Methods for screening and expression of disulfide-bonded binding polypeptides

Abstract

The present disclosure relates to methods for producing and screening display libraries of disulfide-bonded binding polypeptides, for example, to identify binding peptides specific for a target molecule. In some embodiments, the binding peptides comprise an ultralong CDR3. The binding peptides can be derived from bovine antibodies that comprise an ultralong CDR3, or they can be synthetic or semi-synthetic. Also provided herein are display libraries that comprise disulfide-bonded binding polypeptides. The present disclosure also relates to methods for producing or expressing soluble disulfide-bonded binding polypeptides, for example, using suitable host cells. Also provided herein are compositions that comprise soluble disulfide-bonded binding polypeptides.

Description

[Technical field]

[0001] (Statement of Government Interest) This invention was made with Government support under Grants R01 GM105826 and R01 HD088400 awarded by the National Institutes of Health. The Government has certain rights in the invention. (CROSS REFERENCE TO RELATED APPLICATIONS)

[0002] This application claims priority to U.S. Provisional Patent Application No. 63 / 187,931, filed May 12, 2021, and U.S. Provisional Patent Application No. 63 / 288,992, filed December 13, 2021, the contents of each of which are incorporated by reference in their entirety herein.

[0003] (Incorporated by reference in sequence listing) This application is filed with a Sequence Listing in electronic format. The Sequence Listing is provided in a file named 165772000440SEQLIST.txt, created on May 10, 2022, and having a size of 128 kilobytes. The information in the electronic format of the Sequence Listing is incorporated by reference in its entirety.

[0004] FIELD OF THEINVENTION The present disclosure relates to methods for producing and screening display libraries of disulfide-bonded binding polypeptides, for example, to identify binding peptides specific for a target molecule. In some embodiments, the binding peptides comprise an ultralong CDR3. The binding peptides can be derived from bovine antibodies that comprise an ultralong CDR3, or they can be synthetic or semi-synthetic. Also provided herein are display libraries that comprise disulfide-bonded binding polypeptides. The present disclosure also relates to methods for producing or expressing soluble disulfide-bonded binding polypeptides, for example, using suitable host cells. Also provided herein are compositions that comprise soluble disulfide-bonded binding polypeptides. [Background technology]

[0005] Antibodies are natural proteins that vertebrate immune systems form in response to foreign substances (antigens), primarily to protect against infection. Antibodies contain complementarity determining regions (CDRs) that mediate binding to target antigens. Some bovine antibodies have unusually long variable heavy (VH) CDR3 sequences compared to other vertebrates. These long CDR3s, which can be up to 70 amino acids long, can form unique domains that protrude from the antibody surface, thereby allowing for unique antibody platforms. There is a need for improved methods for screening and producing antibodies or portions thereof that contain long CDR3s, as well as for screening and producing other disulfide-linked polypeptides. Summary of the Invention

[0006] Provided herein, in some embodiments, is a method for preparing a bovine ultralong CDR3 antibody display library, comprising: (a) amplifying sequences encoding multiple variable heavy (VH) regions of IgHV1-7 family from a bovine antibody VH chain complementary DNA (cDNA) template library; and (b) constructing multiple replicable expression vectors for the multiple VH regions, each replicable expression vector comprising a single chain variable fragment (SFR) comprising the amplified VH regions linked to a variable lambda light (VL) region selected from the group consisting of the VL regions of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof. (c) transforming a suitable host cell with a plurality of replicable expression vectors under conditions suitable to produce amplified display particles; and (d) collecting the amplified display particles, wherein the amplified display particles comprise display particles that display a fusion protein comprising the scFv.

[0007] In some of the optional embodiments, the VL region is a BLV1H12 VL region.

[0008] Provided herein, in some embodiments, is a method of preparing a bovine ultralong CDR3 antibody display library, the method comprising: (a) amplifying sequences encoding multiple variable heavy (VH) regions of the IgHV1-7 family from a bovine antibody VH chain complementary DNA (cDNA) template library; (b) constructing multiple replicable expression vectors for the multiple VH regions, each replicable expression vector comprising a first nucleic acid sequence encoding a single-chain variable fragment (scFv) comprising the amplified VH region linked to a BLV1H12 lambda variable light (VL) region or a humanized variant thereof; (c) transforming a suitable host cell with the multiple replicable expression vectors under conditions suitable to produce amplified display particles; and (d) collecting the amplified display particles, the amplified display particles comprising display particles displaying a fusion protein comprising the scFv.

[0009] In some of the embodiments, the cDNA template library is prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. In some of the embodiments, the method further comprises preparing the cDNA template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. In some of the embodiments, the method further comprises immunizing the cow with a target antigen.

[0010] In some of any of the embodiments, the amplified display particles include bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. In some of any of the embodiments, the amplified display particles are phage display particles. In some of any of the embodiments, the amplified display particles are phagemid particles. In some of any of the embodiments, each replicable expression vector further comprises a second nucleic acid sequence encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein.

[0011] Provided herein, in some embodiments, is a method for preparing a bovine very long CDR3 antibody phage display library, comprising: (a) immunizing a bovine with a target antigen; (b) preparing an antibody variable heavy (VH) chain complementary DNA (cDNA) template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized bovine; (c) amplifying sequences encoding multiple VH regions of the IgHV1-7 family from the cDNA template library; and (d) constructing multiple replicable expression vectors for the multiple VH regions, each replicable expression vector comprising: (1) a single replicable expression vector comprising the amplified VH region linked to a BLV1H12 lambda variable light (VL) region or a humanized variant thereof; The method includes constructing a plurality of replicable expression vectors comprising (1) a first nucleic acid sequence encoding a fragment variable chain (scFv), and (2) a second nucleic acid sequence encoding at least a portion of a phage coat protein; (e) transforming suitable host cells with the plurality of replicable expression vectors; (f) infecting the transformed host cells with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce amplified phagemid particles; and (g) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles that display a fusion protein comprising at least a portion of the phage coat protein and the scFv.

[0012] In some of the embodiments, the BLV1H12 lambda VL region is set forth in SEQ ID NO: 2. In some of the embodiments, the BLV1H12 lambda VL region is a humanized variant of the lambda VL region of BLV1H12. In some of the embodiments, the humanized variant comprises one or more of the amino acid substitutions S2A, T5N, P8S, A12G, A13S, and P14L based on Kabat numbering, the amino acid substitutions I29V and N32G in the CDR1 region, and / or the amino acid substitution DNN to GDT in the CDR2 region. In some of the embodiments, the humanized variant comprises the sequence set forth in SEQ ID NO: 107.

[0013] In some of the embodiments, the amplified VH region is indirectly linked to the BLV1H12 lambda VL region via a peptide linker. In some of the embodiments, the peptide linker is (Gly4Ser)3 (SEQ ID NO:94).

[0014] In some of the optional embodiments, multiple VH regions of the IgHV1-7 family from a cDNA template library are amplified with a forward primer comprising the sequence set forth in SEQ ID NO:84 and a reverse primer comprising the sequence set forth in SEQ ID NO:85.

[0015] In some of the embodiments, prior to assembly, the method further comprises performing size separation on the sequences encoding the plurality of amplified VH regions to enrich for VH regions with ultralong CDR3. In some of the embodiments, the size separation is performed by gel electrophoresis. In some of the embodiments, the gel electrophoresis is performed using a 1.2%, 1.5%, or 2% agarose gel, optionally using a 2% agarose gel. In some of the embodiments, the size separation comprises separating sequences that are 550 base pairs long, about 550 base pairs long, or greater than 550 base pairs long from the sequences encoding the plurality of amplified VH regions, wherein the sequences that are 550 base pairs long, about 550 base pairs long, or greater than 550 base pairs long include sequences encoding VH regions with ultralong CDR3.

[0016] In some optional embodiments, gel electrophoresis is performed using a 2% agarose gel.

[0017] In some of the embodiments, at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. In some of the embodiments, at least or at least about 30% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. In some of the embodiments, at least or at least about 40% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. In some of the embodiments, at least or at least about 50% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region.

[0018] In some of the optional embodiments, the ultralong CDR3 is a peptide sequence of 25-70 amino acids that contains a cysteine ​​motif that contains 2-12 cysteine ​​residues that can form 1-6 disulfide bonds.

[0019] In some of the embodiments, the ultralong CDR3 is 40-60 amino acids long. In some of the embodiments, the ultralong CDR3 is at least 42 amino acids long. In some of the embodiments, the ultralong CDR3 is 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids long.

[0020] In some of the embodiments, the ultralong CDR3 comprises at least 4 cysteine ​​residues. In some of the embodiments, the ultralong CDR3 comprises 4 cysteine ​​residues. In some of the embodiments, the ultralong CDR3 comprises 6, 8, 10, or 12 cysteine ​​residues.

[0021] In some of the embodiments, the ultralong CDR3 has at least two disulfide bonds. In some of the embodiments, the ultralong CDR3 has two disulfide bonds. In some of the embodiments, the ultralong CDR3 has three, four, or five disulfide bonds. In some of the embodiments, the method further comprises identifying a CDR3-knob sequence in the scFv sequence.

[0022] Provided herein, in some embodiments, is a method for preparing an ultralong CDR3-knob display library, the method comprising: (a) amplifying sequences encoding a plurality of CDR3-knob-only antibodies from a bovine antibody variable heavy (VH) chain complementary DNA (cDNA) template library using forward and reverse primers specific to the up-stalk domain and down-stalk domain of a bovine ultralong CDR3 region; (b) constructing a plurality of replicable expression vectors for the plurality of CDR3 knob-only antibodies, each replicable expression vector comprising a first nucleic acid sequence encoding an amplified CDR3 knob; (c) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; and (d) collecting the amplified display particles, the amplified display particles comprising display particles displaying a fusion protein comprising the amplified CDR3 knob.

[0023] In some of the embodiments, the cDNA template library is prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. In some of the embodiments, the method further comprises preparing the cDNA template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. In some of the embodiments, the method further comprises immunizing the cow with a target antigen.

[0024] In some of any of the embodiments, the amplified display particles include bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. In some of any of the embodiments, the amplified display particles are phage display particles. In some of any of the embodiments, the amplified display particles are phagemid particles. In some of any of the embodiments, each replicable expression vector further comprises a second nucleic acid sequence encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein.

[0025] Provided herein, in some embodiments, is a method for preparing an ultralong CDR3 knob phage display library, comprising: (a) immunizing a bovine with a target antigen; (b) preparing an antibody variable heavy (VH) chain complementary DNA (cDNA) template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized bovine; (c) amplifying sequences encoding multiple CDR3-knob-only antibodies from the cDNA template library using forward and reverse primers specific to the up-stalk domain and down-stalk domain of the bovine ultralong CDR3 region; and (d) constructing multiple replicable expression vectors for the multiple CDR3-knob-only antibodies, wherein each replicable expression vector The method includes: (1) constructing a nucleic acid sequence comprising a first nucleic acid sequence encoding an amplified CDR3 knob, and (2) a second nucleic acid sequence encoding at least a portion of a phage coat protein; (e) transforming a suitable host cell with a plurality of replicable expression vectors; (f) infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce amplified phagemid particles; and (g) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles that display a fusion protein comprising at least a portion of the phage coat protein and the amplified CDR3 knob.

[0026] In some optional embodiments, the primer comprises or consists of any of the sequences set forth in SEQ ID NOs: 7-11 and 121-130.

[0027] In some of the optional embodiments, the primer comprises or consists of any of the sequences shown in SEQ ID NOs: 7-11. In some of the optional embodiments, the primer comprises or consists of any of the sequences shown in SEQ ID NOs: 8-11. In some of the optional embodiments, the primer comprises or consists of any of the sequences shown in SEQ ID NOs: 121-130. In some of the optional embodiments, the primer comprises or consists of any of the sequences shown in SEQ ID NOs: 123, 127, and 128.

