulfamoyl)butyrylamino]dodecanoylamino} butyrylamino)butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);

[0616] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)butyrylamino] ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);

[0617] N-epsilon26-[2-(2-{2-[(S)-4-carboxy- 4-((S)-4-carboxy-4-{6-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]hexanoylamino}butyrylamino)butyrylamino]ethoxy }ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;

[0618] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{6-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino] hexanoylaminojbutyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-35);

[0619] N-epsilon26-[2-(2-{2- [(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoyl-sulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Lys33,Arg34]GLP-1-(7-34);

[0620] N-epsilon26-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-36)amide;

[0621] N-epsilon26-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-((S)-4- carboxy-4-{12-[4-(16-(1 H-tetrazol-5-yl)hexadecanoylsulfamoyl) butyrylamino]dodecanoylamino}butyrylamino)butyrylamino]ethoxy}ethoxy) acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy) acetylamino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Lys26,Arg34]GLP-1- (7-36)amide;

[0622] N-epsilon37-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide; N-epsilon37-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino] ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Arg34,Lys37] GLP-1-(7-37)amide;

[0623] N- epsilon37{2-[2-(2-{2-[2-((R)-3-carboxy-3-{[1 -(19-carboxy-nonadecanoyl) piperidine-4- carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy] ethoxyjacetyl [desaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1 (7-37)amide;

[0624] N-epsilon37{2-[2-(2-{2-[2-((S)-3-carboxy-3-{[1 -(19-carboxynonadecanoyl) piperidine-4- carbonyl]amino}propionylamino)ethoxy]ethoxy}acetylamino)ethoxy] ethoxyjacetyl [Aib8,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0625] N-epsilon37-[2-(2-[2-(2-[2-(2-((R)-3-[1-(17-carboxyhepta-decanoyl)piperidin-4- ylcarbonylamino]3-carboxy-propionylamino)ethoxy)ethoxy]acetylamino)ethoxy] ethoxy)acetyl] [DesaminoHis7, Glu22,Arg26,Arg34,Phe(m-CF3)28] GLP-1-(7-37)amide;

[0626] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexanecarbonyl}amino)butyrylamino]ethoxy} ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7- 37)amide;

[0627] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl]cyclohexane-carbonyl}amino)butyrylamino] ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0628] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy- nonadecanoylamino)methyl] cyclohexane-carbonyl}amino)butyrylamino] ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37);

[0629] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans-4-[(19-carboxy-nonadecanoylamino) methyl]cyclohexane-carbonyl}amino)butyrylamino] ethoxyjethoxy) acetylamino] ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37]GLP-1-(7-37); N-epsilon37-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(1 H-tetrazol-5- yl)hexadecanoyl-sulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0630] N-epsilon37-[2-(2-{2-[(S)-4-carboxy-4-((S)-4-carboxy-4-{12-[4-(16-(IH-tetrazol-5- yl)hexadecanoylsulfamoyl)butyrylamino]dodecanoylamino}butyrylamino) butyrylamino]ethoxy}ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-

[0631] 37)amide;

[0632] N-epsilon37-(3-((2-(2-(2-(2-(2-Hexadecyloxyethoxy)ethoxy)ethoxy)ethoxy)ethoxy)) propionyl)[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1(7-37)-amide;

[0633] N-epsilon37-{2-(2-(2-(2-[2-(2-(4-(hexadecanoylamino)-4-carboxybutyryl- amino)ethoxy)ethoxy]acetyl)ethoxy)ethoxy)acetyl)}- [desaminoHis7,Glu22,Arg26,Glu30,Arg34,Lys37] GLP-1-(7-37)amide;

[0634] N-epsilon37-{2-(2-(2-(2-[2-(2-(4-(hexadecanoylamino)-4-carboxy-butyryl-amino) ethoxy)ethoxy]acetyl)ethoxy)ethoxy)acetyl)}-[desaminoHis7,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37)amide;

[0635] N-epsilon37-(2-(2-(2-(2-(2-(2-(2-(2-(2-(octadecanoyl-amino)ethoxy)ethoxy) acetylamino)ethoxy) ethoxy)acetylamino) ethoxy) ethoxy) acetyl)[desaminoHis7,Glu22,Arg26,Arg34,Lys37] GLP-1 (7-37)amide;

[0636] N- epsilon37-[4-(16-(1 H-tetrazol-5-yl)hexadecanoylsulfamoyl)butyryl] [Desamino- His7,Glu22,Arg26, Arg34, Lys37]GLP-1-(7-37)amide;

[0637] N-epsilon37-[2-(2-{2-[2-(2-{2- [(S)-4-carboxy-4-(19-carboxynonadecanoylamino) butyrylamino] ethoxyjethoxy) acetylamino]ethoxy} ethoxy)acetyl] [DesaminoHis7,Glu22,Arg26, Arg34,Lys37]GLP-1-(7- 37);

[0638] N-epsilon37-(2-{2-[2-((S)-4-carboxy-4-{(S)-4-carboxy-4-[(S)-4-carboxy-4-(19- carboxy- nonadecanoylamino)butyrylamino] butyrylamino} butyrylamino)ethoxy]ethoxy} acetyl)[DesaminoHis7,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37); N-epsilon37-{2-[2-(2- {(S)-4-[(S)-4-(12-{4-[16-(2-tert-Butyl-2H-tetrazol-5-yl)- hexadecanoylsulfamoyl] butyrylamino}dodecanoylamino)-4-carboxybutyrylamino]-4- carboxybutyrylamino}ethoxy)ethoxy]acetyl}[DesaminoHis7,Glu22,Arg26,Arg34, Lys37] GLP-1 (7-37);

[0639] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)- butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl] [Aib8,Glu22, Arg26,Arg34,Lys37]GLP-1-(7-37);

[0640] N-alpha37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17- carboxy-heptadecanoylamino)- butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}- ethoxy)-acetyl] [Aib8,Glu22,Arg26,Arg34,epsilon-Lys37]GLP-1-(7-37)peptide;

[0641] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy-heptadecanoylamino)- butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl] [desaminoHis7, Glu22,Arg26,Arg34,Lys37] GLP-1 -(7-37);

[0642] N-epsilon36-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(15-carboxy-pentadecanoylamino)- butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)-acetyl] [desaminoHis7, Glu22,Arg26,Glu30,Arg34,Lys36] GLP-1 -(7-37)-Glu-Lys peptide;

[0643] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-({trans- 4-[(19- carboxynonadecanoylamino)methyl]cyclohexanecarbonyl}amino)butyryl- amino]ethoxy}ethoxy)acetylamino]ethoxy}ethoxy)acetyl] [Aib8,Glu22,Arg26,Arg34,Lys37]GLP-1-(7-37);

[0644] N-epsilon37-[2-(2-{2-[2-(2-{2-[(S)-4-carboxy-4-(17-carboxy- heptadecanoylamino)- butyrylamino]-ethoxy}-ethoxy)-acetylamino]-ethoxy}-ethoxy)- acetyl]-[Aib8,Glu22, Arg26,Arg34,Aib35,Lys37]GLP-1-(7-37);

[0645] N-epsilon37-[(S)-4- carboxy-4-(2-{2-[2-(2-{2-[2-(17-carboxyheptadecanoylamino) ethoxy] ethoxy} acetylamino) ethoxy] ethoxy} acetylamino) butyryl] [Aib8,Glu22,Arg26,34,Lys37] GLP-1 (7- 37); N-epsilon37-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)- carboxybutyry- lamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [lmPr7,Glu22, Arg26,34,Lys37], GLP-1-(7-37);

[0646] N-epsilon37-{2-[2-(2-{2-[2-(2-{(S)-4-carboxy-4-[10-(4-carboxy- phenoxy) decanoylamino] butyrylamino}ethoxy)ethoxy]acetylamino}ethoxy) ethoxy]acetyl}-[Aib8,Arg34,Lys37]GLP- 1(7-37)-OH;

[0647] N-epsilon26 (17-carboxyhepta-decanoyl)-[Aib8,Arg34]GLP-1-(7-37)-peptide;

[0648] N-epsilon26-(19-carboxynonadecanoyl)-[Aib8,Arg34]GLP-1-(7-37);

[0649] N-epsilon26-(4-{[N-(2-carboxyethyl)-N-(15-carboxypenta-decanoyl)amino] methyl}benzoyl[Arg34]GLP-1-(7-37);

[0650] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy] acetylamino) ethoxy]ethoxy) acetyl] [Aib8,Arg34]GLP- l-(7-37);

[0651] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(19-carboxynonadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy] acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP- 1-(7-37);

[0652] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy] acetylamino)ethoxy]ethoxy)acetyl] [3-(4- lmidazolyl)Propionyl7,Arg34]GLP-1-(7-37);

[0653] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-(carboxymethyl- amino)acetylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP-1- (7-37);

[0654] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-3(S)-

[0655] Sulfopropionylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP-1- N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Gly8,Arg34] GLP- 1-(7-37);

[0656] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP- 1-(7-37)-amide;

[0657] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)- 4(S)- carboxybutyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl]

[0658] Aib8,Arg34, Pro37]GLP-1 -(7-37)amide;

[0659] N-epsilon26-{2-(2-(2-(2-[2-(2-(4-(pentadecanoylamino)-4-carboxybutyrylamino) ethoxy)ethoxy]acetyl)ethoxy)ethoxy)acetyl)}[Aib8,Lys26,Arg34] GLP-1 (7-37)-OH;

[0660] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-{[N-(2- carboxyethyl)-N-(17-carboxyheptadecanoyl) amino]methyl}benzoyl)amino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP-1(7-37);

[0661] N-alpha7-formyl, N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoyl-amino)-4(S)- carboxy-butyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Arg34]GLP-1-(7- 37);

[0662] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-(17-carboxyheptadecanoylamino)-4(S)-carboxy- butyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8, Glu22, Arg34] GLP- 1-(7-37);

[0663] N-epsilon26{3-[2-(2-{2-[2-(2-{2-[2-(2-[4-(15-(N-((S)-1 ,3- dicarboxypropyl) carbamoyl)pentadecanoylamino)-(S)-4-carboxybutyrylamino] ethoxy)ethoxy] ethoxy}ethoxy)ethoxy]ethoxy}ethoxy)ethoxy]propionyl} [Aib8,Arg34]GLP- 1-(7-37);

[0664] N-epsilon26-[2-(2-[2-(2-[2-(2-[4-{[N-(2-carboxyethyl)-N-(17-carboxy- heptadecanoyl)amino]methyl}benzoyl)amino](4(S)-carboxybutyryl-amino)ethoxy) eth- oxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34] GLP-l(7-37); N-epsilon26-{(S)-4-carboxy-4-((S)-4-carboxy-4-((S)-4-carboxy-4-((S)-4-carboxy-4-(19- carboxy-nonadecanoylamino)butyrylamino)butyrylamino)butyrylamino) butyrylamino} [Aib8,Arg34]GLP-1-(7-37);

[0665] N-epsilon26-4-(17-carboxyheptadecanoyl-amino)-4(S)-carboxybutyryl-[Aib8,Arg34]GLP-1- (7-37);

[0666] N-epsilon26-{3-[2-(2-{2-[2-(2-{2-[2-(2-[4- (17-carboxyheptadecanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy]ethoxy}ethoxy)ethoxy]ethoxy}ethoxy)ethoxy] propionyl}[Aib8,Arg34]GLP-1-(7-37);

[0667] N-epsilon26- {2-(2-(2-(2-[2-(2-(4-(17-carboxyheptadecanoylamino)-4- carboxybutyrylamino) ethoxy)ethoxy]acetyl)ethoxy)ethoxy)acetyl)}- [Aib8,22,27,30,35,Arg34,Pro37,Lys26] GLP-1 (7-37)amide;

[0668] N-epsilon26-[2-(2-[2-[4-(21-carboxyuneicosanoylamino)-4(S)-carboxybutyrylamino] ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP-1-(7-37); and

[0669] N-epsilon26- [2-(2-[2-(2-[2-(2-[4-(21-carboxyuneicosanoylamino)-4(S)- carboxybutyrylamino]ethoxy)ethoxy]acetylamino)ethoxy]ethoxy)acetyl] [Aib8,Arg34]GLP- 1-(7-37).

[0670] The therapeutic polypeptide may be a GIP analogue. Certain GIP analogues have been described as exhibiting both GIP and GLP- 1 activity in WO 2013 / 164483, WO 2014 / 192284, and WO 2011 / 119657, which are incorporated herein by reference. Further GIP analogues exhibiting both GIP and GLP-1 like activity (i.e. agonists of GLP-1 receptor and GIP receptor) include those recited in WO 2016 / 111971 , which are incorporated herein by reference. The therapeutic polypeptide may be any of these polypeptides. This includes tirzepatide and structurally related analogues thereof.

[0671] Thus, GIP-GLP-1 co-agonist compounds of use in the invention include those of Formula III

[0672] YX1EGTFTSDYSIX2LDKIAQKAX3VQWLIAGGPSSGAPPPS; (Formula III) wherein Xi is Aib; X2 is Aib; K at position 20 is chemically modified through conjugation to the epsilon-amino group of the K side-chain with ([2-(2-Amino-ethoxy)- ethoxy]-acetyl)2- (yGlu)a-CO-(CH2)b-CO2H wherein a is 1 to 2 and b is 10 to 20; X3 is Phe or 1-Nal; and the C-terminal amino acid is optionally amidated as a C-terminal primary amide, or a pharmaceutically acceptable salt thereof.

[0673] "Aib" is alpha amino isobutyric acid, and "1-Nal" is 1-Naphthylalanine.

[0674] In certain embodiments, b is 14 to 18, preferably 16 to 18, or 18.

[0675] In certain embodiments, the C-terminal amino acid is amidated as a C-terminal primary amide.

[0676] Tirzepatide is an example of an incretin peptide analogue. Incretins such as GIP are a group of metabolic hormones that stimulate a decrease in blood glucose levels. Incretins are released after eating and augment the secretion of insulin released from pancreatic beta cells of the islets of Langerhans by a blood glucose-dependent mechanism.

[0677] Tirzepatide may be considered as a dual agonist for the glucose-dependent insulinotropic polypeptide (GIP) receptor and the glucagon-like peptide- 1 (GLP-1) receptor. Tirzepatide has been marketed under the brand name Mounjaro, and has the structure shown in Formula IV and Figure 16C.

[0678] (Formula IV)

[0679] Tirzepatide is also known as (2S)-2-[[20-[[(5S)-6-[[(2S,3S)-1-[[(2S)-1-[[(2S)-5-amino-1- [[(2S)-6-amino-1-[[(2S)-1-[[(2S)-1-[[(2S)-1-[[(2S)-5-amino-1-[[(2S)-1-[[(2S)-1-[[(2S,3S)-1- [[(2S)-1-[[2-[[2-[(2S)-2-[[(2S)-1-[[(2S)-1-[[2-[[(2S)-1-[(2S)-2-[(2S)-2-[(2S)-2-[[(2S)-1-amino-

[0680] 3-hydroxy-1-oxopropan-2-yl]carbamoyl]pyrrolidine-1-carbonyl]pyrrolidine-1- carbonyl]pyrrolidin-1-yl]-1-oxopropan-2-yl]amino]-2-oxoethyl]amino]-3-hydroxy-1- oxopropan-2-yl]amino]-3-hydroxy-1-oxopropan-2-yl]carbamoyl]pyrrolidin-1-yl]-2- oxoethyl]amino]-2-oxoethyl]amino]-1-oxopropan-2-yl]amino]-3-methyl-1 -oxopentan-2- yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-3-(1 H-indol-3-yl)-1-oxopropan-2-yl]amino]- 1 ,5-dioxopentan-2-yl]amino]-3-methyl-1-oxobutan-2-yl]amino]-1-oxo-3-phenylpropan-2- yl]amino]-1-oxopropan-2-yl]amino]-1-oxohexan-2-yl]amino]-1,5-dioxopentan-2-yl]amino]-1- oxopropan-2-yl]amino]-3-methyl-1-oxopentan-2-yl]amino]-5-[[(2S)-2-[[(2S)-2-[[2-[[(2S,3S)- 2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[(2S,3R)-2-[[(2S)-2-[[(2S,3R)-2-[[2-[[(2S)-2-[[2-[[(2S)-2- amino-3-(4-hydroxyphenyl)propanoyl]amino]-2-methylpropanoyl]amino]-4- carboxybutanoyl]amino]acetyl]amino]-3-hydroxybutanoyl]amino]-3- phenylpropanoyl]amino]-3-hydroxybutanoyl]amino]-3-hydroxypropanoyl]amino]-3- carboxypropanoyl]amino]-3-(4-hydroxyphenyl)propanoyl]amino]-3- hydroxypropanoyl]amino]-3-methylpentanoyl]amino]-2-methylpropanoyl]amino]-4- methylpentanoyl]amino]-3-carboxypropanoyl]amino]-6-oxohexyl]amino]-20- oxoicosanoyl]amino]-5-[2-[2-[2-[2-[2-(carboxymethoxy)ethoxy]ethylamino]-2- oxoethoxy]ethoxy]ethylamino]-5-oxopentanoic acid.