[0028] In some of the optional embodiments, the primers include two or more of the primers set forth in SEQ ID NOs: 7-11 and 121-130. In some of the optional embodiments, the primers include two or more of the primers set forth in SEQ ID NOs: 8-11 and 123, 127, and 128. In some of the optional embodiments, the primers include three or more of the primers set forth in SEQ ID NOs: 8-11 and 123, 127, and 128. In some of the optional embodiments, the primers include four or more of the primers set forth in SEQ ID NOs: 8-11 and 123, 127, and 128.

[0029] In some optional embodiments, the primers include a primer consisting of the sequence shown in SEQ ID NO:8, a primer consisting of the sequence shown in SEQ ID NO:9, a primer consisting of the sequence shown in SEQ ID NO:10, and a primer consisting of the sequence shown in SEQ ID NO:11.

[0030] In some of the optional embodiments, the primers include a primer consisting of the sequence shown in SEQ ID NO:123, a primer consisting of the sequence shown in SEQ ID NO:127, and a primer consisting of the sequence shown in SEQ ID NO:128.

[0031] In some of the optional embodiments, the primers include a primer consisting of the sequence shown in SEQ ID NO:8, a primer consisting of the sequence shown in SEQ ID NO:9, a primer consisting of the sequence shown in SEQ ID NO:10, a primer consisting of the sequence shown in SEQ ID NO:11, a primer consisting of the sequence shown in SEQ ID NO:123, a primer consisting of the sequence shown in SEQ ID NO:127, and a primer consisting of the sequence shown in SEQ ID NO:128.

[0032] In some of the embodiments, the method further comprises identifying a CDR3-knob from a bovine antibody variable heavy (VH) chain template sequence. In some of the embodiments, the CDR3-knob is identified from the antibody sequence by an algorithm comprising identifying a conserved cysteine ​​in framework 3 and a conserved tryptophan in framework 4, and determining the sequence of the CDR-3 knob, the CDR-3 knob having an amino acid sequence length K, the sequence starting at position X+1 and ending at X+K, where K=L-2X, where L is the number of amino acids in the amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending at the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the first conserved cysteine ​​encoded by the DH region in CDR H3.

[0033] In some of the embodiments, the antibody sequence is a bovine antibody. In some of the embodiments, the identified CDR3-knob is extended by 1, 2, 3, 4, or 5 amino acids at the N- and / or C-terminus compared to the identified sequence.

[0034] In some of any of the embodiments, each of the multiple CDR3-knob-only antibodies comprises a peptide sequence of 25-70 amino acids having a cysteine ​​motif that contains 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds. In some of any of the embodiments, the peptide sequence is 40-60 amino acids in length. In some of any of the embodiments, the peptide sequence is at least 42 amino acids in length. In some of any of the embodiments, the peptide sequence is 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids in length.

[0035] In some of the embodiments, the peptide sequence comprises at least 4 cysteine ​​residues. In some of the embodiments, the peptide sequence comprises 4 cysteine ​​residues. In some of the embodiments, the peptide sequence comprises 6, 8, 10, or 12 cysteine ​​residues.

[0036] In some of the embodiments, the peptide sequence has at least two disulfide bonds. In some of the embodiments, the peptide sequence has two disulfide bonds. In some of the embodiments, the peptide sequence has three, four, or five disulfide bonds.

[0037] In some of any of the embodiments, the target antigen is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein (e.g., a checkpoint molecule), a cancer antigen, human IgG, or a recombinant version thereof. In some of any of the embodiments, the immunomodulatory protein is a checkpoint molecule.

[0038] In some of the optional embodiments, the cDNA template library was synthesized using a pool of IgM (SEQ ID NO: 4), IgA (SEQ ID NO: 5), and IgG specific (SEQ ID NOs: 3 and 6) primers. In some of the optional embodiments, the cDNA template library was synthesized using a pool of IgM, IgA, and IgG specific primers including a primer comprising or consisting of the sequence shown in SEQ ID NO: 4, a primer comprising or consisting of the sequence shown in SEQ ID NO: 5, a primer comprising or consisting of the sequence shown in SEQ ID NO: 3, and a primer comprising or consisting of the sequence shown in SEQ ID NO: 6.

[0039] Provided herein, in some embodiments, is a method for preparing an ultralong CDR3 knob phage display library, the method comprising: (a) constructing a plurality of replicable expression vectors for a plurality of CDR3-knob-only antibodies, each replicable expression vector comprising a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds; (b) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; and (c) collecting the amplified display particles, the amplified display particles comprising display particles that display a fusion protein comprising a CDR3 knob.

[0040] In some of any of the embodiments, the amplified display particles include bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. In some of any of the embodiments, the amplified display particles are phage display particles. In some of any of the embodiments, the amplified display particles are phagemid particles. In some of any of the embodiments, each replicable expression vector further comprises a second nucleic acid sequence encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein.

[0041] Provided herein, in some embodiments, is a method for preparing an ultralong CDR3 knob phage display library, the method comprising: (a) constructing a plurality of replicable expression vectors for a plurality of CDR3-knob-only antibodies, each replicable expression vector comprising: (1) a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds; and (2) a second nucleic acid sequence encoding at least a portion of a phage coat protein; (b) transforming a suitable host cell with the plurality of replicable expression vectors; (c) infecting the transformed host cell with a helper phage carrying a gene encoding a phage coat protein sufficient to produce amplified phagemid particles; and (d) collecting the amplified phagemid particles, the amplified phagemid particles comprising phagemid particles displaying a fusion protein comprising at least a portion of the phage coat protein and the CDR3 knob.

[0042] In some of the embodiments, at least one of the multiple CDR3-knob antibodies is identified from the antibody sequence by an algorithm that includes identifying a conserved cysteine ​​in framework 3 and a conserved tryptophan in framework 4, and determining the sequence of the CDR-3 knob, the CDR-3 knob having an amino acid sequence length K, the sequence starting at position X+1 and ending at X+K, where K=L-2X, where L is the number of amino acids in the amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending at the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the first conserved cysteine ​​encoded by the DH region in CDR H3. In some of the embodiments, the antibody sequence is a bovine antibody. In some of the embodiments, at least one CDR3-knob antibody has a sequence that is extended by 1, 2, 3, 4, or 5 amino acids at the N- and / or C-terminus compared to the identified sequence.

[0043] In some of the optional embodiments, the peptide sequence comprises an up stalk domain and a down stalk domain, and the cysteine ​​motif is between the up stalk domain and the down stalk domain.

[0044] In some of the embodiments, the peptide sequences are amplified from DNA from cattle immunized with the target antigen. In some of the embodiments, the peptide sequences are amplified from a variable heavy chain cDNA library from immunized cattle using primers specific for either side of the stalk domain of the bovine ultralong CDR3 region.

[0045] In some of any of the embodiments, the peptide sequence does not include an up stalk domain N-terminal to the cysteine ​​motif. In some of any of the embodiments, the peptide sequence does not include a down stalk domain C-terminal to the cysteine ​​motif.

[0046] In some of the embodiments, the ascending stalk domain comprises the sequence CX2TVX5Q, where X2 and X5 are any amino acid. In some of the embodiments, X2 is Ser, Thr, Gly, Asn, Ala, or Pro, and X5 is His, Gln, Arg, Lys, Gly, Thr, Tyr, Phe, Trp, Met, Ile, Val, or Leu. In some of the embodiments, X2 is Ser, Ala, or Thr, and X5 is His or Tyr.

[0047] In some of the embodiments, the peptide sequence is a synthetic CDR3-knob. In some of the embodiments, the peptide sequence is a cyclotide or a modified cyclotide. In some of the embodiments, the peptide sequence is a semi-synthetic CDR3-knob derived from a bovine CDR3-knob.

[0048] In some of the embodiments, the peptide sequence is between 40 and 60 amino acids in length. In some of the embodiments, the peptide sequence is at least 42 amino acids in length. In some of the embodiments, the peptide sequence is 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids in length.

[0049] In some of the embodiments, the peptide sequence comprises at least 4 cysteine ​​residues. In some of the embodiments, the peptide sequence comprises 4 cysteine ​​residues. In some of the embodiments, the peptide sequence comprises 6, 8, 10, or 12 cysteine ​​residues.

[0050] In some of the embodiments, the peptide sequence has at least two disulfide bonds. In some of the embodiments, the peptide sequence has two disulfide bonds. In some of the embodiments, the peptide sequence has three, four, or five disulfide bonds.

[0051] In some of the optional embodiments, the multiple CDR3 knobs are mutated at one or more selected positions within the nucleic acid sequence encoding the peptide sequence, and the multiple replicable expression vectors are a family of mutated vectors.

[0052] In some of the embodiments, the expression vector further comprises a secretory signal sequence. In some of the embodiments, the secretory signal sequence is the pelB signal sequence.

[0053] In some of the embodiments, the preferred host cells are E. coli cells. In some of the embodiments, the preferred host cells are TG1 electrocompetent cells.

[0054] In some of any of the embodiments, the phagemid particles are derived from M13 phage. In some of any of the embodiments, the coat protein is M13 phage gene III coat protein (pIII). In some of any of the embodiments, the helper phage is selected from the group consisting of M13K07, M13R408, M13-VCS, and phiX174. In some of any of the embodiments, the helper phage is M13K07.

[0055] In some of the optional embodiments, the display particles display, on average, one copy of the fusion protein on the surface of the particle.

[0056] Provided herein, in some embodiments, is a library of display particles produced by any of the methods provided.

[0057] Provided herein, in some embodiments, is a replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a single chain variable fragment comprising a bovine variable heavy (VH) region comprising an ultralong CDR3 linked to a variable lambda light (VL) region selected from the VL regions of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof.

[0058] Provided herein, in some embodiments, is a replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a single chain variable fragment comprising a bovine variable heavy (VH) region comprising an ultralong CDR3 linked to a BLV1H12 lambda variable light (VL) region, or a humanized variant thereof.

[0059] In some of the optional embodiments, the replicable expression vector further comprises a second nucleic acid sequence encoding at least a portion of a phage coat protein.

[0060] Provided herein, in some embodiments, is a display particle encoded by any of the replicable expression vectors provided.

[0061] Provided herein, in some embodiments, is a library of display particles that includes any of a plurality of provided display particles.

[0062] In some of any of the embodiments, at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the display particles in the library comprise an scFv that comprises a VH region that comprises an ultralong CDR3 region. In some of any of the embodiments, at least or at least about 30% of the display particles in the library comprise an scFv that comprises a VH region that comprises an ultralong CDR3 region. In some of any of the embodiments, at least or at least about 40% of the display particles in the library comprise an scFv that comprises a VH region that comprises an ultralong CDR3 region. In some of any of the embodiments, at least or at least about 50% of the display particles in the library comprise an scFv that comprises a VH region that comprises an ultralong CDR3 region.

[0063] Provided herein, in some embodiments, is a replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming a disulfide bond.

[0064] In some of the optional embodiments, the replicable expression vector further comprises a second nucleic acid sequence encoding at least a portion of a phage coat protein.

[0065] Provided herein, in some embodiments, is a display particle encoded by any of the replicable expression vectors provided.

[0066] Provided herein, in some embodiments, is a library of display particles that includes any of a plurality of provided display particles.

[0067] In some of any of the embodiments, the display particle is a phage display particle. In some of any of the embodiments, the display particle is a phagemid particle.

[0068] Provided herein, in some embodiments, is a method for selecting an antibody binding protein, comprising: (1) contacting any of a provided library of display particles with a target molecule under conditions that allow binding of the display particles to the target molecule; and (2) separating display particles that bind from those that do not, thereby selecting display particles that include an antibody binding protein that binds to the target molecule.

[0069] In some of any of the embodiments, the display particle is a phage display particle. In some of any of the embodiments, the display particle is a phagemid particle.

[0070] In some of the embodiments, the target molecule is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein (e.g., a checkpoint molecule), a cancer antigen, human IgG, or a recombinant protein thereof. In some of the embodiments, the target molecule is a coronavirus, a coronavirus pseudovirus, a recombinant coronavirus spike protein, or a receptor-binding domain (RBD) of a coronavirus spike protein. In some of the embodiments, the coronavirus is selected from the group consisting of 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. In some of the embodiments, the coronavirus is a SARS-CoV2 selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, or the B.1.1.7 UK variant.

[0071] In some of any of the embodiments, the method further comprises (i) infecting a suitable host cell with a replicable expression vector encoding the selected display particles that bind in (2), (ii) collecting the amplified display particles, and (iii) repeating steps (1) and (2) using the amplified display particles as a library of display particles. In some of any of the embodiments, the display particles are phagemid particles and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding a phage coat protein in an amount sufficient to produce amplified phagemid particles.

[0072] In some of the embodiments, the steps are repeated one or more times. In some of the embodiments, the steps are repeated with the same target molecule or a different target molecule. In some of the embodiments, the steps are repeated with a different target molecule, the different target molecule being related to the target molecule. In some of the embodiments, the different target molecule is of the same type of pathogen as the target molecule, is in the same pathogen group as the target molecule, or is a variant of the target molecule.

[0073] In some optional embodiments, the method further comprises sequencing the fusion genes in the selected display particles to identify the antibody binding proteins.

[0074] In some of the optional embodiments, the method further comprises producing full length IgG or Fab from the selected antibody binding protein.

[0075] In some of any of the embodiments, the antibody binding protein is an scFv and the method comprises constructing a heavy chain or portion thereof comprising linking a VH region of the scFv to a constant region or portion thereof. In some of any of the embodiments, the method comprises constructing a humanized VH region by replacing the knob region of the very long CDR3 region of the humanized bovine VH region with the very long CDR3 region of the selected antibody binding protein. In some of any of the embodiments, the very long CDR3 region of the selected antibody binding protein is replaced between the up stalk strand and the down stalk strand of the humanized bovine VH region. In some of any of the embodiments, the VH region comprises the formula V1-X-V2, the V1 region of the heavy chain comprises the sequence set forth in SEQ ID NO: 111, the X region comprises the very long CDR3 of the selected antibody binding protein, and the V2 region comprises the sequence set forth in SEQ ID NO: 112. In some of any of the embodiments, the method further comprises constructing a heavy chain or portion thereof comprising linking the humanized VH region to a constant region or portion thereof. In some of any of the embodiments, the heavy chain or portion thereof is a human IgG1 heavy chain or portion thereof.

[0076] In some of the embodiments, the method further comprises co-expressing the heavy chain or a portion thereof with a light chain. In some of the embodiments, the light chain is a bovine light chain of BLVH12, BLV5D3, BLV8C11, BF1H1, BLV5B8, or F18, or a humanized variant thereof. In some of the embodiments, the light chain is a BLV1H12 light chain (SEQ ID NO: 113) or a humanized variant thereof. In some of the embodiments, the light chain is a humanized light chain set forth in SEQ ID NO: 114. In some of the embodiments, the light chain is a BLV5B8 light chain (SEQ ID NO: 115) or a humanized variant thereof. In some of the embodiments, the light chain is a human light chain. In some of the embodiments, the light chain is selected from the group consisting of VL1-47, VL1-40, VL1-51, and VL2-18. In some of the optional embodiments, the light chain is set forth in any one of SEQ ID NOs: 116-120.

[0077] In some of any of the embodiments, the light chain is a BLV1H12 light chain comprising the sequence set forth in SEQ ID NO: 113, or a humanized variant thereof. In some of any of the embodiments, the light chain is a BLV5B8 light chain comprising the sequence set forth in SEQ ID NO: 115, or a humanized variant thereof.

[0078] Provided herein in some embodiments is a method for producing a soluble ultralong CDR3 knob, the method comprising: (a) transforming E. coli with an expression vector encoding a fusion protein comprising an ultralong CDR3 knob and a bacterial chaperone linked by a cleavable linker, wherein the ultralong CDR3 knob is a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds; (b) culturing the bacteria under conditions permissive for expression of the fusion protein; (c) isolating the fusion protein from the supernatant of a bacterial cell lysate; and (d) cleaving the cleavable linker of the fusion protein, thereby producing a soluble ultralong CDR3 knob comprising 1-6 disulfide bonds free of the bacterial chaperone.

[0079] In some of any of the embodiments, the ultralong CDR3 knob is an antibody binding protein selected by any of the methods provided.

[0080] In some of any of the embodiments, the ultralong CDR3 knob is an antibody binding protein identified by any of the methods provided.

[0081] In some of any of the embodiments, the fusion protein has increased solubility compared to the ultralong CDR3 knob alone. In some of any of the embodiments, the bacterial chaperone is thioredoxin A (TrxA).

[0082] In some of the embodiments, the cleavable linker is an enterokinase cleavage tag having the amino acid sequence DDDDK (SEQ ID NO: 106). In some of the embodiments, cleaving the cleavable linker comprises adding enterokinase to the supernatant.

[0083] In some of the embodiments, the soluble ultralong CDR3 knob comprises an additional linker that allows cyclization of the soluble ultralong CDR3 knob via chemical or enzymatic methods. In some of the embodiments, the additional linker allows sortase-mediated cyclization. In some of the embodiments, the method further comprises cyclizing the soluble ultralong CDR3 knob.

[0084] In some of any of the embodiments, the method further comprises (e) removing enterokinase and / or bacterial chaperones from the solution containing the soluble ultralong CDR3 knob.

[0085] In some of the embodiments, the method further comprises enriching the soluble ultralong CDR3 knobs from a solution comprising the soluble ultralong CDR3 knobs. In some of the embodiments, the enriching comprises size exclusion chromatography.

[0086] In some of any of the embodiments, the method further comprises producing a multispecific binding molecule comprising a soluble ultralong CDR3 knob.

[0087] In some of the optional embodiments, the ultralong CDR3 knob is between 3 and 8 kDa in size. In some of the optional embodiments, the ultralong CDR3 knob is between 4 and 5 kDa in size.

[0088] Provided herein, in some embodiments, is a fusion protein comprising an ultralong CDR3 knob and a bacterial chaperone linked by a cleavable linker, wherein the ultralong CDR3 knob is a peptide sequence of 25-70 amino acids having a cysteine ​​motif containing 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds.

[0089] In some of any of the embodiments, the bacterial chaperone is thioredoxin A (TrxA).

[0090] In some of the optional embodiments, the cleavable linker is an enterokinase cleavage tag having the amino acid sequence DDDDK (SEQ ID NO: 106).

[0091] In some of the optional embodiments, the ultralong CDR3 knob comprises between 1 and 6 disulfide bonds.

[0092] Provided herein, in some embodiments, are compositions comprising any of the fusion proteins provided.

[0093] Provided herein is a method of identifying a CDR3 knob sequence from an antibody sequence, comprising identifying a conserved cysteine ​​in framework 3 and a conserved tryptophan in framework 4, and determining the sequence of the CDR-3 knob, which has an amino acid sequence length K, the sequence starting at position X+1 and ending at X+K, where K=L-2X, where L is the number of amino acids in the amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending at the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the first conserved cysteine ​​encoded by the DH region in CDR H3. In some of the embodiments, the antibody sequence is a bovine antibody. In some of the embodiments, the CDR3-knob antibody has a sequence that is extended by 1, 2, 3, 4, or 5 amino acids at the N- and / or C-terminus compared to the identified sequence.

[0094] Provided herein in some embodiments is a purified soluble ultralong CDR3 knob produced by any of the methods provided, wherein the soluble ultralong CDR3 is 25-75 amino acids in length and comprises 1-6 disulfide bonds.

[0095] In some of the optional embodiments, the ultralong CDR3 knob is between 3 and 8 kDa in size. In some of the optional embodiments, the ultralong CDR3 knob is between 4 and 5 kDa in size.

[0096] In some embodiments, the ultralong CDR3 knob has an amino acid sequence length K, the sequence starting at position X+1 and ending at X+K, where K=L-2X, where L is the number of amino acids in the antibody amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending at the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the first conserved cysteine ​​encoded by the DH region in CDR H3. In some embodiments, the antibody sequence is a bovine antibody. In some aspects, the knob sequence has a sequence that is further extended by 1, 2, 3, 4, or 5 amino acids at the N- and / or C-terminus.

[0097] Provided herein is a peptide knob having a sequence of length K, where the knob has an amino acid sequence length K, the sequence starting at position X+1 and ending at X+K, where K=L-2X, where L is the number of amino acids in the antibody amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending at the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the first conserved cysteine ​​encoded by the DH region in CDR H3. In some embodiments, the antibody sequence is a bovine antibody. In some aspects, the knob sequence has a sequence that is further extended by 1, 2, 3, 4, or 5 amino acids at the N- and / or C-terminus.

[0098] Provided herein, in some embodiments, are compositions comprising any of the purified soluble ultralong CDR3s provided.

[0099] In some of the optional embodiments, the composition further comprises a pharma- ceutically acceptable carrier.

[0100] In some of the embodiments, the composition is formulated for parenteral administration. In some of the embodiments, the composition is formulated for intravenous, intramuscular, topical, otic, conjunctival, nasal, inhalation, or subcutaneous administration. In some of the embodiments, the composition is formulated for administration by inhalation. [Brief description of the drawings]