[0681] Certain incretin mimetics have been described as exhibiting GIP, GLP- 1 , and glucagon like activity (i.e. agonists of GLP-1 receptor, GIP receptor and glucagon receptor) in WO 2019 / 125929 and WO 2019 / 125938, which are incorporated herein by reference. This includes retatrutide (LY3437943) and structurally related analogues thereof. Retatrutide may be considered a structural analogue of tirzepatide and vice versa. The therapeutic polypeptide may be any of these polypeptides

[0682] Thus, GIP-GLP-1-glucagon triple co-agonist compounds (incretin analogues) of use in the invention include those of Formula V

[0683] YX2QGTFTSDYSIX13LDKX17AX19X20AFIEYLLX28X29GPSSX34APPPS, (Formula V) wherein:

[0684] X2 is Aib,

[0685] X is L or aMeL,

[0686] X17 is any amino acid with a functional group available for conjugation, and the functional group is conjugated to a C 16-C 22 fatty acid, optionally via a linker

[0687] X19 is Q or A,

[0688] X2o is Aib, aMeK (a-methyl-L-lysine), Q or H,

[0689] X28 is E or A,

[0690] X29 is G or Aib, X34 is G or Aib, and wherein the C-terminal amino acid is optionally amidated.

[0691] In certain embodiments the amino acid with the functional group available for conjugation at position X17 is selected from the group consisting of K, C, E and D, and preferably is K.

[0692] In certain embodiments the linker comprises one to four amino acids, preferably Glu or yGlu. In other embodiments the linker further comprises a structure of: H-{NH-CH2-CH2-[O-CH2-CH2]m-O-(CH2)p -CO}n-OH, wherein m is any integer from 1 to 12, n is any integer from 1 to 12, and p is 1 or 2. 8.

[0693] In certain embodiments the linker further comprises one to four (2-[2-(2-amino-ethoxy)- ethoxy]-acetyl) (i.e. AEEA) moieties.

[0694] In certain specific embodiments the X17 is a K chemically modified through conjugation to an epsilon-amino group of a K side-chain with the following structure: (2-[2-(2-amino-ethoxy)-ethoxy]-acetyl) -(yGlu)b-CO-(CH2)c-CO2H, wherein a is 0, 1 or 2; b is 1 or 2; and c is an integer between 16 to 18.

[0695] In certain specific embodiments the triple agonist incretin analogue is retatrutide (LY3437943), the structure of which is shown in Formula VI and Figure 16D:

[0696] YAibQGTFTSDYSIaMeLLDKKAQAibAFIEYLLEGGPSSGAPPPS-CONH2(Formula VI), wherein K is conjugated via an (AEEA) y Glu linker to a C20 fatty diacid moiety.

[0697] Thus, the invention further provides a solid dosage form adapted for oral delivery to a stomach of a human or non-human animal subject, said composition comprising

[0698] (i) a polypeptide therapeutic agent selected from the group consisting dulaglutide, exenatide, liraglutide, semaglutide, tirzepatide, albiglutide, lixisenatide, polyethylene glycol loxenatide, retatrutide (LY3437943), cotadutide; taspoglutide; langlenatide; beinaglutide; efpeglenatide; LY3502970; LY3537031 ; LY3493269; HM12525A / JNJ-64565111 ; MGD6030 / 1 ; SAR425899; MEDI0382; MK8521 ; ZP2929 / BI 456906; NN9709 / NNC0090-2746 / MAR709 / RG7697 / R06811135; SAR441255; C2816; ZP3022; NNC 9204-1177 (NN9277); LY3305677; JNJ-54728518; LY2944876 / TT-401 ; CPD86; SAR438335; ZP-l-98; ZP-DI-70; HM15211; NN9423 / MAR423, PB-719; and DD01.; and

[0699] (ii) an alginate oligomer; wherein said solid dosage form does not carry a coating in addition to the polypeptide therapeutic agent and the alginate oligomer which would provide substantive protection from a gastric environment.

[0700] The above described dosage form may further comprise a gastrointestinal permeation enhancer as described herein.

[0701] In certain embodiments the solid dosage form (composition) is in the form of a tablet, pill, or powder or granule filled capsule. In certain embodiments the solid dosage form has dimensions which allow it to be swallowed by the subject undergoing treatment. In certain embodiments the solid dosage form begins to dissolve or disperse in the gastric environment of the subject undergoing treatment, e.g. begins to dissolve or disperse in gastric juice of, or representative of that of, the subject undergoing treatment, immediately upon entry to the stomach. The above detailed discussion of dosage forms of the invention applies mutatis mutandis to this aspect of the invention.

[0702] The therapeutic polypeptide may be used in the methods described herein or provided in the compositions or dosage forms described herein in non-salt form or in the form of a pharmaceutically acceptable salt. A corresponding pharmaceutically acceptable salt may be formed, e.g., by protonation of an atom carrying an electron lone pair which is susceptible to protonation, such as an amino group, with an inorganic or organic acid, or as a salt of a carboxylic acid group with a physiologically acceptable cation as they are well-known in the art. Exemplary base addition salts comprise, for example: alkali metal salts such as sodium or potassium salts; alkaline earth metal salts such as calcium or magnesium salts; zinc salts; ammonium salts; aliphatic amine salts such as trimethylamine, triethylamine, dicyclohexylamine, ethanolamine, diethanolamine, triethanolamine, procaine salts, meglumine salts, ethylenediamine salts, or choline salts; aralkyl amine salts such as N,N-dibenzylethylenediamine salts, benzathine salts, benethamine salts; heterocyclic aromatic amine salts such as pyridine salts, picoline salts, quinoline salts or isoquinoline salts; quaternary ammonium salts such as tetramethylammonium salts, tetraethylammonium salts, benzyltrimethylammonium salts, benzyltriethylammonium salts, benzyltributylammonium salts, methyltrioctylammonium salts or tetrabutylammonium salts; and basic amino acid salts such as arginine salts, lysine salts, or histidine salts. Exemplary acid addition salts comprise, for example: mineral acid salts such as hydrochloride, hydrobromide, hydroiodide, sulfate salts, nitrate salts, phosphate salts (such as, e.g., phosphate, hydrogenphosphate, or dihydrogenphosphate salts), carbonate salts, hydrogencarbonate salts or perchlorate salts; organic acid salts such as acetate, propionate, butyrate, pentanoate, hexanoate, heptanoate, octanoate, cyclopentanepropionate, decanoate, undecanoate, oleate, stearate, lactate, maleate, oxalate, fumarate, tartrate, malate, citrate, succinate, glycolate, nicotinate, benzoate, salicylate, ascorbate, or pamoate (embonate) salts; sulfonate salts such as methanesulfonate (mesylate), ethanesulfonate (esylate), 2- hydroxyethanesulfonate (isethionate), benzenesulfonate (besylate), p-toluenesulfonate (tosylate), 2-naphthalenesulfonate (napsylate), 3-phenylsulfonate, or camphorsulfonate salts; and acidic amino acid salts such as aspartate or glutamate salts.

[0703] The methods, uses and compositions of the invention may involve multiple / a plurality of therapeutic polypeptides. Thus, the methods, uses and compositions of the invention may involve at least one, or one or more, therapeutic polypeptides (e.g. at least two, three or four therapeutic polypeptides; or two, three, four or more therapeutic polypeptides). These may be structural or functional analogues of each other, or therapeutic polypeptides from different structural or functional classes. References herein to “a” or “the” polypeptide should be construed as extending to such embodiments, unless context specifically dictates otherwise. In particular, compositions described herein as “consisting of’ a set of components of which “a therapeutic polypeptide” is one, include combinations of therapeutic polypeptides as that aforementioned component.

[0704] The gastrointestinal permeation enhancer (also known as mucosal permeation enhancers, or simply a permeation enhancers), more specifically the gastrointestinal epithelial barrier (epithelium) permeation enhancer is a compound which facilitates the translocation of other compounds from the luminal (apical) side of a gastrointestinal epithelial layer to the basal side of said layer. The permeation enhancer may have a paracellular or transcellular mode of action. The permeation enhancer may have properties which also improve mucus penetrability of the therapeutic polypeptide, but this is not essential. Without wishing to be bound by theory, the alginate oligomer provides such activity and so in certain embodiments the gastrointestinal permeation enhancer is not an agent which affects the structure or viscosity of mucus. The permeation enhancer is not an alginate oligomer. In certain embodiments the permeation enhancer is not, or does not comprise, a polypeptide or peptide.

[0705] In certain embodiments the gastrointestinal permeation enhancer may have a pH buffering property in a gastric environment (simulated or natural). That is a dosage form, e.g. a solid dosage form, comprising the gastrointestinal permeation enhancer, when placed in a gastric environment (simulated or natural) will cause the pH in its immediate vicinity to be more neutral that the gastric environment in which it was placed.

[0706] The permeation enhancer may be a Cs-2oalkanoyl carnitine (preferably lauroyl carnitine, myristoyl carnitine or palmitoyl carnitine; e.g., lauroyl carnitine chloride, myristoyl carnitine chloride or palmitoyl carnitine chloride), salicylic acid (preferably a salicylate, e.g., sodium salicylate), a salicylic acid derivative (such as, e.g., 3-methoxysalicylic acid, 5- methoxysalicylic acid, or homovanillic acid, a Cs-2oalkanoic acid (preferably a Cs-2o alkanoate, more preferably a caprate, a caprylate, a myristate, a palmitate, or a stearate, such as, e.g., sodium caprate, sodium caprylate, sodium myristate, sodium palmitate, or sodium stearate), citric acid (preferably a citrate, e.g., sodium citrate), tartaric acid (preferably a tartrate), a fatty acid acylated amino acid (e.g., any of the fatty acid acylated amino acids described in US 2014 / 0056953 A1 which is incorporated herein by reference, including, without being limited thereto, sodium lauroyl alaninate, N-dodecanoyl-L-alanine, sodium lauroyl asparaginate, N-dodecanoyl-L-asparagine, sodium lauroyl aspartic acid, N- dodecanoyl-L-aspartic acid, sodium lauroyl cysteinate, N-dodecanoyl-L-cysteine, sodium lauroyl glutamic acid, N-dodecanoyl-L-glutamic acid, sodium lauroyl glutaminate, N- dodecanoyl-L-glutamine, sodium lauroyl glycinate, N-dodecanoyl-L-glycine, sodium lauroyl histidinate, N-dodecanoyl-L-histidine, sodium lauroyl isoleucinate, N-dodecanoyl-L- isoleucine, sodium lauroyl leucinate, N-dodecanoyl-L-leucine, sodium lauroyl methioninate, N-dodecanoyl-L-methionine, sodium lauroyl phenylalaninate, N-dodecanoyl- L-phenylalanine, sodium lauroyl prolinate, N-dodecanoyl-L-proline, sodium lauroyl serinate, N-dodecanoyl-L-serine, sodium lauroyl threoninate, N-dodecanoyl-L-threonine, sodium lauroyl tryptophanate, N-dodecanoyl-L- tryptophane, sodium lauroyl tyrosinate, N- dodecanoyl-L-tyrosine, sodium lauroyl valinate, N-dodecanoyl-L-valine, sodium lauroyl sarcosinate, N-dodecanoyl-L-sarcosine, sodium capric alaninate, N-decanoyl-L-alanine, sodium capric asparaginate, N-decanoyl-L-asparagine, sodium capric aspartic acid, N- decanoyl-L-aspartic acid, sodium capric cysteinate, N-decanoyl- L-cysteine, sodium capric glutamic acid, N-decanoyl-L-glutamic acid, sodium capric glutaminate, N-decanoyl-L- glutamine, sodium capric glycinate, N-decanoyl-L-glycine, sodium capric histidinate, N- decanoyl-L-histidine, sodium capric isoleucinate, N-decanoyl-L-isoleucine, sodium capric leucinate, N-decanoyl-L-leucine, sodium capric methioninate, N-decanoyl-L-methionine, sodium capric phenylalaninate, N-decanoyl-L-phenylalanine, sodium capric prolinate, N- decanoyl-L-proline, sodium capric serinate, N-decanoyl-L-serine, sodium capric threoninate, N- decanoyl-L-threonine, sodium capric tryptophanate, N-decanoyl-L- tryptophane, sodium capric tyrosinate, N-decanoyl-L-tyrosine, sodium capric valinate, N- decanoyl-L-valine, sodium capric sarcosinate, N-decanoyl-L-sarcosine, sodium oleoyl sarcosinate, sodium N-decylleucine, sodium stearoyl glutamate (e.g., Amisoft HS-11 P), sodium myristoyl glutamate (e.g., Amisoft MS-11 ), sodium lauroyl glutamate (e.g., Amisoft LS-11 ), sodium cocoyl glutamate (e.g., Amisoft CS-11 ), sodium cocoyl glycinate (e.g., Amilite GCS-11 ), sodium N-decyl leucine, sodium cocoyl glycine, sodium cocoyl glutamate, sodium lauroyl alaninate, N-dodecanoyl-L-alanine, sodium lauroyl asparaginate, N-dodecanoyl-L-asparagine, sodium lauroyl aspartic acid, N-dodecanoyl- L- aspartic acid, sodium lauroyl cysteinate, N-dodecanoyl-L-cysteine, sodium lauroyl glutamic acid, N-dodecanoyl-L-glutamic acid, sodium lauroyl glutaminate, N-dodecanoyl- L-glutamine, sodium lauroyl glycinate, N-dodecanoyl-L-glycine, sodium lauroyl histidinate, N-dodecanoyl-L- histidine, sodium lauroyl isoleucinate, N-dodecanoyl-L-isoleucine, sodium lauroyl leucinate, N- dodecanoyl-L-leucine, sodium lauroyl methinoninate, N- dodecanoyl-L-methionine, sodium lauroyl phenylalaninate, N-dodecanoyl-L-phenylalanine, sodium lauroyl prolinate, N- dodecanoyl-L-proline, sodium lauroyl serinate, N-dodecanoyl- L-serine, sodium lauroyl threoninate, N-dodecanoyl-L-threonine, sodium lauroyl tryptophanate, N-dodecanoyl-L- tryptophane, sodium lauroyl tyrosinate, N-dodecanoyl-L- tyrosine, sodium lauroyl valinate, N- dodecanoyl-L-valine, N-dodecanoyl-L-sarcosine, sodium capric alaninate, N-decanoyl-L- alanine, sodium capric asparaginate, N-decanoyl- L-asparagine, sodium capric aspartic acid, N- decanoyl-L-aspartic acid, Sodium capric cysteinate, N-decanoyl-L-cysteine, sodium capric glutamic acid, N-decanoyl-L-glutamic acid, sodium capric glutaminate, N-decanoyl-L-glutamine, sodium capric glycinate, N- decanoyl-L-glycine, sodium capric histidinate, N-decanoyl-L- histidine, sodium capric isoleucinate, N-decanoyl-L-isoleucine, sodium capric leucinate, N- decanoyl-L-leucine, leucine, sodium capric methioninate, N-decanoyl-L-methionine, sodium capric phenylalaninate, N-decanoyl-L-phenylalanine, sodium capric prolinate, N-decanoyl-L- proline, sodium capric serinate, N-decanoyl-L-serine, sodium capric threoninate, N- decanoyl-L- threonine, sodium capric tryptophanate, N-decanoyl-L-tryptophane, sodium capric tyrosinate, N- decanoyl-L-tyrosine, sodium capric valinate, N-decanoyl-L-valine, sodium capric sarcosinate, sodium oleoyl sarcosinate, and pharmaceutically acceptable salts of any of the aforementioned compounds; or, e.g., Cs-2o alkanoyl sarcosinate (e.g., a lauroyl sarcosinate, such as sodium lauroyl sarcosinate) or one of the 20 standard proteinogenic a-amino acids that is acylated with a Cs-2o alkanoic acid), an alkylsaccharide (e.g., a C1.20 alkylsaccharide, such as, e.g., Cs- alkylpolysaccharide like Multitrope™ 1620-LQ-(MV); or, e.g., n-octyl-beta-D-glucopyranoside, n- dodecyl-beta-D-maltoside, n- tetradecyl-beta-D-maltoside, tridecyl-beta-D-maltoside, sucrose laurate, sucrose stearate, sucrose myristate, sucrose palmitate, sucrose cocoate, sucrose mono-dodecanoate, sucrose mono-tridecanoate, sucrose mono-tetradeca noate, a coco-glucoside, or any of the alkylsaccharides described in US 5,661 ,130 or in WO 2012 / 112319 which are herein incorporated by reference), a cyclodextrine (e.g., a-cyclodextrin, p-cyclodextrin, y- cyclodextrin, methyl-p-cyclodextrin, hydroxypropyl p-cyclodextrin, or sulfobutylether p- cyclodextrin), N-[8-(2-hydroxybenzoyl)amino]caprylic acid ( preferably a N-[8-(2- hydroxybenzoyl)amino]caprylate, more preferably sodium N-[8-(2-hydroxybenzoyl )amino]caprylate, also referred to as “SNAC”), a N-[8-(2- hydroxybenzoyl)amino]caprylate derivative (preferably a sodium N-[8-(2- hydroxybenzoyl)amino]caprylate derivative), a calcium chelating compound (e.g., ethylenediaminetetraacetic acid (EDTA), ethylene glycol tetraacetic acid (EGTA), cremophor EL (also referred to as "Kolliphor EL"; CAS no. 61791-12-6), chitosan, N,N,N-trimethyl chitosan, benzalkonium chloride, bestatin, cetylpyridinium chloride, cetyltrimethylammonium bromide, a C2-20 alkanol (e.g., ethanol, decanol, lauryl alcohol, myristyl alcohol, or palmityl alcohol), a Cs-2o alkenol (e.g., oleyl alcohol), a Cs-2o alkenoic acid (e.g., oleic acid), dextran sulfate, diethyleneglycol monoethyl ether (transcutol), 1 -dodecylazacyclo-heptan- 2-one (Azone®), caprylocaproyl polyoxylglycerides (such as, e.g., caprylocaproyl polyoxyl-8 glycerides; available, e.g., as Labrasol® or ACCONON® MC8-2), ethyl caprylate, glyceryl monolaurate, lysophosphatidylcholine, menthol, a C8-20 alkylamine, a C8-20 alkenylamine (e.g., oleylamine), phosphatidylcholine, a poloxamer, polyethylene glycol monolaurate, polyoxyethylene, polypropylene glycol monolaurate, a polysorbate (e.g., polysorbate 20 or polysorbate 80), cholic acid (preferably a cholate, e.g., sodium chlolate), a deoxycholate (e.g., sodium deoxycholate), a chenodeoxycholate (e.g., sodium chenodeoxycholate), sodium glycocholate, sodium glycodeoxycholate, sodium lauryl sulfate (SDS), sodium decyl sulfate, sodium octyl sulfate, sodium laureth sulfate, N-lauryl sarcosinate, decyltrimethyl ammonium bromide, benzyldimethyl dodecyl ammonium chloride, myristyltri methyl ammonium chloride, dodecyl pyridinium chloride, decyldimethyl ammonio propane sulfonate, myristyldimethyl ammonio propane sulfonate, palmityldimethyl ammonio propane sulfonate, ChemBetaine CAS, ChemBetaine Oleyl, Nonylphenoxypolyoxyethylene, polyoxyethylene sorbitan monolaurate, polyoxyethylene sorbitan monopalmitate, sorbitan monooleate, Triton X-100, hexanoic acid, heptanoic acid, methyl laurate, isopropyl myristate, isopropyl palmitate, methyl palmitate, diethyl sebaccate, sodium oleate, urea, lauryl amine, caprolactam, methyl pyrrolidone, octyl pyrrolidone, methyl piperazine, phenyl piperazine, Carbopol 934P, glyccyrhetinic acid, bromelain, pinene oxide, limonene, cineole, octyl dodecanol, fenchone, menthone, trimethoxy propylene methyl benzene, macrogol- 15-hydroxystearate, a taurocholate (e.g., sodium taurocholate), a taurodeoxycholate (e.g., sodium taurodeoxycholate), a sulfoxide (e.g., decyl methyl sulfoxide, or dimethyl sulfoxide), cyclopentadecalactone, 8-(N-2- hydroxy-5-chloro- benzoyl)-amino-caprylic acid (5-CNAC), N-(10-[2- hydroxybenzoyl]amino)decanoic acid (SNAD), dodecyl-2-N,N- dimethylamino propionate (DDAIP), D-a-tocopheryl polyethylene glycol-1000 succinate (TPGS), arginine, and pharmaceutically acceptable salts of the aforementioned compounds. Mixtures of two or more permeation enhancers, including any of the above-described permeation enhancers, can also be used.