[0101] [Figure 1] FIG. 1 shows a schematic diagram of an exemplary ultralong CDR3 bovine antibody, containing a "knob" peptide with a size of 4-6 kDa. [Figure 2A] Shows binding of immunized bovine sera to the RBD domain of SARS CoV-2 S protein by ELISA. [Figure 2B] Shows the neutralizing activity of serum IgG against SARS-CoV-2 pseudovirus. [Figure 3A] The pIII phage fusion constructs in each display library (ie, scFv and "knob" display) are shown. [Figure 3B] FIG. 1 shows a schematic diagram of the pTAU1 phage vector multiple cloning site used for direct cloning of the bovine CDR3 knob DNA fragment as an NcoI-NotI fragment. [Figure 3C] FIG. 1 shows a schematic diagram of the pTAU1-BLV1H12(-VH) phage scFv vector multiple cloning site used to clone a bovine VH DNA fragment as an NcoI-XhoI fragment in frame with the BLV1H12 V-lambda DNA. [Figure 3D] 1 shows the separation between the very long VH fragment and a shorter VH fragment that does not contain the very long CDR3 region on an agarose gel. [Figure 4] 1 shows a sequence alignment of exemplary ultralong antibodies R2C1 (SKD, SEQ ID NO:68), R2C3 (SKM, SEQ ID NO:69), R4C1 (SEQ ID NO:70), R5C1 (SEQ ID NO:71), SR3A3 (SEQ ID NO:72), RR2F12 (SEQ ID NO:73), and RR2G3 (SEQ ID NO:74). Germline sequences are also shown (SEQ ID NO:75). [Figure 5A]1 shows binding of an exemplary chimeric bovine-human IgG1 antibody to spike protein. [Figure 5B] Binding to the RBD is also shown. [Figure 5C] ELISA binding of IgG antibodies to recombinant stabilized spike proteins from several SARS CoV strains. [Figure 5D] ELISA binding curves of select IgG antibodies against Omicron-variant RBD (left) or recombinant stabilized spike trimer (right). [Figure 5E] 4 reflects exemplary ELISA data for R4C1 and R2D9 against SARS-CoV-2 compared to SARS-CoV-1. [Figure 5F] Figure 1 shows ELISA binding activity for three different exemplary antibody knob candidates against WT (Wuhan) SARS CoV-2 spike protein. [Figure 5G] A modified Western blot using SDS and detected with biotinylated RBD is shown. [Figure 6A] FIG. 1 shows a schematic diagram of the trxA-CDR3-knob fusion and the pET32b vector cloning sites used for CDR3-knob expression. [Figure 6B] FIG. 1 shows a schematic diagram of the purification process from bacterial lysate. [Figure 6C] 1 shows a CDR3-knob SDS-PAGE demonstrating efficient purification of soluble CDR3-knob from E. coli lysates. [Figure 6D] 1 shows an exemplary SDS-PAGE gel of several purified ultralong CDR H3 knob peptides. [Figure 7A] 1 shows the results of a Wuhan-Hu-1 spike protein capture ELISA using serial dilutions of IMAC purified trxA fusion. [Figure 7B] Binding of the TrxA-R2G3 fusion protein is also shown. [Figure 8A] FIG. 1 shows a background subtraction ELISA of soluble biotinylated RBD binding to an exemplary purified R2-G3 CDR3-knob. [Figure 8B]Soluble R2G3 knob binding compared to a reference anti-spike antibody (CR3022) is shown. [Figure 8C] The amino acid sequences of exemplary truncated R2G3 mutants are shown.Exemplary truncated R2G3 mutants include R2G3 TRUNC1 (SEQ ID NO: 87), R2G3 TRUNC2 (SEQ ID NO: 88), R2G3 TRUNC3 (SEQ ID NO: 89), R2G3 TRUNC3A (SEQ ID NO: 90), R2G3 TRUNC3B (SEQ ID NO: 91), R2G3 TRUNC4 (SEQ ID NO: 92), and R2G3 TRUNC5 (SEQ ID NO: 93).The parent R2G3 variant from which the exemplary truncated mutants are derived is also shown (SEQ ID NO: 86). [Figure 8D] SDS-PAGE of R2G3 cleavage products after bacterial expression and purification is shown. [Figure 8E] Shown are the results of ELISA binding of biotinylated RBD with coated CDR3-knob cleavage. [Figure 9A] A size-exclusion chromatograph for purified R4C1 knob is shown. [Figure 9B] A gel electrophoresis gel of two fractions (A4 and A7) is shown. [Figure 9C] A size-exclusion chromatograph for purified R2G3 knob is shown. [Figure 9D] A gel electrophoresis gel of fraction (A6) is shown. [Figure 10A] The results of a pseudovirus luciferase assay for four exemplary ultralong CDR3 antibodies (F12, G3, SKD, and SKM) against wild-type (Figure 10A), "UK" variant (Figure 10B), "484K" variant (Figure 10C), and "SA" variant (Figure 10D) SARS CoV-2 spike protein-expressing viruses are shown. [Figure 10B] The results of a pseudovirus luciferase assay for four exemplary ultralong CDR3 antibodies (F12, G3, SKD, and SKM) against wild-type (Figure 10A), "UK" variant (Figure 10B), "484K" variant (Figure 10C), and "SA" variant (Figure 10D) SARS CoV-2 spike protein-expressing viruses are shown. [Figure 10C] The results of a pseudovirus luciferase assay for four exemplary ultralong CDR3 antibodies (F12, G3, SKD, and SKM) against wild-type (Figure 10A), "UK" variant (Figure 10B), "484K" variant (Figure 10C), and "SA" variant (Figure 10D) SARS CoV-2 spike protein-expressing viruses are shown. [Figure 10D] The results of a pseudovirus luciferase assay for four exemplary ultralong CDR3 antibodies (F12, G3, SKD, and SKM) against wild-type (Figure 10A), "UK" variant (Figure 10B), "484K" variant (Figure 10C), and "SA" variant (Figure 10D) SARS CoV-2 spike protein-expressing viruses are shown. [Figure 11A] 1 shows IC50 values ​​of different IgG antibodies against pseudoviruses from various coronavirus strains. [Figure 11B] Comparison of R2G3 IgG, Fab, and Knob in neutralizing wild-type SARS-CoV-2 pseudovirus. [Figure 12] 1 is a diagram of multispecific knob peptide compositions and formats. Multiple paratope knob peptides can be conjugated to the immunoglobulins comprising them as homodimers or heterodimers to provide multispecific binding polypeptides. Multiple paratope knob peptides can also be directly linked in series, for example via a linker. Multiple knob peptides can also be combined as a mixture or cocktail to provide a combined polyclonal composition. [Figure 13A] The crystal structure of BLV1H12 Fab (PDB 4k3d) is shown. [Figure 13B] A close-up of the stalk and knob regions with framework 3 cysteines, knob position 1 cysteines, and framework 4 tryptophan side chains are shown. [Figure 14] 1 shows a sequence alignment of the stalk and knob regions for 12 exemplary antibodies. The knob region is flanked by the ascending and descending stalk regions, shown in white text highlighted in black. [Figure 15] FIG. 1 is a schematic diagram of the stalk and knob domain (L), which contains CDR H3 plus three residues at the N-terminus. [Figure 16A] Binding of biotinylated RBD by coated CDR3-knob cleavage assessed via ELISA. [Figure 16B] 1 shows an exemplary SDS-PAGE of R2G3 truncations after bacterial expression and purification. [Figure 17A] ELISA binding of biotinylated RBD with coated CDR3-knob N-terminal truncations. [Figure 17B] 1 shows an exemplary SDS-PAGE of R2G3 N-terminal truncations after bacterial expression and purification. [Figure 18A] 1 shows sequence alignment of primers specific for the up-stalk domain and down-stalk domain of the bovine ultralong CDR3 region. [Figure 18B] The PCR products obtained by amplification using the primers are shown. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0102] Provided herein in some embodiments are methods for preparing display libraries, including bovine or synthetic ultralong CDR3 display libraries or cyclotide display libraries, as well as methods for screening the libraries for binding molecules specific to target molecules. In some embodiments, the display libraries are derived from sequences selectively amplified from cDNA of immunized bovine, e.g., to enrich or select for sequences encoding ultralong CDR3s. Also provided herein in some embodiments are methods for producing soluble peptides, and in some cases, soluble ultralong CDR3 knobs. The soluble ultralong CDR3 knobs produced can be bovine or synthetic. The soluble peptides produced by the provided methods also include cyclotides.

[0103] In some embodiments, the methods provided allow for the screening and production of disulfide-linked knob peptides, including those derived from bovine antibodies containing ultralong CDR3s, which can be independently expressed and produced by the methods provided as independent binding units. In some embodiments, the methods provided provide a simple immunization-based discovery platform. This platform offers greater peptide structure diversity than in vitro display-based platforms, with each knob peptide screened and produced potentially having its own novel disulfide-linked structure. This platform also allows for rapid hit discovery against target molecules.

[0104] As described herein, bovine antibodies have a unique structure, including an ultra-long CDR3 sequence in which a subdomain with an unusual structure forms a structure formed from a "stalk" composed of two 12-residue antiparallel β-strands (a rising strand and a falling strand) and a longer, e.g., 39-residue disulfide-rich "knob" located on the stalk, away from the standard antibody paratope. The knob region of the ultra-long CDR3 confers antigen binding. Unlike antibodies from other species, such as human and mouse, the CDR regions L1, L2, L3, H1, and H2 of bovine or bovine-derived antibodies show less sequence diversity, since most of their sequence diversity is in CDR H3 (Stanfield et al. 2016 Sci.Immunol,1(1):doi:10.1126 / sciimmunol.aaf7962). Thus, in bovine or bovine-derived antibodies, antigen binding is primarily or exclusively via CDR H3, and other CDRs do not contribute to antigen binding.

[0105] Available methods for the analysis and exploitation of unique ultralong CDR H3 structures are not entirely satisfactory. In many cases, the methods require excision and purification of the isolated knob domain (Macpherson et al. 2020 PLOS Biology, 18(9):e30000821). Such methods are not easily amenable to good manufacturing practice for generating therapeutic molecules and are also inefficient in terms of the amount of knob protein that can be produced. Furthermore, the use of enzymes for knob excision can also compromise the integrity of the isolated protein.

[0106] Notably, it is found herein that disulfide-bonded knob peptides derived from ultralong CDR-H3 of bovine antibodies can be produced by methods that can be independently expressed and provided as independent binding units, and retain picomolar binding affinity and neutralizing activity for target molecules (e.g., SARS-CoV2). The knob peptides are only approximately 4-5 kDa in size, e.g., about 4.4 kDa, and represent the smallest independent antigen-binding domains. They exhibit high affinity and epitope coverage, similar to larger antibodies. Their small size approaches the size of small molecules, thereby opening up the utility of antigen-binding domains as new and novel therapeutic agents. For example, their small size allows for better tissue penetration and even alveolar delivery. Furthermore, the knob peptides provided are stable due to their tightly disulfide-bonded small domains. This stable structure avoids the aggregation seen in nanobodies and other immunoglobulin domain-based fragments. As demonstrated herein, findings also indicate that knob peptides can be produced in high yields by the provided methods in E. coli, making them highly exploitable as therapeutic molecules. Peptides generated by the provided methods can target known viruses or virus classes, either as mAbs or knobs. In some embodiments, mAbs and knobs are ready for rapid discovery and production in case of a pandemic outbreak and can be rapidly pivoted in case of new strains of disease. In some embodiments, mAbs and knobs production by the provided methods can be rapidly transitioned to GMP standards. In some embodiments, knobs can be used for "cocktails" of therapeutic regimens.

[0107] Also provided herein are compositions comprising any of the knob peptides screened and produced by the methods provided. In some embodiments, the compositions can be monoclonal, providing a single knob peptide that provides a single paratope for binding to a desired antigen, such as SARS-CoV2. In other embodiments, the compositions provided are polyclonal, comprising a mixture or cocktail of different knob peptides directed against different epitopes of an antigen or different antigens (Figure 12).

[0108] Additionally, multispecific binding formats are provided herein that leverage the small and unique size of knob peptides (Figure 12). For example, different knob paratopes can be engineered into the backbone of a human or humanized ultralong CDR-H3 full-length antibody where Fc dimerization provides a bivalent or multivalent format. In some cases, a "knobs into hole" Fc engineering strategy can be used to produce heterodimeric bispecific or multispecific formats that contain two, three, four or more different knob peptides, each of which provides a different paratope for binding to a desired antigen, such as the spike protein of SARS-CoV2.

[0109] Also provided herein are therapeutic methods and uses of the provided binding polypeptides, including antibodies or antigen-binding fragments or knob polypeptides, and compositions thereof.

[0110] I. Definition Unless otherwise defined, all technical terms, notations, and other technical and scientific terms or terminology used herein have the same meaning as commonly understood by one of ordinary skill in the art to which the subject matter of the present claims belongs. In some cases, terms having commonly understood meanings are defined herein for clarity and / or ease of reference, and the inclusion of such definitions herein should not necessarily be construed as representing a substantial difference to what is commonly understood in the art.

[0111] As used herein, the articles "a" and "an" refer to one or to more than one (i.e., to at least one) of the grammatical object of the article. By way of example, "an element" means one element or more than one element.