[0707] Alkyl glycosides which may also be used as permeation enhancers in the present invention can include octyl-, nonyl-, decyl-, undecyl-, dodecyl-, tridecyl-, tetradecyl-, pentadecyl-, hexadecyl-, heptadecyl-, and octadecyl-a- or p-D-maltoside, -glucoside or - sucroside; alkyl thiomaltosides, such as heptyl-, octyl-, dodecyl-, tridecyl-, and tetradecyl- P-D-thiomaltoside; alkyl thioglucosides, such as heptyl- or octyl 1 -thio a- p- or p-D- glucopyranoside; alkyl thiosucroses; alkyl maltotriosides; long chain aliphatic carbonic acid amides of sucrose p-amino-alkyl ethers; derivatives of palatinose and isomaltamine linked by amide linkage to an alkyl chain; derivatives of isomaltamine linked by urea to an alkyl chain; long chain aliphatic carbonic acid ureides of sucrose p-amino- alkyl ethers; and long chain aliphatic carbonic acid amides of sucrose p-amino-alkyl ethers.

[0708] In still further embodiments, the permeation enhancer may be a compound of the following formula (VII): wherein:

[0709] R1, R2, R3and R4are each independently selected from hydrogen, -OH, -NR6R7, halogen (e.g., -F, -Cl, -Br or -I), C1.4 alkyl or C1.4 alkoxy; R5is a substituted or unsubstituted C2-16 alkylene, substituted or unsubstituted C2-16 alkenylene, substituted or unsubstituted Ci-i2 alkyl(arylene) [e.g., substituted or unsubstituted C1-12 alkyl(phenylene)], or substituted or unsubstituted aryl(C1-12 alkylene) [e.g., substituted or unsubstituted phenyl(C1-12 alkylene)]; and

[0710] R6and R7are each independently hydrogen, oxygen, -OH or C1.4 alkyl; or a pharmaceutically acceptable salt or solvate thereof, particularly a disodium salt, an alcohol solvate (e.g., a methanol solvate, an ethanol solvate, a propanol solvate, or a propylene glycol solvate, or any such solvate of the disodium salt; particularly an ethanol solvate or an ethanol solvate of the disodium salt), or a hydrate thereof (e.g., a monohydrate of the disodium salt). The above-mentioned “substituted” groups comprised in formula (V) are preferably substituted with one or more (e.g., one, two, or three) substituent groups independently selected from halogen (e.g., -F, -Cl, -Br or -I), -OH, C1.4 alkyl or C1.4 alkoxy.

[0711] Such compounds and methods for their preparation are described, e.g., in WO 00 / 59863, which is incorporated herein by reference. Accordingly, the permeation enhancer may also be a “delivery agent” as described in WO 00 / 59863. Preferred examples of the compounds of formula (V) include N-(5- chlorosalicyloyl)-8-aminocaprylic acid, N-(10-[2- hydroxybenzoyl]amino)decanoic acid, N-(8-[2- hydroxybenzoyl]amino)caprylic acid, a monosodium or disodium salt of any one of the aforementioned compounds, an ethanol solvate of the sodium salt (e.g., monosodium or disodium salt) of any one of the aforementioned compounds, a monohydrate of the sodium salt (e.g., monosodium or disodium salt) of any one of the aforementioned compounds, and any combination thereof. A particularly preferred compound of formula (I) is the disodium salt of N-(5- chlorosalicyloyl)-8-aminocaprylic acid or the monohydrate thereof. It is particularly preferred that the permeation enhancer is selected from sodium caprate, sodium caprylate, mixtures of sodium caprate and sodium caprylate, SNAC, sucrose laurate, labrasol and polysorbate.

[0712] Furthermore, the permeation enhancer may also be a salt of a medium-chain fatty acid. The salt of a medium-chain fatty acid is preferably a salt of a C4-18 saturated fatty acid, preferably a C4-18 linear or branched alkanoic acid which optionally has 1 , 2 or 3 C=C double bonds, more preferably a CB-IB linear or branched alkanoic acid which optionally has 1 , 2 or 3 C=C double bonds, even more preferably a CB-14 linear or branched alkanoic acid which optionally has 1 , 2 or 3 C=C double bonds. The salt of a medium-chain fatty acid is preferably a salt of a C4-18 linear or branched alkanoic acid, more preferably a CB-IB linear or branched alkanoic acid, even more preferably a CB-14 linear or branched alkanoic acid. The salt of a medium-chain fatty acid is preferably selected from a salt of a valeric acid, caproic acid, enanthic acid, caprylic acid, pelargonic acid, capric acid, undecylic acid, lauric acid, tridecylic acid, myristic acid, pentadecylic acid, palmitic acid, margaric acid and / or stearic acid. More preferably, the salt of a medium-chain fatty acid is a salt of capric acid.

[0713] The salt of a medium-chain fatty acid is more preferably a sodium salt or a potassium salt. It is furthermore preferred that the salt of a medium-chain fatty acid is a salt of capric acid. Capric acid may also be referred to as decanoic acid (CH3(CH2)sCOOH). A preferred salt of capric acid is sodium caprate (i.e. CH3(CH2)sCOONa).

[0714] In particular embodiments the paracellular permeation enhancer may be a chelating agent, e.g. EDTA, citric acid and a salicylate The transcellular enhancer may be medium chain fatty acids (oleic acid, lauric acids, acylcarnitines, acyl choline, acylated amino acids), bile salts (e.g. sodium glycocholate, sodium deoxycholate, sodium taurocholate, sodium dihydrofusidate, sodium glycodihydrofusidate, sodium glycolate), ionic surfactants (e.g. sodium lauryl sulphate and dioctyl sodium sulfosuccinate), non-ionic surfactants (e.g., sucrose fatty acid esters, lactose fatty acid esters, polysorbates, polyoxyethylene-8 lauryl ether (C12E8), Tween80, sucrose laurate, macrogol-8 glycerides, lauroylcarnitine chloride, caprylic acid, sodium caprylate, sodium caprate (sodium decanoate; C10), sodium cholate, choline geranate, 5-CNAC (N-(5-chlorosalicyloyl)-8-aminocaprylic acid), chitosan, chitosan glutamate, N-sulfanto-N,O-carboxymethylchitosan (SNOCC), N- Trimethylated Chitosan Chloride (TMC), ethanol, salicylates, penetratin, Zonula occludens toxin (Zot), polycarbophyl-cysteine conjugate(PCP-Cys)

[0715] More specifically, the gastrointestinal permeation enhancer may be any from the following non-exhaustive list:

[0716] Sodium N-(8-[2-hydroxybenzoyl]amino)caprylate (SNAC), decanoic acid and salts thereof (C10); octanoic acid and salts thereof (C8), dodecanoic acid and salts thereof (C12), icosanoic acid and salts thereof (C20), palmitoylcarnitine chloride, lauroylcarnitine, sodium salicylate, 3-methoxysalicylic acid, 5-methoxysalicylic acid, homovanillic acid, sodium lauroyl alaninate, N-dodecanoyl-L-glutamic acid, sodium capric sarcosinate, sodium stearoyl glutamate (e.g., Amisoft 20 HS-11 P), C8-10 alkylpolysaccharide (e.g.

[0717] Multitrope™ 1620-LQ-(MV)), N-dodecyl-beta-D-maltoside, ethylene glycol tetraacetic acid (EGTA), polyoxyl-35 castor oil (also referred to as Cremophor EL and Kolliphor EL, CAS no. 61791-12-6); trimethyl chitosan, N,N,N-trimethyl chitosan, benzalkonium chloride, cetylpyridinium chloride, cetyltrimethylammonium bromide, ethanol, oleyl alcohol, diethyleneglycol monoethyl ether (transcutol), 1 -dodecylazacyclo-heptan-2-one (Azone®), Labrasol® or ACCONON® MC8-2, phosphatidylcholine, sodium cholate, dodecylphosphocholine, rhamnolipids, carbopol 934P, octyl pyrrolidone, sodium taurocholate, 8-(N-2-hydroxy-5-chloro- benzoyl)-amino-caprylic acid (5-CNAC), N-(10-[2- hydroxybenzoyl]amino)decanoic acid (SNAD), D-a-tocopheryl polyethylene glycol-1000 succinate (TPGS), sodium decanoate (Na caprate), octyl gallate, sodium octanoate (Na caprylate), lauryl gallate, dodecylmaltoside (DDM), tetradecylmaltoside (TDM), palmitoyl carnitine, sodium chenodeoxycholate (NaCDC), polyoxyl 15 hydroxystearate (Kolliphor HS 15), sodium deoxycholate, polyoxyethylene (10) oleyl ether (Brij 10), sodium tetraglycocholate, polyethylene glycol hexadecyl ether, sodium ursodeoxycholate, polyoxyethylene (10) cetyl ether, sodium glycocholate, Purebright PEG, sodium taurocholate, diethylene glycol, monoethyl ether (Transcutol ES), chenodeoxycholic acid, lauroglycol FCC, ethyl gallate, propyl gallate (PG), chitosan, arachidonic acid. SNAC and C10 (in particular the sodium salt form; sodium caprate) are notable enhancers which may be used in the invention alone or in combination.

[0718] In certain embodiments the delivery agent (permeation enhancer) may be a salt of N-(8- (2-hydroxybenzoyl)amino)caprylic acid The structural formula of N-(8-(2- hydroxybenzoyl)amino)caprylate is shown in Formula (VIII),

[0719] Formula VIII

[0720] In some embodiments the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid comprises one monovalent cation, two monovalent cations or one divalent cation. In some embodiments the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid is selected from the group consisting of the sodium salt, potassium salt and calcium salt of N-(8- (2- hydroxybenzoyl)amino)caprylic acid. Salts of N-(8-(2-hydroxybenzoyl)amino)caprylate may be prepared using the method described in e.g. W096 / 030036, WO00 / 046182, W001 / 092206 or W02008 / 028859, which are incorporated herein by reference.

[0721] The salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid may be crystalline and / or amorphous. In some embodiments the delivery agent comprises the anhydrate, monohydrate, dihydrate, trihydrate, a solvate or one third of a hydrate of the salt of N-(8- (2-hydroxybenzoyl)amino) caprylic acid as well as combinations thereof. In some embodiments the delivery agent is a salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid as described in W02007 / 121318, which is incorporated herein by reference.

[0722] In some embodiments the delivery agent (is sodium N-(8-(2- hydroxybenzoyl)amino)caprylate (referred to as "SNAC" herein), also known as sodium 8- (salicyloylamino) octanoate.

[0723] In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in a composition or dosage form containing the therapeutic polypeptide and optionally the alginate oligomer is at least 0.6 mmol, such as selected from the group consisting of at least 0.65 mmol, at least 0.7 mmol, at least 0.75 mmol, at least 0.8 mmol, at least 0.8 mmol, at least 0.9 mmol, at least 0.95 mmol and at least 1 mmol. Any range which may be constructed with endpoints having the above values are expressly contemplated. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is in the range of 0.6-2.1 mmol or 0.6-1.9 mmol. In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl) amino)caprylic acid in the composition is in the range of 0.7-1.7 mmol or 0.8-1.3 mmol.