[0112] Throughout this disclosure, various aspects of the claimed subject matter are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the claimed subject matter. Thus, the description of a range should be considered to have all possible subranges specifically disclosed as well as individual numerical values ​​within that range. For example, when a range of values ​​is provided, it is understood that each intervening value between the upper and lower limits of that range, and any other stated or intervening value within that stated range, is encompassed within the claimed subject matter. The upper and lower limits of these smaller ranges can be independently included in the smaller ranges, and are also encompassed within the scope of the claimed subject matter, subject to any specifically excluded limitations within the stated ranges. When a stated range includes one or both of the limits, ranges excluding either or both of those included limits are also encompassed within the claimed subject matter. This applies regardless of the breadth of the range.

[0113] As used herein, the term "about" will be understood by those of ordinary skill in the art and will vary to some extent with the context in which it is used. As used herein, "about" when referring to a measurable value, such as an amount, duration, etc., is meant to encompass a variation of ±20% or ±10%, more preferably ±5%, even more preferably ±1%, and even more preferably ±0.1% from the particular value, such variations being appropriate for carrying out the disclosed methods.

[0114] "Ultralong CDR3" or "ultralong CDR3 sequence", as used interchangeably herein, includes CDR3 or CDR3 sequence not derived from a human antibody sequence. Ultralong CDR3 may be 35 amino acids or more in length, e.g., 40 amino acids or more in length, 45 amino acids or more in length, 50 amino acids or more in length, 55 amino acids or more in length, or 60 amino acids or more in length. In some embodiments, ultralong CDR3 is 25-70 amino acids in length, e.g., 40-70 amino acids in length. Typically, ultralong CDR3 is a heavy chain CDR3 (CDR-H3 or CDRH3). Ultralong CDR3H3 exhibits characteristics of CDRH3 of ruminant (e.g., bovine) sequence. The structure of ultralong CDR3 includes a "stalk" composed of an ascending strand and a descending strand (e.g., each about 12 amino acids long) and a disulfide-rich "knob" located on the stalk. The unique "stalk and knob" structure of ultralong CDR3 results in two antiparallel β-strands (the up-stalk strand and the down-stalk strand) that support a disulfide-bonded knob that protrudes from the antibody surface to form a mini-antigen binding domain. In some embodiments, ultralong CDR3 antibodies comprise, in order, a up-stalk region, a knob region, and a down-stalk region.

[0115] As used herein, the terms "CDR3-knob" or "knob" used interchangeably refer to a portion of an ultralong CDR3, which is a peptide sequence of 40-70 amino acids in length, the CDR3-knob having at least four non-canonical Cys residues, e.g., 6, 8, 10 or up to 12 non-canonical cysteine ​​residues, forming two to six disulfide bonds. Typically, the knob includes the first cysteine ​​residue with the amino acid motif cysteine-proline (CP). In some cases, the CDR3-knob may be located between the ascending stalk (stalk A) or the descending stalk (stalk B) in an antibody or antigen-binding fragment comprising an ultralong CDR3, and the CDR3-knob protrudes from the antibody interface to form an antigen-binding site with the antigen. In other cases, the CDR3-knob may be produced independently as a "knob" peptide as described herein.

[0116] As used herein, the interchangeably used terms "knob peptide", "CDR3-knob peptide", or "knob-only peptide" refer to an independently produced linear disulfide-bonded peptide that is 40-70 amino acids long and contains 2-6 disulfide bonds formed by at least 4 non-canonical Cys residues, e.g., 6, 8, 10, or up to 12 non-canonical cysteine ​​residues. Knob peptides can be derived from ultra-long CDR3 or can be synthetically produced. Typically, the first cysteine ​​of the peptide sequence contains the first cysteine ​​residue with the amino acid motif cysteine-proline (CP). Knob peptides are linear molecules that cannot undergo cyclization to form circular molecules.

[0117] "Substantially similar" or "substantially the same" refers to a sufficiently high degree of similarity between two numerical values ​​(generally one associated with an antibody disclosed herein and the other associated with a reference / comparator antibody) such that one of skill in the art would consider the difference between the two values ​​to have little or no biological and / or statistical significance within the context of the biological characteristic measured by the values ​​(e.g., Kd values). The difference between the two values ​​is preferably less than about 50%, preferably less than about 40%, preferably less than about 30%, preferably less than about 20%, preferably less than about 10% as a function of the value for the reference / comparator antibody.

[0118] "Binding affinity" generally refers to the strength of the sum of non-covalent interactions between a single binding site of a molecule (e.g., an antibody) and its binding partner (e.g., an antigen). Unless otherwise indicated, "binding affinity" refers to the intrinsic binding affinity that reflects a 1:1 interaction between members of a binding pair (e.g., an antibody and an antigen). The affinity of a molecule X for its partner Y can generally be represented by a dissociation constant. Low affinity antibodies generally bind antigens slowly and tend to dissociate easily, whereas high affinity antibodies generally bind antigens faster and tend to remain bound longer. Various methods of measuring binding affinity are known in the art, any of which can be used for the purposes of this disclosure.

[0119] "Percent (%) amino acid sequence identity" with respect to a peptide or polypeptide sequence refers to the percentage of amino acid residues in a candidate sequence that are identical to the amino acid residues in a particular peptide or polypeptide sequence, after aligning the sequences and introducing gaps, if necessary, to achieve the maximum percent sequence identity, without considering any conservative substitutions as part of the sequence identity. Alignment for purposes of determining percent amino acid sequence identity can be accomplished in a variety of ways that are within the skill of the art, for example, using publicly available computer software such as BLAST, BLAST-2, ALIGN, or MegAlign (DNASTAR) software. Those skilled in the art can determine appropriate parameters for measuring alignment, including any algorithms required to achieve maximum alignment over the entire length of the sequences being compared.

[0120] "Polypeptide," "peptide," "protein," and "protein fragment" may be used interchangeably to refer to a polymer of amino acid residues. These terms apply to amino acid polymers in which one or more amino acid residues are artificial chemical mimetics of a corresponding naturally occurring amino acid, as well as to naturally occurring and non-naturally occurring amino acid polymers.

[0121] "Amino acid" refers to naturally occurring and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function similarly to naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those that are later modified, e.g., hydroxyproline, gamma-carboxyglutamic acid, and O-phosphoserine. Amino acid analogs refer to compounds that have the same basic chemical structure as naturally occurring amino acids, e.g., an alpha carbon, which is bound to a hydrogen, a carboxyl group, an amino group, and an R group (e.g., homoserine, norleucine, methionine sulfoxide, methionine methylsulfonium). Such analogs may have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as naturally occurring amino acids. Amino acid mimetics refer to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that function similarly to a naturally occurring amino acid.

[0122] "Conservatively modified variants" applies to both amino acid and nucleic acid sequences. "Amino acid variants" refers to amino acid sequences. With respect to a particular nucleic acid sequence, conservatively modified variants refer to nucleic acids that code for the same or essentially identical amino acid sequences, or, if the nucleic acid does not code for an amino acid sequence, to essentially the same or related (e.g., naturally adjacent) sequences. Due to the degeneracy of the genetic code, a large number of functionally identical nucleic acids code for most proteins. For example, the codons GCA, GCC, GCG, and GCU all code for the amino acid alanine. Thus, at all positions where alanine is specified by a codon, the codon can be changed to another of the corresponding codons described without changing the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one type of conservatively modified variation. All nucleic acid sequences herein that code for a polypeptide also describe silent variations of the nucleic acid. Those skilled in the art will recognize that in certain circumstances, each codon in a nucleic acid (except AUG, which is usually the only codon for methionine, and TGG, which is usually the only codon for tryptophan) can be modified to produce a functionally identical molecule. Thus, silent mutations in a nucleic acid encoding a polypeptide are implicit in the sequence described with respect to the expression product, but not with respect to the actual probe sequence. With respect to amino acid sequences, those skilled in the art will recognize that individual substitutions, deletions, or additions to a nucleic acid, peptide, polypeptide, or protein sequence that alter, add, or delete a single amino acid or a small percentage of amino acids in the encoded sequence are "conservatively modified variants," including cases where the alteration results in the replacement of an amino acid with a chemically similar amino acid. Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to, and do not exclude, the polymorphic variants, interspecies homologs, and alleles disclosed herein.Exemplary conservative substitutions include: 1) alanine (A), glycine (G), 2) aspartic acid (D), glutamic acid (E), 3) asparagine (N), glutamine (Q), 4) arginine (R), lysine (K), 5) isoleucine (I), leucine (L), methionine (M), valine (V), 6) phenylalanine (F), tyrosine (Y), tryptophan (W), 7) serine (S), threonine (T), and 8) cysteine ​​(C), methionine (M) (see, e.g., Creighton, Proteins (1984)).

[0123] "Humanized" or "human engineered" forms of non-human (e.g., bovine) antibodies are, for example, chimeric antibodies that contain amino acids represented in human immunoglobulin sequences, including those whose minimal sequence is derived from a non-human immunoglobulin. For example, a humanized or human engineered antibody can be a non-human (e.g., bovine) antibody in which some residues have been replaced by residues from analogous sites in a human antibody (see, e.g., U.S. Pat. No. 5,766,886). A humanized antibody can also optionally contain at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin. For further details, see Jones et al., Nature 321:522-525 (1986); Riechmann et al., Nature 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol. 2:593-596 (1992). See also the following reviews and references cited therein: Vaswani and Hamilton, Ann. Allergy, Asthma & Immunol. 1:105-115 (1998); Harris, Biochem. Soc. Transactions 23:1035-1038 (1995); Hurle and Gross, Curr. Op. Biotech. 5:428-433 (1994).

[0124] "Variable domain" with respect to an antibody refers to a specific Ig domain of an antibody heavy or light chain that contains a sequence of amino acids that varies between different antibodies. Each light chain and each heavy chain has one variable region domain (VL and VH). The variable domain provides antigen specificity and is therefore responsible for antigen recognition. Each variable region contains the CDRs, which are part of the antigen binding site domain and the framework region (FR).

[0125] "Constant region domain" refers to a domain in an antibody heavy or light chain that contains a sequence of amino acids that is relatively more conserved among antibodies than the variable region domain. Each light chain has a single light chain constant region (CL) domain, and each heavy chain contains one or more heavy chain constant region (CH) domains, including CH1, CH2, CH3, and possibly CH4. Full-length IgA, IgD, and IgG isotypes contain CH1, CH2 CH3, and a hinge region, while IgE and IgM contain CH1, CH2 CH3, and CH4. The CH1 and CL domains extend the Fab arm of the antibody molecule, thus contributing to the interaction with antigens and the rotation of the antibody arm. The antibody constant region can perform effector functions, such as, but not limited to, clearance of antigens, pathogens, and toxins to which the antibody specifically binds, through interactions with various cells, biomolecules, and tissues.

[0126] The terms "complementarity determining region" and "CDR", which are synonymous with "hypervariable region" or "HVR", are known in the art to refer to non-contiguous sequences of amino acids in an antibody variable region that confer antigen specificity and / or binding affinity. Generally, there are three CDRs in each heavy chain variable region (CDR-H1, CDR-H2, CDR-H3) and three CDRs in each light chain variable region (CDR-L1, CDR-L2, CDR-L3). "Framework region" and "FR" are known in the art to refer to the non-CDR portions of the heavy and light chain variable regions. Generally, there are four FRs in each full-length heavy chain variable region (FR-H1, FR-H2, FR-H3, and FR-H4) and four FRs in each full-length light chain variable region (FR-L1, FR-L2, FR-L3, and FR-L4).