[0724] In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid in a composition or dosage form containing the therapeutic polypeptide and optionally the alginate oligomer is up to 2.1 mmol, such as selected from the group consisting of up to 2.1 mmol, up to 2 mmol, up to 1.9 mmol, up to 1.8 mmol, up to 1.7 mmol, up to 1.6 mmol, up to 1.5 mmol, up to 1.4 mmol, up to 1.3 mmol, up to 1.2 mmol and up to 1.1 mmol. Any range which may be constructed with endpoints having the above values are expressly contemplated. In some embodiments the amount of the salt of N-(8-(2- hydroxybenzoyl)amino)caprylic acid is 1 mmol, such as 1.08 mmol.

[0725] In other embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid in a composition or dosage form containing the therapeutic polypeptide and optionally the alginate oligomer is less than 0.6 mmol, such as selected from the group consisting of less than 0.55 mmol, of less than 0.5 mmol, of less than 0.45 mmol. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0726] In some embodiments the amount of the salt of N-(8-(2-hydroxybenzoyl)amino)caprylic acid in a composition or dosage form containing the therapeutic polypeptide and optionally the alginate oligomer is less than 50% w / w, e.g. less than 45% w / w, 40% w / w, 35% w / w, 30 % w / w, 25% w / w, 20% w / w, 15% w / w or 10% w / w. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0727] In some embodiments the amount of SNAC in the composition or dosage form is at least 30 mg, e.g. at least 50, 70, 90, 110, 130, 150, or 170 mg. In some embodiments the amount of SNAC in the composition is at least 175 mg, such as an amount selected from the group consisting of at least 200 mg, at least 210 mg, at least 220 mg, at least 230 mg, at least 240 mg, at least 250 mg, at least 260 mg, at least 270 mg and at least 280 mg. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0728] In some embodiments the amount of SNAC in the composition or dosage form is in the range of 30 to 200 mg, e.g. 50, 70, 90, 110, 130, 150, 170, or 190 mg to 200 mg, or 50 to 70, 90, 110, 130, 150, 170, 190 mg or 200 mg. In some embodiments the amount of SNAC in the composition is in the range of 175-575 mg, such as 200-500 mg or 250-400 mg. In some embodiments the amount of SNAC in the composition is up to 575 mg, such as an amount selected from the group consisting of up to 550 mg, up to 525 mg, up to 500 mg, up to 475 mg, up to 450 mg, up to 425 mg, up to 400 mg, up to 375 mg, up to 350 mg and up to 325 mg. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0729] In some embodiments the amount of SNAC in the composition or dosage form is about 300, 200, 100, 50 or 30 mg. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0730] In some embodiments the molar ratio between the therapeutic polypeptide (e.g. GLP-1 receptor agonist) and permeation enhancer in the composition or dosage form is less than 10, such as less than 5 or less than 1.

[0731] In some embodiments the amount of SNAC in a composition or dosage form containing the therapeutic polypeptide and optionally the alginate oligomer is less than 175 mg, e.g. less than 170 mg, 165 mg, 160 mg, 155 mg, 150 mg, 145 mg, 140 mg, 135 mg, 130 mg, 125 mg, 120 mg, 115 mg, 110 mg, 105 mg, 100 mg, 90 mg, 80 mg, 70 mg, 60 mg, 50 mg, or 40 mg. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0732] In these embodiments the composition or dosage form, e.g. in the form of a tablet, has a weight in the range of 50 to 1000 mg, e.g. 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 to 1000 mg, or 100 to 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950 or 1000 mg. Any range which may be constructed with endpoints having the above values are expressly contemplated.

[0733] In these embodiments the composition or dosage form, e.g. in the form of a tablet, has a weight in the range of 175 mg to 1000 mg, such as in the range of 175- 250 mg, 300-500 mg or 500-900 mg, or such as about 200 mg, about 400 mg or about 700 mg. In some embodiments the weight of the tablet is in the range of 200 mg to 1000 mg, such as in the range of 500-700 mg or 600-1000 mg, or such as about 200 mg, about 400 mg, about 600 mg or about 800 mg.

[0734] Thus, the invention further provides a dosage form adapted for delivery to a stomach of a human or non-human animal subject, said dosage form comprising

[0735] (i) a polypeptide therapeutic agent,

[0736] (ii) an alginate oligomer; and

[0737] (iii) a gastrointestinal permeation enhancer selected from the group consisting of EDTA, citric acid, a salicylate, oleic acid, lauric acid, acylcarnitine, acyl choline, and acylated amino acid, sodium glycocholate, sodium deoxycholate, sodium taurocholate, sodium dihydrofusidate, sodium glycodihydrofusidate, sodium glycolate, sodium lauryl sulphate, dioctyl sodium sulfosuccinate, sucrose fatty acid esters, lactose fatty acid esters, a polysorbate, polyoxyethylene-8 lauryl ether, Tween80, sucrose laurate, macrogol-8 glycerides, lauroylcarnitine chloride, caprylic acid, sodium caprylate, sodium caprate (sodium decanoate; C10), sodium cholate, choline geranate, 5-CNAC (N-(5- chlorosalicyloyl)-8-aminocaprylic acid), sodium salcaprozate (SNAC), chitosan, chitosan glutamate, N-sulfanto-N,O-carboxymethylchitosan (SNOCC), N-Trimethylated Chitosan Chloride (TMC), ethanol, penetratin, Zonula occludens toxin (Zot), polycarbophyl-cysteine conjugate(PCP-Cys), wherein said dosage form does not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer which would provide substantive protection from a gastric environment.

[0738] Expressed differently, the invention further provides a dosage form adapted for delivery to a stomach of a human or non-human animal subject, said dosage form consisting of

[0739] (i) a polypeptide therapeutic agent,

[0740] (ii) an alginate oligomer;

[0741] (iii) a gastrointestinal permeation enhancer selected from the group consisting of EDTA, citric acid, a salicylate, oleic acid, lauric acid, acylcarnitine, acyl choline, and acylated amino acid, sodium glycocholate, sodium deoxycholate, sodium taurocholate, sodium dihydrofusidate, sodium glycodihydrofusidate, sodium glycolate, sodium lauryl sulphate, dioctyl sodium sulfosuccinate, sucrose fatty acid esters, lactose fatty acid esters, polysorbates, polyoxyethylene-8 lauryl ether, Tween80, sucrose laurate, macrogol-8 glycerides, lauroylcarnitine chloride, caprylic acid, sodium caprylate, sodium caprate (sodium decanoate; C10), sodium cholate, choline geranate, 5-CNAC (N-(5- chlorosalicyloyl)-8-aminocaprylic acid), sodium salcaprozate (SNAC), chitosan, chitosan glutamate, N-sulfanto-N,O-carboxymethylchitosan (SNOCC), N-Trimethylated Chitosan Chloride (TMC), ethanol, penetratin, Zonula occludens toxin (Zot), polycarbophyl-cysteine conjugate(PCP-Cys), and optionally

[0742] (iv) a pharmaceutically acceptable excipient, wherein said excipient is not a further compound which provides substantive protection from a gastric environment, and wherein said dosage form does not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer, and the excipient if used, which would provide substantive protection from a gastric environment.

[0743] In other embodiments any of the gastrointestinal permeation enhancers disclosed herein may be present in part (iii), e.g. sodium N-(8-[2-hydroxybenzoyl]amino)caprylate (SNAC), decanoic acid and salts thereof (C10); octanoic acid and salts thereof (C8), dodecanoic acid and salts thereof (C12), icosanoic acid and salts thereof (C20), palmitoylcarnitine chloride, lauroylcarnitine, sodium salicylate, 3-methoxysalicylic acid, 5-methoxysalicylic acid, homovanillic acid, sodium lauroyl alaninate, N-dodecanoyl-L-glutamic acid, sodium capric sarcosinate, sodium stearoyl glutamate (e.g., Amisoft 20 HS-11 P), C8-10 alkylpolysaccharide (e.g. Multitrope™ 1620-LQ-(MV)), N-dodecyl-beta-D-maltoside, ethylene glycol tetraacetic acid (EGTA), polyoxyl-35 castor oil (also referred to as Cremophor EL and Kolliphor EL, CAS no. 61791-12-6); trimethyl chitosan, N,N,N-trimethyl chitosan, benzalkonium chloride, cetylpyridinium chloride, cetyltrimethylammonium bromide, ethanol, oleyl alcohol, diethyleneglycol monoethyl ether (transcutol), 1 - dodecylazacyclo-heptan-2-one (Azone®), Labrasol® or ACCONON® MC8-2, phosphatidylcholine, sodium cholate, dodecylphosphocholine, rhamnolipids carbopol 934P, octyl pyrrolidone, sodium taurocholate, 8-(N-2-hydroxy-5-chloro- benzoyl)-amino- caprylic acid (5-CNAC), N-(10-[2- hydroxybenzoyl]amino)decanoic acid (SNAD), D-a- tocopheryl polyethylene glycol-1000 succinate (TPGS), sodium decanoate (Na caprate), octyl gallate, sodium octanoate (Na caprylate), lauryl gallate, dodecylmaltoside (DDM), tetradecylmaltoside (TDM), palmitoyl carnitine, sodium chenodeoxycholate (NaCDC), polyoxyl 15 hydroxystearate (Kolliphor HS 15), sodium deoxycholate, polyoxyethylene (10) oleyl ether (Brij 10), sodium tetraglycocholate, polyethylene glycol hexadecyl ether, sodium ursodeoxycholate, polyoxyethylene (10) cetyl ether, sodium glycocholate, Purebright PEG, sodium taurocholate, diethylene glycol, monoethyl ether (Transcutol ES), chenodeoxycholic acid, lauroglycol FCC, ethyl gallate, propyl gallate (PG), chitosan, arachidonic acid. SNAC and C10 (in particular the sodium salt form; sodium caprate) are notable enhancers which may present in part (iii) alone or in combination.

[0744] The methods, uses and compositions of the invention may involve multiple / a plurality of gastrointestinal permeation enhancers. Thus, the methods, uses and compositions of the invention may involve at least one, or one or more, gastrointestinal permeation enhancers (e.g. at least two, three, four or five gastrointestinal permeation enhancers; or two, three, four, five or more gastrointestinal permeation enhancers). These may be structural or functional analogues of each other, or gastrointestinal permeation enhancers from different structural or functional classes. References herein to “a” or “the” gastrointestinal permeation enhancer should be construed as extending to such embodiments, unless context specifically dictates otherwise. In particular, compositions described herein as “consisting of” a set of components of which “a gastrointestinal permeation enhancer” is one, include combinations of gastrointestinal permeation enhancers as that aforementioned component.

[0745] The above detailed discussion of dosage forms of the invention applies mutatis mutandis to these aspects of the invention.

[0746] In specific embodiments of the above, the alginate oligomer is a high G alginate oligomer, e.g. at least 80% or 85% G. In specific embodiments of the above, the alginate oligomer has 2 to 40 monomer residues, e.g. with a weight average molecular weight of 2600Da. In specific embodiments of the above, the gastrointestinal permeation enhancer is SNAC and / or sodium caprate. In more specific embodiments of the above, all of these features apply.

[0747] In even more specific embodiments of the above, the alginate oligomer has 5 to 20 monomer residues, e.g. with a weight average molecular weight of 3200 Da. In specific embodiments of the above, the alginate oligomer has 90-95% G residues. In specific embodiments of the above, the gastrointestinal permeation enhancer is SNAC and / or sodium caprate. In more specific embodiments of the above, all of these features apply.

[0748] As shown in the Examples, it has surprisingly been found that systemic bioavailability (stomach absorption) for tirzepatide and retatrutide (LY3437943) can be increased significantly when these compounds are orally administered with C10 (sodium caprate). The analogous combination of semaglutide with SNAC during oral administration had only a marginal effect on bioavailability over 3 hrs and 8 hrs, and the modest uptake that did occur was slow. In contrast, tirzepatide and C , and retatrutide and Cw, showed rapid and significant absorption in rats.

[0749] Thus, in a further aspect the invention provides a method for increasing the systemic bioavailability of tirzepatide, retatrutide, or structural analogues thereof when undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering tirzepatide, and / or retatrutide, and / or a structural analogue thereof together with capric acid or pharmaceutically acceptable salt thereof, to a stomach of a human or non-human animal subject as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the tirzepatide, retatrutide, or a structural analogue thereof and the capric acid or pharmaceutically acceptable salt thereof which would provide substantive protection from a gastric environment.

[0750] The invention further provides capric acid or pharmaceutically acceptable salt thereof for use in a method for increasing the systemic bioavailability of tirzepatide, retatrutide, or structural analogues thereof when undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering tirzepatide, and / or retatrutide, and / or a structural analogue thereof together with said capric acid or pharmaceutically acceptable salt thereof to a stomach of a human or non-human animal as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the tirzepatide, retatrutide, or structural analogue thereof and the capric acid or pharmaceutically acceptable salt thereof which would provide substantive protection from a gastric environment.

[0751] Analogously to the other aspects of the invention, this aspect of the invention may be framed as (i) a method for the gastric uptake of [active or reversibly deactivated] tirzepatide, retatrutide, or structural analogues thereof; (ii) a method for absorbing [active or reversibly deactivated] tirzepatide, retatrutide, or structural analogues thereof from a stomach of a human or non-human animal subject; (iii) a method for increasing absorption of [active or reversibly deactivated] tirzepatide, retatrutide, or structural analogues thereof from a stomach of a human or non-human animal subject; (iv) a method for improving the effectiveness of tirzepatide, retatrutide, or structural analogues thereof undergoing oral, orogastric, nasogastric, or intragastric administration in the systemic treatment or prevention of a disease or condition or complication thereof which is responsive thereto, or which is prevented by tirzepatide, retatrutide, or structural analogues thereof; (v) a method for systemic treatment or prevention of a disease or condition or complication thereof which is responsive to tirzepatide, retatrutide, or structural analogues thereof, or which is prevented by tirzepatide, retatrutide, or structural analogues thereof, and the associated detailed discussion of these methods applies mutatis mutandis to these aspects to the extent relevant to tirzepatide, retatrutide, or structural analogues thereof and / or capric acid or pharmaceutically acceptable salt thereof.

[0752] The invention further provides a dosage form adapted for delivery to a stomach of a human or non-human animal subject, said dosage form comprising

[0753] (i) tirzepatide, and / or retatrutide, and / or a structural analogue thereof, and

[0754] (ii) capric acid or pharmaceutically acceptable salt thereof, wherein said dosage form does not carry a coating in addition to the tirzepatide, and / or retatrutide, and / or structural analogue thereof, and the capric acid or pharmaceutically acceptable salt thereof which would provide substantive protection from a gastric environment.

[0755] Expressed differently, the invention further provides a dosage form adapted for delivery to a stomach of a human or non-human animal subject, said dosage form consisting of

[0756] (i) tirzepatide, and / or retatrutide, and / or a structural analogue thereof,

[0757] (ii) capric acid or pharmaceutically acceptable salt thereof; and optionally

[0758] (iii) a pharmaceutically acceptable excipient, wherein said excipient is not a further compound which provides substantive protection from a gastric environment, and wherein said dosage form does not carry a coating in addition to the tirzepatide, retatrutide, or structural analogue thereof, and the caprylic acid or pharmaceutically acceptable salt thereof, and the excipient if used, which would provide substantive protection from a gastric environment.

[0759] As discussed above, tirzepatide and retatrutide are considered structural analogues of each other, as such component (i) of these aspects of the invention may be any of the compounds described above in connection with tirzepatide and retatrutide (LY3437943).

[0760] The pharmaceutically acceptable salt of capric acid may be any of the base addition salts disclosed above in connection with the polypeptide therapeutic, and in particular may be alkali metal salts, e.g. sodium or potassium salts; alkaline earth metal salts, e.g. calcium or magnesium salts; zinc salts; or ammonium salts.

[0761] The above detailed discussion of dosage forms of the invention applies mutatis mutandis to these aspects of the invention to the extent relevant to tirzepatide, retatrutide, or structural analogues thereof, and / or capric acid or pharmaceutically acceptable salt thereof.

[0762] The subject may be any human or non-human animal subject, but more particularly may be a human or a non-human vertebrate, e.g. a non-human mammal, bird, amphibian, fish or reptile. In a preferred embodiment the subject is a mammalian subject. The animal may be a livestock or a domestic animal or an animal of commercial value, including laboratory animals or an animal in a zoo or game park. Representative animals therefore include dogs, cats, rabbits, mice, guinea pigs, hamsters, horses, pigs, sheep, goats and cows. Veterinary uses of the invention are thus covered. The subject may be viewed as a patient. Preferably the subject is a human. In some embodiments the subject is not a ruminant mammal.

[0763] The gastrointestinal (Gl) tract of vertebrates, also referred to as the digestive tract or alimentary canal, is the continuous series of organs beginning at the mouth and ending at the anus. Specifically, this sequence consists of the mouth, the pharynx, the oesophagus, the stomach (or stomachs in ruminant mammals), the duodenum, the small intestine, the large intestine and the anus. For the purposes of this invention, these organs can be subdivided into the upper Gl tract, consisting of the mouth, pharynx, oesophagus, and stomach(s), and the lower Gl tract (the intestinal tract), consisting of the duodenum, the jejunum, the ileum (together the small intestine), the cecum, the colon, the rectum (together the large intestine) and the anus. When the invention is applied to a ruminant animal, references to “a stomach” should be taken as references to the “abomasum”.

[0764] "Treatment" when used generally in relation to the treatment of a disease or medical condition in a subject in accordance with the invention is used broadly herein to include any therapeutic effect, i.e. any beneficial effect in relation to the disease or on the condition. Thus, not only included is eradication or elimination of the disease or condition, or cure of the subject, but also an improvement in the disease or condition of the subject. Thus, included for example, is an improvement in any symptom or sign of the disease or condition, or in any clinically accepted indicator of the disease / condition. Treatment thus includes both curative and palliative therapy, e.g. of a pre-existing or diagnosed disease / condition, i.e. a reactionary treatment.

[0765] "Prevention" as used generally herein refers to any prophylactic or preventative effect. It thus includes delaying, limiting, reducing or preventing the disease or condition or the onset of the disease or condition, or one or more symptoms or indications thereof, for example relative to the disease or condition or symptom or indication prior to the prophylactic treatment. Prophylaxis thus explicitly includes both absolute prevention of occurrence or development of the disease or condition, or symptom or indication thereof, and any delay in the onset or development of the disease or condition or symptom or indication, or reduction or limitation on the development or progression of the disease condition or symptom or indication.

[0766] The skilled person will be able to formulate, alone or in various combinations, the alginate oligomers and the therapeutic polypeptides and the gastrointestinal permeation enhancers of use in the invention into pharmaceutical compositions and dosage forms that are suitable for use in the above described aspects and embodiments of the invention according to any of the conventional methods known in the art and widely described in the literature.

[0767] More specifically, the alginate oligomers of use in the invention may be incorporated, optionally together with the polypeptide therapeutic agent and / or the gastrointestinal permeation agent, with one or more conventional carriers, diluents and / or excipients, to produce conventional galenic preparations such as tablets, pills, granules, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, soft and hard gelatine capsules, and the like.

[0768] Likewise, the polypeptide therapeutic agents of use in the invention may be incorporated, optionally together with the alginate oligomer and / or the gastrointestinal permeation agent, with one or more conventional carriers, diluents and / or excipients, to produce conventional galenic preparations such as tablets, pills, granules, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, soft and hard gelatine capsules, and the like. Likewise, the gastrointestinal permeation agents of use in the invention may be incorporated, optionally together with the alginate oligomer and / or the polypeptide therapeutic agent, with one or more conventional carriers, diluents and / or excipients, to produce conventional galenic preparations such as tablets, pills, granules, powders, lozenges, sachets, cachets, elixirs, suspensions, emulsions, solutions, syrups, soft and hard gelatine capsules, and the like.

[0769] Such formulations may be any pharmaceutically acceptable composition, e.g. in the form of a solution, dispersion, emulsion, powder, tablet, capsule, gel, and the like, comprising any of the formulation components specifically recited herein. Conveniently, the formulation will take the form of a tablet or a liquid or powder / pellet filled capsule, but this is not an exhaustive list.

[0770] Examples of suitable carriers, excipients, and diluents are lactose, dextrose, sucrose, sorbitol, mannitol, starches, gum acacia, calcium phosphate, tragacanth, gelatine, calcium silicate, microcrystalline cellulose, polyvinylpyrrolidone, cellulose, water syrup, water, water / ethanol, water / glycol, water / polyethylene, hypertonic salt water, glycol, propylene glycol, methyl cellulose, methylhydroxybenzoates, propyl hydroxy benzoates, talc, magnesium stearate, mineral oil or fatty substances such as hard fat or suitable mixtures thereof. Excipients and diluents of note are mannitol and hypertonic salt water (saline).

[0771] The compositions may additionally include lubricating agents, wetting agents, emulsifying agents, suspending agents, preserving agents, sweetening agents, flavouring agents, buffering agents, and the like. In certain embodiments agents which would provide substantive protection to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, and the dosage form more generally, from the gastric environment, e.g. buffering agents and enzyme (protease) inhibitors are not included.

[0772] Excipients for tablet, capsule and solid or semi-solid mixture formulations may include diluents, binders, lubricants, disintegrants, gildants, stabilisers, and surfactants.

[0773] Sweeteners, flavourings, and colourants can also be added in order to get an acceptable product even though they do not directly affect the performance of the formulation. Cellulose, starch, monosaccharides, disaccharides, carbonates, and polyvinylpyrrolidone may act as fillers, binders and disintegrants in solid dosage forms. Fatty acids, stearates and silicates may act as lubricants in solid dosage forms.

[0774] Excipients for aqueous liquid formulations may, in addition to the water (e.g. purified or sterilised water) vehicle include co-solvents, buffers, surface active agents, rheology modifiers, preservatives, and antioxidants. Sweeteners, flavourings, and colourants can also be added in order to get an acceptable product even though they do not directly affect the performance of the formulation.

[0775] Compositions or dosage forms comprising the polypeptide therapeutic agent, in particular the lipid modified incretin analogues described herein, may comprise one or more solubility enhancers, such as, e.g., poly(ethylene glycol), including poly(ethylene glycol) having a molecular weight in the range of about 200 to about 5,000 Da, ethylene glycol, propylene glycol, non-ionic surfactants, tyloxapol, polysorbate 20, polysorbate 80, macrogol-15-hydroxystearate, phospholipids, lecithin, dimyristoyl phosphatidylcholine, dipalmitoyl phosphatidylcholine, distearoyl phosphatidylcholine, cyclodextrins, a- cyclodextrin, p-cyclodextrin, y-cyclodextrin, hydroxyethyl-p-cyclodextrin, hydroxypropyl-p- cyclodextrin, hydroxyethyl-y-cyclodextrin, hydroxypropyl-y-cyclodextrin, dihydroxypropyl-p- cyclodextrin, sulfobutylether-p-cyclodextrin, sulfobutylether-y-cyclodextrin, glucosyl-a- cyclodextrin, glucosyl-p-cyclodextrin, diglucosyl-p-cyclodextrin, maltosyl-a-cyclodextrin, maltosyl-p-cyclodextrin, maltosyl-y-cyclodextrin, maltotriosyl-p-cyclodextrin, maltotriosyl-y- cyclodextrin, dimaltosyl-p-cyclodextrin, methyl-p-cyclodextrin, carboxyalkyl thioethers, hydroxypropyl methylcellulose, hydroxypropylcellulose, polyvinylpyrrolidone, vinyl acetate copolymers, vinyl pyrrolidone, sodium lauryl sulfate, dioctyl sodium sulfosuccinate, or any combination thereof.

[0776] The alginate oligomer may be administered in doses of 0.01 to 10 g, e.g. 0.05, 0.1, 0.2,

[0777] 0.4, 0.6, 0.8, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 5.0, 6.0, 7.0, 8.0, 9.0 to 10g, or 0.05 to 0.1 ,

[0778] 0.2, 0.4, 0.6, 0.8, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 5.0, 6.0, 7.0, 8.0, 9.0 or 10g, or O.lg to

[0779] 10g, 0.5g to 5g, 0.8g to 3g, or 1g to 2g, e.g. about 2g.

[0780] A representative tablet to be used to administer an alginate oligomer in accordance with the invention to the stomach may contain up to 99%, up to 95%, 90%, 85% or 80%, e.g. 50 to 95%, 55 to 95%, 60 to 95%, 65 to 95%, 70 to 95%, 75 to 95%, 80 to 95%, 85 to 95%, 90 to 95%, 50 to 90%, 50 to 90%, 55 to 90%, 60 to 90%, 65 to 90%, 70 to 90%, 75 to 90%, 80 to 90%, 85 to 90%, 50 to 90%, 55 to 85%, 60 to 80% or, 65 to 75% w / w of the oligomer, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the therapeutic polypeptide and / or the gastrointestinal permeation enhancer) if being used.

[0781] A representative powder for oral administration of an alginate oligomer following admixture with food or beverages may contain up to 100%, e.g. up to 99%, 95%, 90%, 85%, 80%, 75% or 70%, e.g. 50 to 90%, 55 to 90%, 60 to 90%, 65 to 90%, 70 to 90%, 75 to 90%, 80 to 90%, 85 to 90%, 50 to 85%, 55 to 85%, 60 to 85%, 65 to 85%, 70 to 85%, 75 to 85%, 80 to 85%, 50 to 80%, 55 to 80%, 60 to 80%, 65 to 80%, 70 to 80%, 75 to 80%, 50 to 70%, 55 to 70%, 60 to 70%, or 65 to 70%w / w of the alginate oligomer, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the therapeutic polypeptide and / or the gastrointestinal permeation enhancer) if being used in the same composition.

[0782] A representative solution to be used to administer an alginate oligomer to the stomach in accordance with the invention may contain up to 1 to 25%, 1 to 20%, e.g. 1 to 15%, 1 to 10%, 1 to 9%, 1 to 8%, 1 to 7% or 1 to 6%, 5 to 25%, 5 to 20%, 5 to 15%, 5 to 10%, 5 to 9%, 5 to 8%, 5 to 7%, 5 to 6%, 8 to 25%, 8 to 20%, 8 to 15%, 8 to 10%, 9 to 25%, 9 to 20%, or 9 to 15% w / v or w / w of the alginate oligomer, the remainder being comprised of pharmaceutically acceptable excipients, e.g. water, and / or other active agents (e.g. the therapeutic polypeptide and / or the gastrointestinal permeation enhancer) if being used.

[0783] A representative tablet to be used to administer a gastrointestinal permeation enhancer in accordance with the invention to the stomach may contain up to 99%, up to 95%, 90%, 85% or 80%, e.g. 50 to 95%, 55 to 95%, 60 to 95%, 65 to 95%, 70 to 95%, 75 to 95%, 80 to 95%, 85 to 95%, 90 to 95%, 50 to 90%, 50 to 90%, 55 to 90%, 60 to 90%, 65 to 90%, 70 to 90%, 75 to 90%, 80 to 90%, 85 to 90%, 50 to 90%, 55 to 85%, 60 to 80% or, 65 to 75% w / w of the gastrointestinal permeation enhancer, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the therapeutic polypeptide and / or alginate oligomer) if being used.

[0784] A representative powder for oral administration of a gastrointestinal permeation enhancer following admixture with food or beverages may contain up to 100%, e.g. up to 99%, 95%, 90%, 85%, 80%, 75% or 70%, e.g. 50 to 90%, 55 to 90%, 60 to 90%, 65 to 90%, 70 to 90%, 75 to 90%, 80 to 90%, 85 to 90%, 50 to 85%, 55 to 85%, 60 to 85%, 65 to 85%, 70 to 85%, 75 to 85%, 80 to 85%, 50 to 80%, 55 to 80%, 60 to 80%, 65 to 80%, 70 to 80%, 75 to 80%, 50 to 70%, 55 to 70%, 60 to 70%, or 65 to 70% w / w of the gastrointestinal permeation enhancer, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the therapeutic polypeptide and / or the alginate oligomer) if being used in the same composition.

[0785] A representative solution to be used to administer a gastrointestinal permeation enhancer to the stomach in accordance with the invention may contain up to 1 to 25%, 1 to 20%, e.g. 1 to 15%, 1 to 10%, 1 to 9%, 1 to 8%, 1 to 7% or 1 to 6%, 5 to 25%, 5 to 20%, 5 to 15%, 5 to 10%, 5 to 9%, 5 to 8%, 5 to 7%, 5 to 6%, 8 to 25%, 8 to 20%, 8 to 15%, 8 to 10%, 9 to 25%, 9 to 20%, or 9 to 15% w / v or w / w of the gastrointestinal permeation enhancer, the remainder being comprised of pharmaceutically acceptable excipients, e.g. water, and / or other active agents (e.g. the therapeutic polypeptide and / or the alginate oligomer) if being used.

[0786] A representative tablet to be used to administer a polypeptide therapeutic agent in accordance with the invention to the stomach may contain up to 10%, up to 9.5%, 9.0%, 8.5%, 8.0%, 7.5%, 7.0%, 6.5%, 6.0%, 5.5%, 5.0%, 4.5%, 4.0%, 3.5%, 3.0%, 2.5%, 2.0%, 1.5%, 1.0%, 0.5% or 0.1%, e.g. 0.1 , 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5 to 10%, or 0.1 to 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, or 10%, or 5.0 to 9.5%, 5.5 to 9.5%, 6.0 to 9.5%, 6.5 to 9.5%, 7.0 to 95.%, 7.5 to 9.5%, 8.0 to 9.5%, 8.5 to 9.5%, 9.0 to 9.5%, 5.0 to 9.0%, 5.0 to 9.0%, 5.5 to 9.0%, 6.0 to 9.0%, 6.5 to 9.0%, 7.0 to 9.0%, 7.5 to 9.0%, 8.0 to 9.0%, 8.5 to 9.0%, 5.0 to 9.0%, 5.5 to 8.5%, 6.0 to 8.0% or, 6.5 to 7.5% w / w of the polypeptide therapeutic agent, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the gastrointestinal permeation enhancer and / or alginate oligomer) if being used.

[0787] A representative powder for oral administration of a polypeptide therapeutic agent following admixture with food or beverages may contain up to 10%, up to 9.5%, 9.0%, 8.5%, 8.0%, 7.5%, 7.0%, 6.5%, 6.0%, 5.5%, 5.0%, 4.5%, 4.0%, 3.5%, 3.0%, 2.5%, 2.0%, 1.5%, 1.0%, 0.5% or 0.1%, e.g. 0.1, 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5 to 10%, or 0.1 to 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, or 10%, or 5.0 to 9.5%, 5.5 to 9.5%,

[0788] 6.0 to 9.5%, 6.5 to 9.5%, 7.0 to 95.%, 7.5 to 9.5%, 8.0 to 9.5%, 8.5 to 9.5%, 9.0 to 9.5%,

[0789] 5.0 to 9.0%, 5.0 to 9.0%, 5.5 to 9.0%, 6.0 to 9.0%, 6.5 to 9.0%, 7.0 to 9.0%, 7.5 to 9.0%,

[0790] 8.0 to 9.0%, 8.5 to 9.0%, 5.0 to 9.0%, 5.5 to 8.5%, 6.0 to 8.0% or, 6.5 to 7.5% w / w of the polypeptide therapeutic agent, the remainder being comprised of pharmaceutically acceptable excipients and / or other active agents (e.g. the gastrointestinal permeation enhancer and / or the alginate oligomer) if being used in the same composition.

[0791] A representative solution to be used to administer a polypeptide therapeutic agent to the stomach in accordance with the invention may contain up to 10%, up to 9.5%, 9.0%, 8.5%, 8.0%, 7.5%, 7.0%, 6.5%, 6.0%, 5.5%, 5.0%, 4.5%, 4.0%, 3.5%, 3.0%, 2.5%, 2.0%, 1.5%, 1.0%, 0.5% or 0.1%, e.g. 0.1, 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5 to 10%, or 0.1 to 0.2, 0.5, 1.0, 1.5, 2.0, 2.5, 3.0, 3.5, 4.0, 4.5, 5.0, 5.5, 6.0, 6.5, 7.0, 7.5, 8.0, 8.5, 9.0, 9.5, or 10%, or 5.0 to 9.5%, 5.5 to 9.5%,

[0792] 6.0 to 9.5%, 6.5 to 9.5%, 7.0 to 95.%, 7.5 to 9.5%, 8.0 to 9.5%, 8.5 to 9.5%, 9.0 to 9.5%,

[0793] 5.0 to 9.0%, 5.0 to 9.0%, 5.5 to 9.0%, 6.0 to 9.0%, 6.5 to 9.0%, 7.0 to 9.0%, 7.5 to 9.0%,

[0794] 8.0 to 9.0%, 8.5 to 9.0%, 5.0 to 9.0%, 5.5 to 8.5%, 6.0 to 8.0% or, 6.5 to 7.5% w / v or w / w of the polypeptide therapeutic agent, the remainder being comprised of pharmaceutically acceptable excipients, e.g. water, and / or other active agents (e.g. the gastrointestinal permeation enhancer and / or the alginate oligomer) if being used.