[0127] The precise amino acid sequence boundaries of a given CDR or FR can be determined by Kabat et al. (1991), "Sequences of Proteins of Immunological Interest," 5th Ed. Public Health Service, National Institutes of Health, Bethesda, MD ("Kabat" numbering scheme); Al-Lazikani et al., (1997) JMB 273, 927-948 ("Chothia" numbering scheme); MacCallum et al., J. Mol. Biol. 262:732-745 (1996), "Antibody-antigen interactions: Contact analysis and binding site topography," J. Mol. Biol. 262, 732-745. ("Contact" numbering scheme); Lefranc MP et al., "IMGT unique numbering for immunoglobulin and T cell receptor variable domains and Ig superfamily V-like domains," Dev Comp Immunol, 2003 Jan;27(1):55-77 (the "IMGT" numbering scheme), Honegger A and Pluckthun A, "Yet another numbering scheme for immunoglobulin variable domains: an automatic modeling and analysis tool," J Mol Biol, 2001 Jun 8;309(3):657-70 (the "Aho" numbering scheme), and Martin et al., "Modeling antibody hypervariable loops: a combined algorithm," PNAS, 1989,86(23):9268-9272 (the "AbM" numbering scheme).

[0128] The boundaries of a given CDR or FR may vary depending on the scheme used for identification. For example, the Kabat scheme is based on structural alignment, while the Chothia scheme is based on structural information. The numbering of both the Kabat and Chothia schemes is based on the most common antibody region sequence length, with insertions being addressed by an insertion letter, e.g., "30a", and deletions appearing in some antibodies. The two schemes place certain insertions and deletions ("indels") in different positions, resulting in different numbering. The Contact scheme is based on the analysis of complex crystal structures and is similar in many ways to the Chothia numbering scheme. The AbM scheme is a compromise between the Kabat and Chothia definitions, based on those used by Oxford Molecular's AbM antibody modeling software.

[0129] Table 1 below lists exemplary position boundaries for CDR-L1, CDR-L2, CDR-L3, and CDR-H1, CDR-H2, CDR-H3 as identified by Kabat, Chothia, AbM, and Contact schemes, respectively. For CDR-H1, the residue numbering is listed using both the Kabat and Chothia numbering schemes. FRs are located between the CDRs, e.g., FR-L1 is located before CDR-L1, FR-L2 is located between CDR-L1 and CDR-L2, FR-L3 is located between CDR-L2 and CDR-L3, etc. Note that the Kabat numbering scheme shown places the insertion at H35A and H35B, so when numbered using the Kabat numbering rules shown, the end of the Chothia CDR-H1 loop varies between H32 and H34 depending on the length of the loop.

[0130] [Table 1] 1-Kabat et al. (1991), “Sequences of Proteins of Immunological Interest,” 5th Ed.Public Health Service, National Institutes of Health, Bethesda, MD. 2-Al-Lazikani et al.,(1997)JMB 273,927-948

[0131] Thus, unless otherwise specified, the "CDRs" or "complementarity determining regions" of a given antibody or region thereof, such as a variable region, or each designated CDR (e.g., CDR-H1, CDR-H2, CDR-H3) should be understood to encompass a (or particular) complementarity determining region defined by any of the foregoing schemes. For example, a particular CDR (e.g., CDR-H3) may be a CDR that is complementary to a given V H Or V L When a region amino acid sequence is described as containing the amino acid sequence of a corresponding CDR, it is understood that such a CDR has the sequence of the corresponding CDR (e.g., CDR-H3) in the variable region as defined by any of the above schemes. In some embodiments, a specific CDR sequence is identified. Although exemplary CDR sequences of the provided antibodies are described using various numbering schemes, it is understood that the provided antibodies can contain CDRs described by any of the other above numbering schemes or other numbering schemes known to those of skill in the art.

[0132] Similarly, unless otherwise specified, the FRs or individual designated FRs (e.g., FR-H1, FR-H2, FR-H3, FR-H4) of a given antibody or region thereof, such as a variable region thereof, should be understood to encompass a (or specific) framework region defined by any of the known schemes. In some cases, specific CDRs, FRs, or schemes for identifying FRs or CDRs are specified, such as CDRs defined by Kabat, Chothia, AbM, or Contact methods. In other cases, specific amino acid sequences of the CDRs or FRs are given.

[0133] An antibody comprising an ultralong CDR3 is an antibody comprising a variable heavy (VH) chain with an ultralong CDR3. The antibody may further comprise a pairing of a VH chain and a variable light (VL) chain. In some embodiments, the antibody or antigen-binding fragment comprises a heavy chain variable region and a light chain variable region. Thus, the term antibody includes full-length antibodies and portions thereof, including antibody fragments, such as comprising a heavy chain or a portion thereof and / or a light chain or a portion thereof. An antibody may comprise two heavy chains (which may be represented as H and H') and two light chains (which may be represented as L and L'), each L chain being linked to a H chain by a covalent disulfide bond, and the two H chains being linked to each other by disulfide bonds. The terms "full-length antibody" or "intact antibody" are used interchangeably to refer to an antibody in its substantially intact form, as opposed to an antibody fragment. A full-length antibody is typically an antibody having two full-length heavy chains (e.g., VH-CH1-CH2-CH3 or VH-CH1-CH2-CH3-CH4) and two full-length light chains (VL-CL) and a hinge region.

[0134] The term "antibody" as used herein is used in the broadest sense and includes polyclonal and monoclonal antibodies, and includes fragment antigen binding (Fab) fragments, F(ab')2 fragments, Fab' fragments, Fv fragments, recombinant IgG (rIgG) fragments, heavy chain variable (V) fragments capable of specific binding. H) regions, and single chain variable fragments (scFv).

[0135] An "antibody fragment" comprises a portion of an intact antibody, the antigen-binding and / or variable regions of the intact antibody. Antibody fragments include, but are not limited to, Fab fragments, Fab' fragments, F(ab')2 fragments, Fv fragments, disulfide-linked Fv (dsFv), Fd fragments, Fd' fragments, single-chain antibody molecules including single-chain Fv (scFv) or single-chain Fab (scFab), antigen-binding fragments of any of the above, and multispecific antibodies derived from antibody fragments.

[0136] A "Fab fragment" is an antibody fragment resulting from digestion of a full-length immunoglobulin with papain, or a fragment having the same structure produced synthetically, e.g., by recombinant methods. A Fab fragment is a fragment of an antibody that contains only a light chain (V L and C L ), as well as the variable domain of the heavy chain (V H ) and one constant region domain of the heavy chain (C H 1) and another strand containing

[0137] An "scFv fragment" is a fragment of a variable light chain (VLC) covalently linked by a polypeptide linker in any order. L ) and variable heavy chain (V H (Gly-Ser) with several Glu or Lys residues dispersed throughout to increase solubility. n It is a residue.

[0138] As in the description of a nucleotide or amino acid position "corresponding to" a nucleotide or amino acid position in a disclosed sequence as shown in the sequence listing, the term "corresponding to" in reference to a protein position refers to a nucleotide or amino acid position identified upon alignment with a disclosed sequence based on structural sequence alignment or using a standard alignment algorithm such as the GAP algorithm. For example, corresponding residues of a similar sequence (e.g., a fragment or species variant) can be determined by alignment to a reference sequence by structural alignment methods. By aligning the sequences, one skilled in the art can identify corresponding residues, for example, using conserved and identical amino acid residues as guides.

[0139] The term "effective amount" or "therapeutically effective amount" as used herein means an amount of a pharmaceutical composition sufficient to significantly and positively modify (e.g., provide a positive clinical response) the symptoms and / or condition being treated. The effective amount of active ingredient for use in a pharmaceutical composition will vary depending on the particular condition being treated, the severity of the condition, the duration of treatment, the nature of any concurrent therapy, the particular active ingredient employed, the particular pharma- ceutically acceptable excipients and / or carriers utilized, and similar factors within the knowledge and expertise of the attending physician.

[0140] As used herein, the term "pharmaceutical acceptable" refers to a material, such as a carrier or diluent, that does not abrogate the biological activity or properties of the compound and is relatively non-toxic, i.e., the material can be administered to an individual without causing undesired biological effects or interacting in a deleterious manner with any of the components of the composition in which it is contained.

[0141] As used herein, a composition refers to any mixture of two or more products, substances, or compounds, including cells, which may be a solution, suspension, liquid, powder, paste, aqueous, non-aqueous, or any combination thereof.

[0142] As used herein, the term "pharmaceutical composition" refers to a mixture of at least one compound of the present invention with other chemical components, such as carriers, stabilizers, diluents, dispersants, suspending agents, thickeners, and / or excipients. The pharmaceutical composition facilitates administration of the compound to an organism. Multiple techniques of administering the compound exist in the art, including, but not limited to, intravenous, oral, aerosol, parenteral, ocular, pulmonary, and topical administration, and administration by inhalation.

[0143] As used herein, "disease or disorder" refers to a pathological condition in an organism resulting from a cause or condition (including, but not limited to, an infection, an acquired condition, a genetic condition) and is characterized by an identifiable symptom.

[0144] As used herein, the terms "treat," "treating," or "treatment" refer to ameliorating a disease or disorder, e.g., slowing or halting or reducing the onset of a disease or disorder, e.g., an underlying cause of the disorder or at least one of its clinical symptoms.

[0145] As used herein, the term "subject" refers to an animal, including a mammal, such as a human. The terms subject and patient may be used interchangeably.

[0146] As used herein, "optional" or "optionally" means that the subsequently described event or circumstance may or may not occur, and that the description includes instances when that event or circumstance occurs and instances when it does not occur. For example, an optionally substituted group means that the group is unsubstituted or substituted.

[0147] II. Display Libraries and Selection Methods In some embodiments, methods for preparing an ultralong CDR3 antibody display library are provided herein. Also in some embodiments, methods for preparing an ultralong CDR3-knob display library are provided herein. In some embodiments, the display library is a phage display library. In some embodiments, the ultralong CDR3 antibody or knob is derived from a bovine antibody, e.g., based on an antibody produced by a bovine immunized with a target antigen. In some embodiments, the ultralong CDR3 antibody or knob is synthetic. In some embodiments, the ultralong CDR3 antibody or knob comprises, e.g., a cyclotide or modified cyclotide comprising an exogenous peptide sequence.

[0148] A. Library Generation Methods Techniques for manipulating nucleic acids, such as for generating mutations in sequences, subcloning, labeling, probing, sequencing, hybridization, etc., are described in detail in the scientific and patent literature. See, for example, Sambrook J, Russell DW (2001) Molecular Cloning: a Laboratory Manual, 3rd ed. Cold Spring Harbor Laboratory Press, New York; Current Protocols in Molecular Biology, Ausubel ed., John Wiley & Sons, Inc., New York (1997); Laboratory Techniques in Biochemistry and Molecular Biology: Hybridization With Nucleic Acid Probes, Part I, Theory and Nucleic Acid Preparation, Tijssen ed., Elsevier, NY (1993).

[0149] Any known method for generating libraries containing mutant polynucleotides and / or polypeptides can be used with the provided methods and vectors to generate display libraries, e.g., phage display libraries, and select binding proteins from the libraries. The libraries can be used in screening assays to select binding proteins from the libraries for any antigen, including, for example, any virus, bacteria, other pathogens, immune-modulating proteins (e.g., checkpoint molecules), or cancer antigens. To facilitate screening, antibody libraries are typically screened using display techniques such that there is a physical link between the individual molecules of the library (phenotype) and the genetic information (genotype) that encodes them. These methods include, but are not limited to, bacterial display, yeast display, mammalian display, phage display (Smith, GP (1985) Science 228:1315-1317), mRNA display, ribosome display, and cellular display, including DNA display.

[0150] In some embodiments, the library provided is a phage display library. In some embodiments, the display library is a phage display library. In some embodiments, the phage display library is produced through the use of phagemids that, in addition to encoding a polypeptide for display, encode at least a portion of a phage coat protein. In some embodiments, the phagemid particles are derived from M13 phage. In some embodiments, the coat protein is M13 phage gene III coat protein (pIII).

[0151] In some embodiments, phage display libraries are produced by fusing candidate binding polypeptides described herein, such as ultralong CDR3 scFv antibody fragments or ultralong CDR3 knob peptides, with the gene III minor coat protein of the F-specific filamentous phage of Escherichia coli (Ff:f1, M13, or fd). Alternatively, other bacterial species, including Pseudomonas fluorescens, can be used to produce phage display libraries. In some embodiments, gene III is the minor coat protein of M13 phage (also called pIII). The gene III minor coat protein (present in about 5 copies at one end of the virion) is involved in proper phage assembly and infection by attachment to E. coli pili. Methods of phage display are known.

[0152] In some embodiments, a nucleic acid encoding a candidate binding polypeptide described herein, such as an ultralong CDR3 scFv antibody fragment or an ultralong CDR3 knob peptide, is inserted into or constructed as part of a replicable expression vector, and the nucleic acid is fused to a nucleic acid encoding at least a portion of a phage coat protein, such as pill. In some embodiments, a nucleic acid encoding a candidate binding polypeptide described herein, such as an ultralong CDR3 scFv antibody fragment or an ultralong CDR3 knob peptide, is fused to pill.

[0153] In some embodiments, replicable expression vectors are plasmid vectors that generally contain various components including promoters, signal sequences, phenotypic selection genes, origin of replication sites, and other necessary components known to those skilled in the art. The most commonly used promoters in prokaryotic vectors include the lac Z promoter system, alkaline phosphatase pho A promoter, bacteriophage lambda PL promoter (temperature sensitive promoter), tac promoter (hybrid trp-lac promoter regulated by lac repressor), tryptophan promoter, bacteriophage T7 promoter, or other suitable microbial promoters. Examples of promoter systems include Lac Z, lambda PL, TAC, T7 polymerase, tryptophan, and alkaline phosphatase promoters, and combinations thereof. Suitable prokaryotic signal sequences can be obtained, for example, from genes encoding LamB or OmpF (Wong et al., Gene, 68:193 1983), MalE, PhoA, E. coli heat-stable enterotoxin II (STII) signal sequence, or Pel B secretion signal sequence. In some embodiments, the expression vector further comprises a secretion signal sequence operably fused to the nucleic acid encoding the polypeptide. In some embodiments, the secretion sequence is a Pel B secretion signal sequence. In some embodiments, the replicable expression vector may also comprise a phenotypic selection gene. Exemplary phenotypic selection genes are those that encode proteins that confer antibiotic resistance to the host cell. As examples, the ampicillin resistance gene (amp), tetracycline resistance gene (tet), or carbenicillin resistance gene may be used.

[0154] The construction of a suitable vector containing a nucleic acid encoding a desired polypeptide is prepared using standard recombinant DNA procedures. The isolated DNA fragments that are combined to form the vector are cleaved, tailored, and ligated together in a specific order and orientation to generate the desired vector. In some embodiments, the DNA is cleaved using an appropriate restriction enzyme(s) in a suitable buffer. The appropriate buffer, DNA concentration, and incubation time and temperature are specified by the manufacturer of the restriction enzyme. Generally, an incubation time of about 1 or 2 hours at 37°C is appropriate, although some enzymes require higher temperatures. After incubation, the enzyme and other contaminants are removed by extraction of the digestion solution with a mixture of phenol and chloroform, and the DNA is recovered from the aqueous fraction by precipitation with ethanol.

[0155] In order for DNA fragments to be ligated together to form a functional vector, the ends of the DNA fragments must be compatible with each other. In some cases, the ends are directly compatible after endonuclease digestion. However, it may be necessary to first convert the sticky ends that are typically produced by endonuclease digestion to blunt ends to make them compatible for ligation. To blunt the ends, the DNA is treated with 10 units of Klenow fragment of DNA polymerase I (Klenow) in the presence of four deoxynucleotide triphosphates for at least 15 minutes at 15° C. in a suitable buffer. The DNA is then purified by phenol-chloroform extraction and ethanol precipitation.

[0156] The DNA fragments to be ligated together (pre-digested with an appropriate restriction enzyme so that the ends of each fragment to be ligated are compatible) are placed in a solution. In some embodiments, the DNA fragments are provided in approximately equimolar amounts. In some embodiments, the solution also contains ATP, ligase buffer, and ligase, e.g., T4 DNA ligase, e.g., 10 units or about 10 units per 0.5 μg of DNA. If the DNA fragments are to be ligated to a vector, the vector is first linearized by cutting with an appropriate restriction endonuclease. The linearized vector is then treated with alkaline phosphatase or calf intestinal phosphatase. The phosphatase treatment prevents self-ligation of the vector during the ligation step.

[0157] In some embodiments, the plurality of constructed replicable expression vectors are transformed into a suitable host cell. Suitable host cells include prokaryotic host cells. In some embodiments, the host cell used to express or produce the display library is an E. coli cell. Suitable prokaryotic host cells include E. coli strain JM101, E. coli K12 strain 294 (ATCC No. 31,446), E. coli strain W3110 (ATCC No. 27,325), E. coli X1776 (ATCC No. 31,537), E. coli XL-1Blue (stratagene), and E. coli B. However, many other strains of E. coli, such as HB101, NM522, NM538, NM539, and many other species and genera of prokaryotes can be used as well. In addition to the E. coli strains listed above, bacilli such as Bacillus subtilis, other Enterobacteriaceae such as Salmonella typhimurium or Serratia marcesans, and various Pseudomonas species can all be used as hosts. In some embodiments, the host cell is a protease-deficient strain of E. coli. In some embodiments, the host cell is a TG1 electrocompetent cell.

[0158] Transformation of prokaryotic cells is readily accomplished using the calcium chloride method described in section 1.82 of Sambrook et al. (supra). Alternatively, electroporation (Neumann et al., EMBO J., 1:841 1982) may be used to transform these cells. In some embodiments, the method further comprises infecting the transformed host cells with a helper phage carrying a gene encoding a phage coat protein. In some embodiments, the method further comprises the use of a helper phage to facilitate efficient expression of the phagemid particles. In some embodiments, the helper phage is selected from the group consisting of M13K07, M13R408, M13-VCS, and phiX174. In some embodiments, the helper phage is M13K07. The transformed, infected host cells are then cultured under conditions suitable for the formation of recombinant phagemid particles that contain at least a portion of the plasmid and are capable of transforming a host. Transformed cells are selected by growth on an antibiotic, such as tetracycline (tet) or ampicillin (amp), carbenicillin, or other antibiotic depending on the particular expression vector, and are made resistant by the presence of a resistance gene on the vector.

[0159] After selection of transformed cells, these cells are grown in culture and the plasmid DNA (or other vector with the foreign gene inserted) is then isolated. Plasmid DNA can be isolated using methods known in the art. The isolated DNA can be purified by methods known in the art. The purified plasmid DNA is then analyzed by restriction mapping and / or DNA sequencing.

[0160] 1. Polypeptides for Display In some embodiments, the polypeptide for display comprises an ultralong CDR3. In bovine antibodies, the ultralong CDR3 sequence forms a structure in which a subdomain with an unusual structure is formed from a "stalk" composed of two 12-residue antiparallel β-strands (a rising strand and a falling strand) and a longer, e.g., 39-residue disulfide-rich "knob" located on the stalk away from the standard antibody paratope. The long antiparallel β-ribbon serves as a bridge to link the knob domain with the main antibody scaffold. The unique "stalk and knob" structure of the ultralong CDR3 results in two antiparallel β-strands (a rising stalk strand and a falling stalk strand) supporting a disulfide-bonded knob that protrudes from the antibody surface to form a mini antigen-binding domain. In some embodiments, the ultralong CDR3 antibody comprises, in order, a rising stalk region, a knob region, and a falling stalk region.

[0161] In some embodiments, the ultralong CDR-H3 comprises an up stalk domain (stalk A), a disulfide-rich knob region, and a down stalk domain (stalk B), with the knob region located between the up stalk domain and the down stalk domain. In some embodiments, the sequence of the ultralong CDR-H3 provides a structure of antiparallel β-strands protruding from the antibody, with the disulfide-rich knob region located at the tip of the antibody (Figure 1). Stalk A comprises a predominantly hydrophobic side chain and a relatively conserved motif at the base that starts the up strand. This conserved motif is typically found after the first cysteine ​​residue in the variable region sequences of various bovine or cow sequences. In some embodiments, the base of stalk A comprises residues CTTVHQ (SEQ ID NO: 98), CATVHQ (SEQ ID NO: 99), CAIVQQ (SEQ ID NO: 100), or CATVDQ (SEQ ID NO: 101), which stabilize the base by interacting with residues of CDR-H1. Stalk A is connected by a variable number of residues, e.g., 2-8 amino acid residues, before the first conserved cysteine ​​residue that forms part of the disulfide-bonded knob region. In some embodiments, the knob region includes a first conserved amino acid motif, Cys-Pro(CP), where the first cysteine ​​residue forms a first disulfide bond with another cysteine ​​residue in the knob. The knob can include 2-12 cysteine ​​residues that can form 2-6 disulfide bonds. The stalk can be of variable length and stalk B can include alternating aromatics that form a ladder through stacking interactions, which can contribute to the stability of long solvent-exposed two-stranded β-ribbons (Wang et al. Cell. 2013, 153(6):1379-1393). In some embodiments, stalk B includes a conserved pattern of alternating tyrosines that support the knob structure and may have the motif YX1YX2Y (SEQ ID NO: 102).

[0162] In some embodiments, the ultralong CDR3 comprises or is a peptide sequence of 25-70 amino acids. In some embodiments, the ultralong CDR3 is a peptide sequence that is 35-70 amino acids, 40-70 amino acids, 45-70 amino acids, 50-70 amino acids, 55-70 amino acids, or 60-70 amino acids in length, or is about 35-70 amino acids, 40-70 amino acids, 45-70 amino acids, 50-70 amino acids, 55-70 amino acids, or 60-70 amino acids in length.

[0163] In some embodiments the ultralong CDR3 comprises a cysteine ​​motif. In some embodiments, the cysteine ​​motif comprises 2 to 20 cysteine ​​residues, e.g., 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, 2 to 8, 2 to 6, 2 to 4, 4 to 20, 4 to 18, 4 to 16, 4 to 14, 4 to 12, 4 to 10, 4 to 8, 4 to 6, 6 to 20, 6 to 18, 6 to 16, 6 to 14, 6 to 12, 6 to 10, 6 to 8, 8 to 20, 8 to 18, 8 to 16, 8 to 14, 8 to 12, 8 to 10, 10 to 20, 10 to 18, 10 to 16, 10 to 14, 10 to 12, 12 to 20, 12 to 18, 12 to 16, 12 to 14, 14 to 20, 14 to 18, 14 to 16, 16 to 20, 16 to 18, or more. or about 2-18, 2-16, 2-14, 2-12, 2-10, 2-8, 2-6, 2-4, 4-20, 4-18, 4-16, 4-14, 4-12, 4-10, 4-8, 4-6, 6-20, 6-18, 6-16, 6-14, 6-12, 6-10, 6-8, 8-20, 8-18, 8- In some embodiments, the cysteine ​​motif comprises 16, 8-14, 8-12, 8-10, 10-20, 10-18, 10-16, 10-14, 10-12, 12-20, 12-18, 12-16, 12-14, 14-20, 14-18, 14-16, 16-20, 16-18, or 18-20 cysteine ​​residues (each inclusive). In some embodiments, the cysteine ​​motif comprises 2-12 cysteine ​​residues.