[0795] A representative tablet to be used to administer an alginate oligomer, a gastrointestinal permeation enhancer and a polypeptide therapeutic agent in accordance with the invention to the stomach may contain 20 to 60% (e.g. 25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / w of the alginate oligomer, 20 to 60% (e.g. 25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / v or w / w of the gastrointestinal permeation enhancer, 1 to 10% (e.g. 2, 3, 4, 5, 6, 7, 8, 9 to 10%, or 2 to 3, 4, 5, 6, 7, 8, 9, or 10%) w / v or w / w of the polypeptide therapeutic agent, to a maximum of 100% with remainder being comprised of pharmaceutically acceptable excipients.

[0796] A representative powder for oral administration of an alginate oligomer, a gastrointestinal permeation enhancer and a polypeptide therapeutic agent following admixture with food or beverages may contain 20 to 60% (e.g. 25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / v or w / w of the alginate oligomer, 20 to 60% (e.g. 25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / v or w / w of the gastrointestinal permeation enhancer, 1 to 10% (e.g.2, 3, 4, 5, 6, 7, 8, 9 to 10%, or 2 to 3, 4, 5, 6, 7, 8, 9, or 10%) w / w of the polypeptide therapeutic agent, to a maximum of 100% with remainder being comprised of pharmaceutically acceptable excipients.

[0797] A representative solution to be used to administer an alginate oligomer, a gastrointestinal permeation enhancer and a polypeptide therapeutic agent to the stomach in accordance with the invention may contain 20 to 60% (e.g.25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / v or w / w of the alginate oligomer, 20 to 60% (e.g.25, 30, 35, 40, 50 or 55 to 60%, or 25 to 30, 35, 40, 50, 55 or 60%) w / v or w / w of the gastrointestinal permeation enhancer, 1 to 10% (e.g.2, 3, 4, 5, 6, 7, 8, 9 to 10%, or 2 to 3, 4, 5, 6, 7, 8, 9, or 10%) w / v or w / w of the polypeptide therapeutic agent, to a maximum of 100% with remainder being comprised of pharmaceutically acceptable excipients.

[0798] A tablet of use in the present invention may consist of about 0.1% to 100% w / w in total of a polypeptide therapeutic agent and an alginate oligomer, and 0 to about 99.9% w / w in total of a gastrointestinal permeation enhancer and / or further excipients For example, the tablet may consist of about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95% to 100%, or about 0.1% to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95% in total of a polypeptide therapeutic agent and an alginate oligomer, and about 0.1 , 0.5, 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, or 95% to about 99%, or about 0.1% to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, or 99%. in total of a gastrointestinal permeation enhancer and / or further excipients. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0799] In these embodiments the mass ratio of polypeptide therapeutic agent to alginate oligomer in the tablet may be about 1:0.5 to about 1:100, e.g. about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or 1:95 to about 1:100, or about 1:0.5 to about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1 :75, 1 :80, 1 :85, 1 :90, or 1 :95. Any ranges with end points which may be formed from any of these values are explicitly contemplated. In these embodiments the mass ratio of gastrointestinal permeation enhancer to the total amount of polypeptide therapeutic agent and alginate oligomer in the tablet may be about 1:0.5 to about 1:100, e.g. about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or 1:95 to about1:100, or about 1:0.5 to about1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or 1 :95. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0800] In these embodiments the tablet may consist of about 0.1 to about 200 mg, e.g. about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195 to about 200mg, or about 0.1 to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, or 195 mg, of the polypeptide therapeutic agent; about 0.1 to about 2000 mg, e.g. about 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950 to about 2000mg, or about 0.1 to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, or 1950 mg, of the alginate oligomer; and 0 to about 2000 mg, e.g. about 0.1, 0.5, 1,2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950 to about 2000mg, or Oto about 0.1, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, or 1950 mg, in total of the gastrointestinal permeation enhancer and / or further excipients

[0801] A film coated tablet of use in the present invention may comprise a core having the parameters of the above described tablet and a film coating the core, e.g. of about 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10 pm in thickness, comprising active or non-active film forming components, e.g. fats, PEG, and colourants. In these embodiments the coating accounts for less than about 50%, e.g. less than 45, 40, 35, 30, 25, 20, 15, 10 or 5% of the total weight of the formulation

[0802] A delayed or controlled release tablet (depot tablet) of use in the present invention may consist of 0.1% to 100% w / w in total of a polypeptide therapeutic agent and an alginate oligomer, and 0 to 99.9% w / w in total of a gastrointestinal permeation enhancer and / or further excipients, with the components provided in a layered arrangement, e.g. arrangements as described above. The specific parameters of the tablets recited above apply mutatis mutandis to these delayed or controlled release tablets.

[0803] The delayed or controlled release tablet (depot tablet) of use in the present invention may or may not be further provided with an outer film layer, e.g. of about 1 , 2, 3, 4, 5, 6, 7, 8, 9 or 10 pm in thickness, comprising active or non-active film forming components, e.g. fats, PEG, and colourants. In these embodiments the coating accounts for less than about 50%, e.g. less than about 45, 40, 35, 30, 25, 20, 15, 10 or 5% of the total weight of the formulation.

[0804] A hard capsule of use in the invention may comprise a rigid shell, e.g. of about 10, 20, 30, 40, 50, 60, 70, 80, 90 or 100 pm in thickness, formed from gelatin and / or other rigid shell forming polymeric compounds, and optionally further comprising active agents or nonactive excipients, stabilisers, colourants and flavours, and a filling having the parameters of the above described non-coated tablet. The shell may dissolve essentially immediately in the gastric environment. The filling may be particulate, e.g. in the form of a powder, granules, pellets, or microparticles or nanoparticles, or combinations thereof. The particulate filing may be monodisperse or polydisperse is size.

[0805] A soft capsule of use in the invention may comprise a pliable shell, e.g. of about 50, 60, 70, 80, 90, 100, 110, 120, 130, 140 or 150 pm in thickness, formed from gelatin and / or other pliable shell forming polymeric compounds and suitable solvents to maintain pliability, and optionally further comprising active agents or non-active excipients, stabilisers, colourants and flavours, and a liquid or semi-solid, e.g. gel, filling having the parameters of the above described non-coated tablet. The shell may dissolve essentially immediately in the gastric environment. In these embodiments the filing will typically include a liquid excipient, in particular an aqueous or oil-based liquid excipient. The filling may be a liquid or gel phase carrying particulate forms of the other ingredients or particles formed from the other ingredients, e.g. in the form of a powder, granules, pellets, or microparticles or nanoparticles, or combinations thereof. The particulate components may be monodisperse or polydisperse is size. Gels may formed from any gel forming excipients, in particular hydrogel forming excipients, e.g. gelatin, cellulose or alginate polymers.

[0806] In other embodiments the formulation of use in the invention may be solid or semi-solid, e.g. gelled, mixture of components having the parameters of the above described noncoated tablet. These mixtures may in the form of a powder, granules, pellets, or microparticles or nanoparticles, or combinations thereof. The particles may be monodisperse or polydisperse is size. The individual components of the formulation, e.g. the polypeptide therapeutic agent, alginate oligomer, gastrointestinal permeation enhancer, or other excipients may be provided as, or on, separate species of particles, or combinations of some or all components may be provided on different species of particles. Gels may be formed from any gel forming excipients, in particular hydrogel forming excipients, e.g. gelatin, cellulose or alginate polymers. The gels may carry the above described particles or non-particulate forms of the individual components of the formulation.

[0807] In certain embodiments these solid or semi-solid mixtures may be designed to be dissolved, dispersed or suspended in a pharmaceutically acceptable liquid, e.g. water, prior to administration by oral, orogastric, nasogastric, and intragastric routes.

[0808] Other formulations of use in the invention may be a solution or suspension comprising about 0.1 to about 200 mg, e.g. about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, 195 to about 200mg, or about 0.1 to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, 90, 95, 100, 105, 110, 115, 120, 125, 130, 135, 140, 145, 150, 155, 160, 165, 170, 175, 180, 185, 190, or 195 mg, of the polypeptide therapeutic agent; about 0.1 to about 2000 mg, e.g. about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950 to about 2000mg, or about 0.1 to about 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, or 1950 mg, of the alginate oligomer; and 0 to about 2000 mg, e.g. about 0.1 , 0.5, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, 1950 to about 2000mg, or 0 to about 0.1, 0.5, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 150, 200, 250, 300, 350, 400, 450, 500, 550, 600, 650, 700, 750, 800, 850, 900, 950, 1000, 1050, 1100, 1150, 1200, 1250, 1300, 1350, 1400, 1450, 1500, 1550, 1600, 1650, 1700, 1750, 1800, 1850, 1900, or 1950 mg, in total of the gastrointestinal permeation enhancer and / or further excipients other than water.

[0809] In these embodiments the mass ratio of polypeptide therapeutic agent to alginate oligomer in the solution or suspension may be about 1:0.5 to about 1:100, e.g. about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or 1:95 to about 1:100, or about 1:0.5 to about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1 :60, 1 :65, 1 :70, 1 :75, 1 :80, 1 :85, 1 :90, or 1 :95. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0810] In these embodiments the mass ratio of gastrointestinal permeation enhancer to the total amount of polypeptide therapeutic agent and alginate oligomer in the solution or suspension may be about 1:0.5 to about 1:100, e.g. about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1:75, 1:80, 1:85, 1:90, or 1:95 to about 1:100, or about 1:0.5 to about 1:1, 1:2, 1:3, 1:4, 1:5, 1:6, 1:7, 1:8, 1:9, 1:10, 1:15, 1:20, 1:25, 1:30, 1:35, 1:40, 1:45, 1:50, 1:55, 1:60, 1:65, 1:70, 1 :75, 1 :80, 1 :85, 1 :90, or 1 :95. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0811] A further example of a tablet of use in in the invention is a tablet suitable for oral administration to a human or non-human animal subject consisting of about 10% to about 50% w / w in total of an alginate oligomer and a polypeptide therapeutic agent, and about 50 % to about 90% w / w in total of a gastrointestinal permeation enhancer and one or more excipients selected from, (i) a binder or a disintegrant

[0812] (ii) a lubricant; and / or

[0813] (iii) a filler, wherein the tablet contains no less than about 1% w / w polypeptide therapeutic agent, no less than about 9% w / w alginate oligomer and no less than about 10% w / w gastrointestinal permeation enhancer.

[0814] Such a tablet may be designed to dissolve essentially immediately in the gastric environment.

[0815] In certain embodiments the tablet contains about 1 % to about 20 % w / w, e.g. about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 % to about 20 % w / w, or about 1 % to about 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 % w / w of the polypeptide therapeutic agent. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0816] In certain embodiments the tablet contains about 9 % to about 49% w / w, e.g. about 10, 15, 20, 25, 30, 35, 40, or 45 % to about 49 % w / w, or about 9 % to about 10, 15, 20, 25, 30, 35, 40, or 45 % w / w of the alginate oligomer. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0817] In these embodiments the mass ratio of polypeptide therapeutic agent to alginate oligomer in the tablet may be about 1 :0.25 to about 1:50, e.g. about 1 :0.5, 1 :1 , 1 :2, 1:3, 1 :4, 1 :5, 1 :6, 1 :7, 1 :8, 1:9, 1:10, 1 :15, 1 :20, 1:25, 1 :30, 1 :35, 1:40, or 1 :45 to about 1:50, or about 1 :0.25 to about 1 :0.5, 1 :1 , 1 :2, 1:3, 1:4, 1 :5, 1 :6, 1:7, 1:8, 1 :9, 1 :10, 1 :15, 1:20, 1:25, 1 :30, 1 :35, 1 :40, 1 :45, or 1 :50. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0818] In certain embodiments the tablet contains about 10% to about 70% w / w, e.g. about 10, 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 % to about 70% w / w, or about 10 % to about 15, 20, 25, 30, 35, 40, 45, 50, 55, 60, or 65 % w / w of a gastrointestinal permeation enhancer. Any ranges with end points which may be formed from any of these values are explicitly contemplated In these embodiments the mass ratio of gastrointestinal permeation enhancer to the total amount of polypeptide therapeutic agent and alginate oligomer in the tablet may be about 5:1 to about 1 :9, e.g. about 4:1 , 3:1, 2:1, 1:1 , 1 :2, 1 :3, 1 :4, 1 :5, 1:6, 1:7, or 1:8 to about 1 :9, or about 5:1 to about 4:1 , 3:1, 2:1, 1 :1 , 1 :2, 1:3, 1:4, 1 :5, 1 :6, 1:7, or about 1:8. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0819] In certain embodiments the tablet contains about 10% to about 50% w / w, e.g. about 10, 15, 20, 25, 30, 35, 40, or 45 % to about 50% w / w, or about 10 % to about 15, 20, 25, 30, 35, 40, or 45 % w / w of a filler. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0820] In certain embodiments the tablet contains about 0.1 % to about 20 % w / w, e.g. about 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, or 19 % to about 20 % w / w, or about 0.1 % to about 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 % w / w of a lubricant. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0821] In certain embodiments the tablet contains about 0.1 % to about 20 % w / w, e.g. about 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 , 12, 13, 14, 15, 16, 17, 18, or 19 % to about 20 % w / w, or about 0.1 % to about 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, 1 , 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, or 19 % w / w of a binder or a disintegrant. Any ranges with end points which may be formed from any of these values are explicitly contemplated.

[0822] For the avoidance of doubt, in this aspect of the invention the sum of the individual percentage amounts of each component will be 100%. It may be that upon preparation of the formulations the ingredients retain solvent molecules, e.g. water molecules, in intimate association. For the purposes of the present invention residual solvent associated in this way is included pro rata in the %w / w calculations and so has no impact on relative amounts of the components of particles of the invention.

[0823] “% w / w" (or “percentage weight by weight”) is a commonly used expression designating the proportion of a solid composition that is made up of the compound in question. 1% w / w equates to 1 gram of compound per 100 grams of solid composition, 2% w / w equates to 2g of compound per 100g of solid composition, and so on. 1% w / w also equates to 10 gram of compound per kilogram of solid composition.

[0824] “% w / v” (or “percentage weight by volume”) is a commonly used expression of the concentration of a solid solute in a liquid or semi-solid solution. 1% w / v equates to 1 gram of solid per 100ml of solvent, 2% w / v equates to 2g of solid per 100ml of solvent, and so on. Accordingly, % w / v may be expressed as g / 100ml, grams per 100 millilitres, g100ml’1.

[0825] In these embodiments of dosage forms, the polypeptide therapeutic agent may be an incretin analogue / mimetic, e.g. an agonist for the glucagon receptor, the glucosedependent insulinotropic polypeptide (GIP) receptor and / or the glucagon-like peptide- 1 (GLP-1) receptor. In more preferred embodiments the polypeptide is an agonist for the human forms of the above receptors.

[0826] Thus, in certain specific embodiments the polypeptide therapeutic agent of the above described formulations is dulaglutide (Trulicity), exenatide (Byetta), liraglutide (Victoza), semaglutide (Ozempic, Wegovy and Rybelsus), tirzepatide (Mounjaro), albiglutide (Eperzan / Tanzeum), lixisenatide (Lyxumia / Adlyxin), polyethylene glycol loxenatide (Fulaimei) and LY3437943 (retatrutide), or structural analogues thereof.

[0827] The above described formulations may be prepared by standard formulation techniques and so the skilled person would be able to prepared the above described formulations without undue burden. For example, the various ingredients may be dry mixed and pressed into tablet form, or filled into capsules, by standard means. Wet mixing of some or all components prior to tabletting or filling may be performed. In embodiments involving powders and / or pellets various particle sizes may be used.

[0828] Powders / particles / pellets may be prepared by standard means, e.g. milling, co-milling, spray drying, granulation (wet or dry), microdroplet gelation, microfluidic processing and the like. Powders and / or pellets may be administered as they are, or may be dissolved / suspended in a liquid, e.g. water or an aqueous solution (e.g. solutions of water and co-solvents and / or buffers described above). Formulations comprising layers and / or coatings, may be prepared using conventional layering / coating techniques, e.g. spray coating or dip coating.

[0829] The invention will be further described with reference to the following non-limiting Examples, in which

[0830] Figure 1 shows a representative DOSY spectrum of Tirzepatide (Tz) alone or in the presence of either SNAC or C10. Upper three traces from top: Tirzepatide, light grey; tirzepatide + SNAC, black; tirzepatide + C10, dark grey.

[0831] Figure 2 shows the timecourse of diffusion of semaglutide through artificial mucus in a transwell apparatus at 37°C in the presence of SNAC and / or OligoG. Bars from left to right 15 min, 30 min, 45 min and 240 min.

[0832] Figure 3 shows the diffusion of tirzepatide (TZ) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of combinations of C10, SNAC and / or OligoG (OG)

[0833] Figure 4 shows the diffusion of liraglutide (LG) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of SNAC and / or OligoG (OG)

[0834] Figure 5 shows the diffusion of semaglutide (SG) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of SNAC and / or OligoG (OG)

[0835] Figure 6 shows plasma concentration of semaglutide in rats following oral gavage of semaglutide alone (solid line; semaglutide (6.67 mg / kg)); or together with SNAC (long dash line; semaglutide (6.67 mg / kg) + SNAC (400 mg / kg)) or SNAC and OligoG (short dashed line, semaglutide (6.67 mg / kg) + SNAC (400 mg / kg) + OligoG (333 mg / kg)). All doses are based on an assumed weight of 300 grams for each animal.

[0836] Figure 7 shows plasma concentration of tirzepatide in rats following oral gavage of tirzapetide alone (solid line; tirzepatide (7.65 mg / kg)), or together with C10 (long dash; tirzepatide (7.65 mg / kg) + C10 (257.87 mg / kg)); or C10 and OligoG (short dash line; tirzepatide (7.65 mg / kg) + C10 (257.87 mg / kg) + OligoG (333 mg / kg)). All doses are based on an assumed weight of 300 grams for each animal. Figure 8 shows plasma concentration of semaglutide in rats following oral gavage of semaglutide (6.67 mg / kg) together with SNAC (400 mg / kg) (solid line); semaglutide (6.67 mg / kg) together with SNAC (180 mg / kg) and OligoG (100 mg / kg) (short dashed line); semaglutide (6.67 mg / kg) together with SNAC (400 mg / kg) and OligoG (100 mg / kg) (long dashed line); and semaglutide (6.67 mg / kg) together with SNAC (400 mg / kg) and OligoG

[0837] (333 mg / kg) (dotted line). All doses are based on an assumed weight of 300 grams for each animal.

[0838] Figure 9 shows systemic bioavailability (calculated as area under the curve of Figure 1) of semaglutide within 90 minutes of oral gavage of semaglutide with various combinations and levels of SNAC and OligoG as follows: semaglutide 6.67 mg / kg, high dose OligoG 333 mg / kg, low dose, OligoG 100 mg / kg, low dose SNAC180 mg / kg, high dose SNAC, 400 mg / kg. All doses are based on an assumed weight of 300 grams for each animal. plasma concentration of semaglutide in rats at 15 and 30 minutes following oral gavage of semaglutide (6.67 mg / kg) together with SNAC (400 mg / kg) (grey bar) and semaglutide (6.67 mg / kg) together with SNAC (400 mg / kg) and OligoG (333 mg / kg) (black bar). All doses are based on an assumed weight of 300 grams for each animal.

[0839] Figure 11 shows plasma concentration of tirzepatide in rats following oral gavage of tirzepatide (7.65 mg / kg) together with C10 (128.9 mg / kg) (solid line); and tirzepatide (7.65 mg / kg) together with C10 (192 mg / kg) and OligoG (333 mg / kg) (dotted line). All doses are based on an assumed weight of 300 grams for each animal.

[0840] Figure 12 shows systemic bioavailability of tirzepatide within 90 minutes of oral gavage of tirzepatide (7.65 mg / kg) together with C10 (128.9 mg / kg) (solid line); and tirzepatide (7.65 mg / kg) together with C10 (192 mg / kg) and OligoG (333 mg / kg). All doses are based on an assumed weight of 300 grams for each animal.

[0841] Figure 13 shows plasma concentration of tirzepatide in rats at 15 and 30 minutes following oral gavage of tirzepatide (7.65 mg / kg) together with C10 (128.9 mg / kg) (grey bar); and tirzepatide (7.65 mg / kg) together with C10 (192 mg / kg) and OligoG (333 mg / kg) (black bar). All doses are based on an assumed weight of 300 grams for each animal. Figure 14 shows systemic bioavailability of retatrutide within 90 minutes of oral gavage of retatrutide (6.67 mg / kg) together with C10 (125 mg / kg) (grey line); and retatrutide (6.67 mg / kg) together with C10 (125 mg / kg) and OligoG (250 mg / kg) (black line). All doses are based on an assumed weight of 300 grams for each animal.

[0842] Figure 15 shows plasma concentration of retatrutide in rats at 10 minutes following oral gavage of retatrutide (6.67 mg / kg) together with C10 (125 mg / kg) (grey bar); and retatrutide (6.67 mg / kg) together with C10 (125 mg / kg) and OligoG (250 mg / kg) (black bar). All doses are based on an assumed weight of 300 grams for each animal.

[0843] Figure 16 shows the chemical structures of liraglutide (A), semaglutide (B), tirzepatide (C), and retatrutide (D).

[0844] EXAMPLES

[0845] Example 1 - Effect of gastrointestinal permeation enhancers on the diffusion of representative GLP-1 agonists in water.

[0846] The diffusion of semaglutide, tirzepatide and liraglutide, alone and in the presence of the gastrointestinal permeation enhancers SNAC or C10, in phosphate buffered deuterium oxide (D2O) was measured by1H-NMR,13C HSQC and DOSY.

[0847] All samples were prepared in 10 mM phosphate pH 7.5 with 150 mM NaCI (PBS buffer) in a 3mm NMR tube. Liraglutide, semaglutide, tirzepatide (0.75-1.25 mM) were mixed with SNAC or C10.1H-NMR,13C HSQC and DOSY were recorded at 25 °C on a BRUKER AVIIIHD 800 MHz eguipped with 5mm cryogenic CP-TCI. The spectra were recorded using TopSpin 3.5 pL7 software (Bruker BioSpin) and processed and analysed with TopSpin 4.0.7 software (Bruker BioSpin).

[0848] Semaglutide

[0849] DOSY and HQSC spectrum of semaglutide and semaglutide with SNAC shows that the diffusion of semaglutide seems to be reduced upon addition of SNAC. Chemical shift changes in semaglutide were observed in13C-HSQC upon addition of SNAC. Changes can also be seen in 1 D spectrum of semaglutide upon addition of increasing amounts of SNAC.

[0850] Tirzepatide

[0851] DOSY and HQSC spectrum of tirzepatide and tirzepatide with SNAC and C10 shows that the diffusion of tirzepatide is increased upon addition of SNAC and even more by addition of C10.

[0852] Chemical shift changes in tirzepatide were observed in13C-HSQC upon addition of SNAC and C10. Changes can also be seen in 1 D spectrum of tirzepatide upon addition of SNAC and C10.

[0853] Liraglutide

[0854] DOSY and HQSC spectrum of liraglutide and liraglutide with SNAC shows that the diffusion of liraglutide is affected by SNAC, but to a minor extent. Changes can also be seen in 1 D spectrum of liraglutide upon addition of C10.

[0855] Figure 1 shows a representative DOSY spectrum of Tirzepatide (Tz) alone or in the presence of either SNAC or C10. Upper three traces from top: Tirzepatide, light grey; tirzepatide + SNAC, black; tirzepatide + C10, dark grey.

[0856] Example 2 - Effect of gastrointestinal permeation enhancers and alginate oligomers on the translocation of representative GLP-1 agonists through artificial mucus.

[0857] Timecourse of diffusion of semaglutide through artificial mucus in a transwell apparatus in the presence of SNAC and / or OligoG.

[0858] Polycarbonate membrane transwell plates (Costar) with pore size 3 pm, 96-well plates. Artificial mucin (Sigma): 2.5 % in Tris buffer pH 7.2. 13 pL mucus (approx. 900 pm thick layer) added on top of the transwell membrane. Semaglutide (SG): 200 pg / ml, OligoG (OG - alginate oligomer of DP 5 to 20, average molecular weight 3200 Da, 90-95% G residues): 6 % and SNAC: 100 mM were added to the mucus layer. Incubation at 37°C for 15, 30, 45 and 240 min before sampling from acceptor chamber (basolateral side). Samples were stored at -20°C until MS analysis. Four parallels of each condition. Results shown in Figure 2.

[0859] Diffusion oftirzepatide (TZ) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of combinations of C10, SNAC and / or OligoG (OG)

[0860] Polycarbonate transwell plates (Costar) with pore size 3 pm, 24-well plates. Artificial mucin (Sigma): 2.5 % in Tris buffer pH 7.2. 30 pL mucus (approx. 900 pm thick layer) added on top of the transwell membrane. Tirzepatide (TZ): 100 pg / ml, OligoG: 6 % and SNAC and C10: 100 mM of each were added to the mucus layer. Incubation at 37°C for 60 min before sampling from acceptor chamber (basolateral side). Samples were stored at -20°C until MS analysis. Four parallels of each condition. Results shown in Figure 3.

[0861] Diffusion of I irag I utide (LG) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of SNAC and / or OligoG (OG)

[0862] Polycarbonate transwell plates (Costar) with pore size 0.4 pm, 24-well plates. Artificial mucin (Sigma): 2.5 % in Tris buffer pH 7.2. 10 pL mucus (approx. 300 pm thick layer) added on top of the transwell membrane. Liraglutide (LG): 100 pg / ml, OligoG (OG): 6 % and SNAC: 100 mM were added to the mucus layer. Incubation at 37°C for 60 min before sampling from acceptor chamber (basolateral side). Samples were stored at -20°C until ELISA analysis. Four parallels of each condition. Results shown in Figure 4.

[0863] Diffusion of semaglutide (SG) through artificial mucus in a transwell apparatus after 60 mins at 37°C alone or in the presence of SNAC and / or OligoG (OG)

[0864] Polycarbonate transwell plates (Costar) with pore size 3 pm, 14-well plates. Artificial mucin (Sigma): 2.5 % in Tris buffer pH 7.2. 10 pL mucus (approx. 300 pm thick layer) added on top of the transwell membrane. Semaglutide (SG): 100 pg / ml, OligoG (OG): 6 % and SNAC: 100 mM were added to the mucus layer. Incubation at 37°C for 60 min before sampling from acceptor chamber (basolateral side). Samples were stored at -20°C until ELISA analysis. Four parallels of each condition. Results shown in Figure 5.

[0865] Example 3 - Effect of gastrointestinal permeation enhancers and alginate oligomers on the systemic bioavailability of orally administered GLP-1 agonists Fifty Sprague Dawley Rats, 25 males and 25 females (2 spare) ca 300g at dosing were used in this study. Animals were housed and maintained according to established institutional procedures conforming to animal welfare guidelines. Animals were fasted ca 12 hrs pre-dose until 2 hours post-dose.

[0866] Dose concentrations were prepared in a final gavage volume of 1.5 mL as defined in the tables below. All doses were based on an assumed weight of 300 grams for each animal. Formulations were prepared fresh on day of administration. The dose was administered directly into the stomach via gastric gavage.

[0867] Blood samples (ca 0.3 mL) were collected from the jugular vein into K2EDTA tubes at 0.25, 0.5, 0.75, 1 , 1.5, 3, 6 and 8 hrs following administration.

[0868] Samples were immediately inverted to ensure mixing with anticoagulant and then placed on wet ice until processing to plasma. Plasma was generated by centrifugation (1500 xg, 10 min, +4°C) as soon as practically possible following blood collection and transferred to polypropylene micronic tubes in 96-well plate format and stored in a freezer set to maintain a temperature of <-65 °C, until analysis.

[0869] Samples were analysed using a suitable LC-MS / MS and RGA2 method for the GLP-1 agonist administered. These methods are expected to detect intact and active GLP-1 agonist.

[0870] Results are shown in Figures 6 (semaglutide) and 7 (tirzepatide). AUG calculations are provided in the tables below.

[0871]

[0872] As can be seen, following oral administration of either the GLP-1 agonists semaglutide and tirzepatide together with an alginate oligomer and a gastrointestinal permeation enhancer, plasma concentration of the GLP-1 agonist begins to rise almost immediately and reaches essentially peak (Tz) or near peak (80%; SG) levels 15 mins from administration. This indicates that uptake is occurring from the stomach primarily as the drug has not had time to transit the stomach. Thus, the increase in bioavailability observed within 3hrs of administration can be attributed almost exclusively to enhanced uptake (absorption) from the stomach as only limited amounts could have reached the intestines in such timescales. Such rapid uptake might provide opportunities for improved oral dosage regimens.

[0873] The data also shows surprisingly increased systemic bioavailability (stomach absorption) for tirzepatide when orally administered with C10 (sodium caprate). The combination of semaglutide with SNAC during oral administration had only a marginal effect on bioavailability over 3 hrs and 8 hrs, and the modest uptake that did occur was slow. In contrast, tirzepatide and C10 showed rapid and significant absorption, albeit not as great as when these agents were administered together with an alginate oligomer.

[0874] The data from the bioavailability studies in SD rats clearly shows that alginate oligosaccharides can improve the bioavailability of orally administered polypeptides (as represented by the GLP-1 agonists semaglutide and tirzepatide). This means that less polypeptide therapeutic can be administered to a subject to have the same pharmacological effect and this may help reduce manufacturing costs. The reduced dose and subsequent reduction in formulation ingredients, may also reduce side effects due to off-target exposure of formulation ingredients such as in the lower Gl tract. Example 4 - Effect of alginate oligomers on the systemic bioavailability of orally administered semaglutide and SNAP

[0875] Introduction

[0876] Patients with obesity and / or diabetes mellitus type II have been treated successfully with orally administered semaglutide when semaglutide is provided in tablet form together with sodium N-[8-(2-hydroxybenzoyl)amino]caprylate (also referred to as SNAP). Such tablets are currently marketed by Novo Nordisk as Rybelsus. It has been shown in Buckley et al, 2018 (Transcellular stomach absorption of a derivatized glucagon-like peptide-1 receptor agonist, Sci. Transl. Med. 10, eaar7047) that systemic uptake occurs from the stomach and is a prolonged process taking several hours (Fig. 1B). Uptake appears to peak at around 2 hrs. This timecourse is correlated with the dissolution rate of the tablet formulation used (Fig. 1 A). Absorption of semaglutide in gastric cell culture was also shown to be highly dependent on the concentration of SNAP present (Fig. 2B) and the concentration gradient of SNAP diffusing from the tablet was very steep. According to the Buckley data, suboptimal concentrations of SNAP were reached between 3cm and 6 cm from the tablet, which maty be estimated to occur at 4cm (Fig. 2P).

[0877] The successful treatment of patients with orally administered semaglutide is therefore susceptible to complication by the presence of, or the introduction of, other stomach contents such as food and drink, and the physical movements of the patient. These actions might dislodge the tablet in the stomach and / or interfere with diffusion of the tablet ingredients. As such, patients are not permitted to consume food within 30 minutes of administering the Rybelsus tablet.

[0878] A means by which semaglutide can be absorbed from the stomach in therapeutically effective amounts more rapidly than the tablets of Buckley, e.g. over the first 90 minutes following administration, would be advantageous. Experiments were conducted to ascertain whether administering an alginate oligomer alongside semaglutide and SNAP might alter the absorption profile of semaglutide.

[0879] Materials and methods Experiments were conducted as described in Example 3. Dose concentrations were prepared in a final gavage volume of 1 .5 mL as defined in below. All doses were based on an assumed weight of 300 grams for each animal. Formulations were prepared fresh on day of administration. The dose was administered directly into the stomach via gastric gavage.

[0880] Semaglutide 6.67 mg / kg

[0881] High dose OligoG: 333 mg / kg

[0882] Low dose OligoG: 100 mg / kg

[0883] Low dose SNAC: 180 mg / kg

[0884] High dose SNAC: 400 mg / kg

[0885] OligoG (OG - alginate oligomer of DP 5 to 20, average molecular weight 3200 Da, 90- 95% G residues):

[0886] Samples were analysed using a suitable LC-MS / MS and RGA2 method for semaglutide. These methods are expected to detect intact and active semaglutide.

[0887] Discussion

[0888] Results are shown in Figures 8 to 10.

[0889] As can be seen, following oral administration of liquid formulations of semaglutide together with high levels of SNAC, consistent with the formulation of the Rybelsus tablet and the tablets of Buckley, plasma concentrations of semaglutide remain modest up to 90 minutes. In contrast combination of OligoG with semaglutide and SNAC resulted in up to a 10 fold increase in semaglutide uptake (as measured by semaglutide plasma concentration) over this time period, with peak absorption occurring as soon as 15 mins. This suggests that orally administered solid dosage forms which release semaglutide, OligoG and SNAC rapidly would show similar uptake profiles and thus would be able to deliver therapeutic levels of semaglutide to patients more quickly than the Rybelsus tablet. Such novel formulations would be less susceptible to inference by food in the patient’s stomach at the time of administration and by the consumption of food or drink after administration. Interestingly, uptake was enhanced over this period even when low levels of SNAC and OligoG were used suggesting that formulations with reduced amounts of these active ingredients could be used clinically thus saving resources.

[0890] 5 - Effect of alginate oligomers on the administered tirzepatide and C10

[0891] Introduction

[0892] Patients with obesity and / or diabetes mellitus type II have been treated successfully with tirzepatide administered by subcutaneous injection. Successful oral administration has not been shown. Uptake of a similar therapeutic polypeptide, semaglutide, from the stomach following oral administration by tablet further comprising the gastrointestinal permeation enhancer SNAC (marketed as Rybelsus) has been shown, however, the successful treatment of patients with this orally administered tablet is susceptible to complication by the presence of, or the introduction of, other stomach contents such as food and drink, and the physical movements of the patient. These actions might dislodge the tablet in the stomach and / or interfere with diffusion of the tablet ingredients. As such, patients are not permitted to consume food within 30 minutes of administering the Rybelsus tablet.

[0893] If tirzepatide can be shown to undergo absorption from the stomach with the aid of a gastrointestinal permeation enhancer a means by which tirzepatide can be rapidly absorbed from the stomach in therapeutically effective amounts, e.g. over the first 90 minutes following administration, would be advantageous. Experiments were conducted to ascertain whether administering an alginate oligomer alongside tirzepatide and a prototypical gastrointestinal permeation enhancer, C10 (sodium caprate), might alter the absorption profile of tirzepatide.

[0894] Materials and methods

[0895] Experiments were conducted as described in Example 3. Dose concentrations were prepared in a final gavage volume of 1.5 mL as defined in below. All doses were based on an assumed weight of 300 grams for each animal. Formulations were prepared fresh on day of administration. The dose was administered directly into the stomach via gastric gavage.

[0896] Tirzepatide 7.65 mg / kg

[0897] OligoG: 333 mg / kg

[0898] C10 128.9 or 192 mg / kg

[0899] OligoG (OG - alginate oligomer of DP 5 to 20, average molecular weight 3200 Da, 90- 95% G residues):

[0900] Samples were analysed using a suitable LC-MS / MS and RGA2 method for the tirzepatide. These methods are expected to detect intact and active tirzepatide.

[0901] Discussion

[0902] Results are shown in Figures 11 to 13.

[0903] As can be seen, following oral administration of liquid formulations of tirzepatide together with C10, concentrations of tirzepatide remain modest up to 90 minutes. In contrast combination of OligoG with tirzepatide and C10 resulted in up to an 8 fold increase in tirzepatide uptake (as measured by tirzepatide plasma concentration) at certain points over this time period, with overall systemic bioavailability being almost 4 times greater over this period, and with uptake reaching a near peak within 15 mins and peak from 30 mins. This suggests that orally administered solid oral dosage forms which release tirzepatide, OligoG and C10 rapidly would show similar uptake profiles and thus would be able to deliver therapeutic levels of tirzepatide to patients rapidly. Such novel formulations would be less susceptible to inference by food in the patient’s stomach at the time of administration and by the consumption of food or drink after administration.

[0904] Example 6 - Effect of alginate oligomers on the systemic bioavailability of orally administered retatrutide (LY3437943) and C10

[0905] 16 male Sprague Dawley Rats, ca 300g at dosing, were used in this study. Animals were housed and maintained according to established institutional procedures conforming to animal welfare guidelines. Animals were fasted 6 hrs pre-dose until 1.5 hours post-dose. Dose concentrations were prepared in a final gavage volume of 0.75 mL as defined in the table below. All doses were based on an assumed weight of 300 grams for each animal. Formulations were prepared fresh on day of administration. The single dose was administered directly into the stomach via gastric gavage. Each formulation was administered to 4 rats.

[0906] Blood samples (ca 0.1 mL) were collected from a peripheral vein into K2EDTA tubes at 5, 10, 15, 30, 45, 60 and 90 mins following administration.

[0907] Samples were immediately inverted to ensure mixing with anticoagulant. Blood samples were then placed on ice after sample collection and centrifuged at approx. 3000xG, 5 min., 4°C. 20 pL plasma was transferred into a separate low binding protein tube and the remaining plasma was transferred into a new tube. The tube was frozen upright at approximately -20°C. The whole sample processing was completed within 30 minutes after sampling. Samples were then stored in a freezer set to maintain a temperature of <- 70 °C, until analysis.

[0908] Samples were analysed using a suitable LC-MS / MS and RGA2 method for retatrutide. These methods are expected to detect intact and active retatrutide. Results are shown in Figures 14 and 15.

[0909] As can be seen, following oral administration of liquid formulations of retatrutide together with C10, plasma concentrations of retatrutide are improved but remain modest up to 90 minutes. In contrast combination of OligoG with retatrutide and C10 resulted in up to a 5 fold increase in retatrutide uptake (as measured by retatrutide plasma concentration) at certain points over this time period (5 and 10 mins in particular). This suggests that orally administered solid oral dosage forms which release retatrutide, OligoG and C10 rapidly would show similar uptake profiles and thus would be able to deliver therapeutic levels of retatrutide to patients rapidly. Such novel formulations would be less susceptible to inference by food in the patient’s stomach at the time of administration and by the consumption of food or drink after administration.

Claims

CLAIMS1. An alginate oligomer, wherein said alginate oligomer has 2 to 100 monomer residues, for use in a method for increasing the systemic bioavailability of a polypeptide therapeutic agent undergoing oral, orogastric, nasogastric, or intragastric administration, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to a stomach of a human or non-human animal as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

2. An alginate oligomer, wherein said alginate oligomer has 2 to 100 monomer residues, for use in a method for systemic treatment or prevention of a disease or condition or complication thereof which is responsive to, or which is prevented by, a polypeptide therapeutic agent, said method comprising administering said polypeptide therapeutic agent together with said alginate oligomer, and optionally a gastrointestinal permeation enhancer, to the stomach of a human or non-human animal subject, which has, is suspected of having, or is at risk of, said disease or condition or complication thereof, as part of one or more dosage forms, wherein said one or more dosage forms do not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer if used, which would provide substantive protection from a gastric environment.

3. A dosage form adapted for delivery to a stomach of a human or non-human animal subject, said dosage form comprising(i) a polypeptide therapeutic agent,(ii) an alginate oligomer which has 2 to 100 monomer residues; and(iii) gastrointestinal permeation enhancer, wherein said dosage form does not carry a coating in addition to the polypeptide therapeutic agent, the alginate oligomer, and the gastrointestinal permeation enhancer which would provide substantive protection from a gastric environment.

4. The alginate oligomer for use or the dosage form of any one of claims 1 to 3, wherein the alginate oligomer has a degree of polymerisation (DP), or a number average degree of polymerisation (DPn) of(i) 2 to 75, 2 to 50, 2 to 35, 2 to 30, 2 to 25, 2 to 22, 52 to 20, 2 to 18, 2 to 16 or 2 to 14,(i) 4 to 100, 4 to 75, 4 to 50, 4 to 35, 4 to 30, 4 to 25, 4 to 22, 4 to 20, 4 to 18,4 to 16 or 4 to 14,(iii) 6 to 50, 6 to 35, 6 to 30, 6 to 25, 6 to 22, 6 to 20, 6 to 18, 6 to 16 or 6 to 14, or(iv) 8 to 50, 8 to 35, 8 to 30, 8 to 25, 8 to 22, 8 to 20, 8 to 18, 8 to 16 or 8 to 14, or(v) 10 to 50, 10 to 35, 10 to 30, 10 to 25, 10 to 22, 10 to 20, 10 to 18, or 10 to 14.

5. The alginate oligomer for use or the dosage form of any one of claims 1 to 4, wherein the alginate oligomer is a 2- to 35-mer, 2- to 30-mer, 3- to 35-mer, 3- to 28-mer, 4- to 25-mer, 5- to 20-mer, 6- to 22-mer, 8- to 20-mer, or 10- to 15-mer.

6. The alginate oligomer for use or the dosage form of any one of claims 1 to 5, wherein the alginate oligomer has at least 70%, at least 80%, at least 85%, at least 90% G, at least 95%, or 100% G residues.

7. The alginate oligomer for use or the dosage form of claim 6, wherein at least 80% of the G residues are arranged in G-blocks.

8. The alginate oligomer for use or the dosage form use of any one of claims 1 to 7, wherein the alginate oligomer has at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, or 100% M residues.

9. The alginate oligomer for use or the dosage form of claim 8, wherein at least 80% of the M residues are arranged in M blocks.

10. The alginate oligomer for use or the dosage form of any one of claims 1 to 9, wherein at least 70%, at least 80%, at least 85%, at least 90%, at least 95%, at least 99% or 100% of the G and M residues in the oligomer are arranged in MG blocks.

11. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the therapeutic polypeptide is, or is an analogue of(i) a peptide hormone or growth factor(ii) a cytokine(iii) an enzyme, or(iv) a blood factor.

12. The alginate oligomer for use or the dosage form of claim 11 , wherein the therapeutic polypeptide is, or is an analogue of G-CSF, VEGF, EGF, HGF, PDGF, FGF, NGF, BDNF, neurotrophin-3, neurotrophin-4, TNF, IL-1 , IL-6, IL-8, IL-10, IFN-y, IFN-a, IFN-p, IFN-E, IFN-K and IFN-co, Factor VII, Factor VIII and Factor IX, adrenocorticotropic hormone (ACTH), corticotropin-releasing factor, angiotensin, endothenlin, calcitonin, insulin, glucagon, glucagon-like peptide-1, glucagon-like peptide-2, insulin-like growth factor, insulin-like growth factor-2, gastric inhibitory peptide, growth hormone releasing factor, pituitary adenylate cyclase activating peptide, secretin, enterogastrin, somatostatin, somatotropin, somatomedin, parathyroid hormone, thrombopoietin, follicle-stimulating hormone, erythropoietin, gastrin, growth hormone, gonadotrophin, hypothalamic releasing factors, prolactin, thyroid stimulating hormones, endorphins, enkephalins, vasopressin, oxytocin, interferon, and analogues thereof, superoxide dismutase, asparaginase, arginase, arginine deaminase, adenosine deaminase and ribonuclease.

13. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the therapeutic polypeptide is or comprises an immunoglobulin amino acid sequence.

14. The alginate oligomer for use or the dosage form of claim 13, wherein the therapeutic polypeptide is a therapeutic antibody, preferably selected from alemtuzumab, bevacizumab, cetuximab, ofatumumab, panitumumab, rituximab, trastuzumab, ipilimumab, nivolumab, pembrolizumab, atezolizumab, avelumab, durvalumab, cemiplimab, sutimlimab, anifrolumab, bimekizumab, tralokinumab, evinacumab, aducanumab, ansuvimab, atoltivimab, teprotumumab, eptinezumab, crizanlizumab, brolucizumab, risankizumab, romosozumab, galcanezumab, erenumab, ibalizumab, emicizumab, benralizumab, ocrelizumab, sarilumab, dupilumab, bezlotoxumab, ixekizumab, alirocumab, vedolizumab, tocilizumab, canakinumab, infliximab, adalimumab,omalizumab, efalizumab, golimumab, ustekinumab, certolizumab pegol, ibritumomab or tositumomab.

15. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the therapeutic polypeptide is a polypeptide antibiotic, preferably actinomycin, gramicidin, tyrocidine, bleomycin, bacitracin, colistin, and polymyxin B.

16. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the therapeutic polypeptide is an antimicrobial peptide or protein.

17. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the therapeutic polypeptide is incretin peptide or an analogue / mimetic thereof, preferably glucagon-like protein 1 , gastric inhibitory peptide (glucose-dependent insulinotropic polypeptide (GIP)) and / or exendin-4 peptide.

18. The alginate oligomer for use or the dosage form of claim 17, wherein the therapeutic polypeptide is selected from dulaglutide, exenatide, liraglutide, semaglutide, tirzepatide, albiglutide, lixisenatide, polyethylene glycol loxenatide, retatrutide (LY3437943), cotadutide; taspoglutide; langlenatide; beinaglutide; efpeglenatide; LY3502970; LY3537031; LY3493269; HM12525A / JNJ-64565111; MOD6030 / 1; SAR425899; MEDI0382; MK8521; ZP2929 / BI 456906; NN9709 / NNC0090- 2746 / MAR709 / RG7697 / R06811135; SAR441255; C2816; ZP3022; NNC 9204-1177 (NN9277); LY3305677; JNJ-54728518; LY2944876 / TT-401 ; CPD86; SAR438335; ZP-I- 98; ZP-DI-70; HM15211 ; NN9423 / MAR423, PB-719; and DD01.

19. The alginate oligomer for use or the dosage form of any one of claims 1 to 10, wherein the gastrointestinal permeation enhancer is selected from the group consisting of EDTA, citric acid, a salicylate, oleic acid, lauric acid, acylcarnitine, acyl choline, and acylated amino acid, sodium glycocholate, sodium deoxycholate, sodium taurocholate, sodium dihydrofusidate, sodium glycodihydrofusidate, sodium glycolate, sodium lauryl sulphate, dioctyl sodium sulfosuccinate, sucrose fatty acid esters, lactose fatty acid esters, polysorbates, polyoxyethylene-8 lauryl ether, Tween80, sucrose laurate, macrogol-8 glycerides, lauroylcarnitine chloride, caprylic acid, sodium caprylate, capric acid, sodium caprate (sodium decanoate; C10), sodium cholate, choline geranate, 5-CNAC (N-(5- chlorosalicyloyl)-8-aminocaprylic acid), sodium salcaprozate (SNAC), chitosan, chitosanglutamate, N-sulfanto-N,O-carboxymethylchitosan (SNOCC), N-Trimethylated Chitosan Chloride (TMC), ethanol, penetratin, Zonula occludens toxin (Zot), polycarbophyl-cysteine conjugate(PCP-Cys)20. A solid dosage form adapted for oral delivery to a stomach of a human or nonhuman animal subject, said composition comprising(i) a polypeptide therapeutic agent selected from the group consisting dulaglutide, exenatide, liraglutide, semaglutide, tirzepatide, albiglutide, lixisenatide, polyethylene glycol loxenatide, retatrutide (LY3437943), cotadutide; taspoglutide; langlenatide; beinaglutide; efpeglenatide; LY3502970; LY3537031 ; LY3493269; HM12525A / JNJ-64565111 ; MOD6030 / 1 ; SAR425899; MEDI0382; MK8521 ; ZP2929 / BI 456906; NN9709 / NNC0090-2746 / MAR709 / RG7697 / R06811135; SAR441255; C2816; ZP3022; NNC 9204-1177 (NN9277); LY3305677; JNJ-54728518; LY2944876 / TT-401 ; CPD86; SAR438335; ZP-l-98; ZP-DI-70; HM15211 ; NN9423 / MAR423, PB-719; and DD01.; and(ii) an alginate oligomer which has 2 to 100 monomer residues; wherein said solid dosage form does not carry a coating in addition to the polypeptide therapeutic agent and the alginate oligomer which would provide substantive protection from a gastric environment.