[0164] In some embodiments, the ultralong CDR3 knob comprises between 1 and 10 disulfide bonds, e.g., 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, young or 9-10, or about 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or 9-10 disulfide bonds (each inclusive). In some embodiments, the ultralong CDR3 knob comprises 1 to 6 disulfide bonds.

[0165] In some embodiments, the ultralong CDR3 comprises a rising stalk domain. In some embodiments, the ultralong CDR3 comprises a falling stalk domain. In some embodiments, a cysteine ​​motif is between the rising stalk domain and the falling stalk domain. In some embodiments, the rising stalk domain comprises the sequence CX2TVX5Q (SEQ ID NO: 103), where X2 and X5 are any amino acid. In some embodiments, X2 is Ser, Thr, Gly, Asn, Ala, or Pro, and X5 is His, Gln, Arg, Lys, Gly, Thr, Tyr, Phe, Trp, Met, Ile, Val, or Leu (SEQ ID NO: 104). In some embodiments, X2 is Ser, Ala, or Thr, and X5 is His or Tyr (SEQ ID NO: 105).

[0166] In other embodiments, the ultralong CDR3 does not include an up stalk domain N-terminal to the cysteine ​​motif. In some embodiments, the ultralong CDR3 does not include a down stalk domain C-terminal to the cysteine ​​motif.

[0167] In some embodiments, the polypeptides for display, e.g., polypeptides comprising an ultralong CDR3, are derived from bovine antibodies. In some embodiments, the polypeptides for display are produced by amplifying sequences from a bovine complementary DNA (cDNA) library. In some embodiments, a cDNA template library is prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from bovine. In some embodiments, the cDNA template library is synthesized using a pool of immunoglobulin-specific primers. In some embodiments, the cDNA template library is synthesized using a pool of IgM, IgA, and IgG-specific primers. Exemplary primers for use include those having the sequences shown in SEQ ID NO:3 (IgG), SEQ ID NO:4 (IgM), SEQ ID NO:5 (IgA), and SEQ ID NO:6 (IgG).

[0168] In some embodiments, the cattle are immunized with a target antigen. In some embodiments, the target antigen is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein (e.g., a checkpoint molecule), a cancer antigen, human IgG, or a recombinant protein thereof. In some embodiments, the target antigen is a viral protein. In some embodiments, the cattle are immunized with multiple target antigens, e.g., different viral antigens. In some embodiments, the different viral antigens are proteins associated with different variants, clades, or strains of a virus.

[0169] In some embodiments, the target antigen is a coronavirus, a coronavirus pseudovirus, or an antigen of such a virus, such as a recombinant coronavirus spike protein, or the receptor binding domain (RBD) of a coronavirus spike protein. The coronavirus can be from the Orthocoronavirus subfamily, which is one of two subfamilies in the Coronaviridae family, the Nidovirales order, and the Riboviria region. There are four genera: Alphacoronavirus, Betacoronavirus, Gammacoronavirus, and Deltacoronavirus. SARS CoV2 is a Betacoronavirus belonging to the Sarbecovirus subgenus. In some embodiments, the coronavirus is selected from the group consisting of 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. In some embodiments, the coronavirus is a SARS-CoV2 selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, or the B.1.1.7 UK variant. In some embodiments, the SARS CoV-2 specific antigen comprises an S trimer polypeptide. In some embodiments, the SARS CoV-2 specific antigen comprises an S monomer polypeptide. In some embodiments, the SARS CoV-2 specific antigen comprises a polynucleotide encoding an S trimer or monomer polypeptide. In some embodiments, the cattle are immunized with multiple target antigens associated with any combination of coronaviruses 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. In some embodiments, the cattle are immunized with multiple target antigens associated with any combination of SARS-CoV2 variants selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, or the B.1.1.7 UK variant.

[0170] In some embodiments, the antigen is a cancer antigen. In some embodiments, the antigen is ACTHR, endothelial cell Anxa-1, aminopetidase N, anti-IL-6R, alpha-4-integrin, alpha-5-beta-3 integrin, alpha-5-beta-5 integrin, alpha-fetoprotein (AFP), ANPA, ANPB, APA, APN, APP, 1AR, 2AR, AT1, B1, B2, BAGE1, BAGE2, B cell receptor BB1, BB2, BB4, calcitonin receptor, cancer antigen 125 125, CA125), CCK1, CCK2, CD5, CD10, CD11a, CD13, CD14, CD19, CD20, CD22, CD25, CD30, CD33, CD38, CD45, CD52, CD56, CD68, CD90, CD133, CD7, CD15, CD34, CD44, CD206, CD271, CEA (carcinoembryonic antigen), CGRP, chemokine receptor, cell surface annexin-1, cell surface plectin-1, Cripto-1, CRLR, CXCR2, CXCR4, DCC, DLL3, E2 glycoprotein, EGFR, EGFRvIII, EMR1, endosialin, E P2, EP4, EpCAM, EphA2, ET receptor, fibronectin, fibronectin ED-B, FGFR, frizzled receptor, GAGE1, GAGE2, GAGE3, GAGE4, ​​GAGE5, GAGE6, GLP-1 receptor, family A G protein-coupled receptor (rhodopsin-like), family B G protein-coupled receptor (secretin receptor-like), family C G protein-coupled receptor (metabotropic glutamate receptor-like), GD2, GP100, GP120, glypican-3, hemagglutinin, heparan sulfate, HER1, HER2, HER3, HER4, HMFG, HPV 16 / 18 and E6 / E7 antigens, hTERT, IL11-R, IL-13R, ITGAM, kallikrein-9, Lewis Y, LH receptor, LHRH-R, LPA1, MAC-1, MAGE 1, MAGE 2, MAGE 3, MAGE4, MART1, MC1R, mesothelin, MUC1, MUC16, Neu (cell surface nucleolin), neprilysin, neuropilin-1, neuropilin-2, NG2, NK1, NK2, NK3, NMB-R, Notch-1, NY-ESO-1, OT-R, mutated p53, p97 melanoma antigen, NTR2, NTR3, p32 (p32 / gC1q-R / HABP1), p75, PAC1, PAR1, Patched (PTCH), PDGFR, PDFG receptor, PDT, protease-cleaved collagen IV, proteinase 3, prohibitin, protein tyrosine kinase 7, PSA, PSMA, purinergic P2X family (e.g., P2X1-5), mutated Ras, RAMP1, RAMP2, RAMP3 patched, RET receptor, plexin, smoothened, sst1, sst2A, sst2B, sst3, sst4, sst5, substance P, TEM, T cell CD3 receptor, TAG72, TGFBR1, TGFBR2, Tie-1, Tie-2, Trk-A, Trk-B, Trk-C, TR1, TRPA, TRPC, TRPV, TRPM, TRPML, TRPP (e.g., TRPV1-6, TRPA1, TRPC1-7, TRPM1-8, TRPP1-5, TRPML1-3), TSH receptor, VEGF receptor (VEGFR1 or Flt-1, VEGFR2 or FLK-1 / KDR, and VEGF-3 or FLT-4), voltage-gated ion channels, VPAC1, VPAC2, Wilms' tumor 1, Y1, Y2, Y4, and Y5.

[0171] In some embodiments, the antigen is HER1 / EGFR, HER2 / ERBB2, CD20, CD25 (IL-2Rα receptor), CD33, CD52, CD133, CD206, CEA, CEACAM1, CEACAM3, CEACAM5, CEACAM6, cancer antigen 125 (CA125), alpha-fetoprotein (AFP), Lewis Y, TAG72, Caprin-1, mesothelin, PDGF receptor, PD-1, PD-L1, CTLA-4, IL-2 receptor, vascular endothelial growth factor (VEGF), CD30, EpCAM, EphA2, glypican-3, gpA33, mucin, CAIX, PSMA, folate binding protein, gangliosides (such as GD2, GD3, GM1, and GM2), VEGF receptor (VEGF receptor, VEGFR), integrin αVβ3, integrin α5β1, ERBB3, MET, IGF1R, EPHA3, TRAILR1, TRAILR2, RANKL, FAP, tenascin, AFP, BCR complex, CD3, CD18, CD44, CTLA-4, gp72, HLA-DR 10β, HLA-DR antigen, IgE, MUC-1, nuC242, PEM antigen, metalloproteinase, ephrin receptor, ephrin ligand, HGF receptor, CXCR4, CXCR4, bombesin receptor, and SK-1 antigen.

[0172] In some embodiments, the antigen is CD25, PD-1 (CD279), PD-L1 (CD274, B7-H1), PD-L2 (CD273, B7-DC), CTLA-4, LAG3 (CD223), TIM3 (HAVCR2), 4-1BB (CD137, TNFRSF9), CXCR2, CXCR4 (CD184), CD27, CEACAM1, Galectin 9, BT LA, CD160, VISTA (PD1 homolog), B7-H4 (VCTN1), CD80 (B7-1), CD86 (B7-2), CD28, HHLA2 (B7-H7), CD28H, C D155, CD226, TIGIT, CD96, Galectin 3, CD40, CD40L, CD70, LIGHT (TNFSF14), HVEM (TNFRSF14), B7-H3 (CD2 76), Ox40L (TNFSF4), CD137L (TNFSF9, GITRL), B7RP1, ICOS (CD278), ICOSL, KIR, GAL9, NKG2A (CD94), GARP, TL1A, TNFRSF25, TMIGD2, BTNL2, butyrophilin family, CD48, CD244, Siglec family, CD30, CSF1R, MICA (MHC class I polypeptide-related sequence A), MICB (MHC class I polypeptide-related sequence B), NKG2D, KIR family (killer cell immunoglobulin-like receptor, LILR family (leukocyte immunoglobulin-like receptor, CD85, ILT, LIR), SIRPA (signal regulatory protein alpha), CD47 (IAP), Neuropilin 1 (NRP-1), VEGFR, and VEGF.

[0173] In some embodiments, the antigen is an immune-modulating protein (e.g., a checkpoint molecule). In some embodiments, the antigen is an immune checkpoint receptor ligand. Exemplary immune checkpoint molecules that can be targeted for blocking or inhibition include PD1 (CD279), PDL1 (CD274, B7-H1), PDL2 (CD273, B7-DC), CTLA-4, LAG3 (CD223), TIM3, 4-1BB (CD137), 4-1BBL (CD137L), GITR (TNFRSF18, AITR), CD40, Ox40 (CD134, TNFRSF4), CXCR2, tumor associated antigens (TAAs), and / or IL-16 (IL-16). In some embodiments, the immune checkpoint molecule includes, but is not limited to, CD25, PD-1, PD-L1, PD-L2, CTLA-4, LAG-3, TIM-3, 4-1BB, GITR, CD40, CD40L, OX40, OX40L, CXCR2, B7-H3, B7-H4, BTLA, HVEM, CD28, and VISTA.

[0174] In some embodiments, the polypeptide for display is synthetic. In some embodiments, the synthetic polypeptide comprises all or a portion of a bovine antibody, e.g., an ultralong CDR3 knob. In some embodiments, the synthetic polypeptide is a modified cyclotide. In some embodiments, the modified cyclotide comprises, e.g., a bovine ultralong CDR3 knob sequence.

[0175] In some embodiments, the polypeptides for display comprise a variable heavy region and a variable light region comprising an ultralong CDR-H3. Particular formats include single chain formats, such as single chain variable fragments (scFv). In other embodiments, the polypeptides for display are smaller peptides, i.e., knob peptides, between 25 and 70 amino acids in length, for example between 40 and 70 amino acids in length. Exemplary molecules for display and display libraries are described.

[0176] a. scFv peptides for display In some embodiments, the polypeptide for display is a single chain variable fragment (scFv). In some embodiments, the scFv comprises a VH region with a bovine ultralong CDR3. In some embodiments, the VH region is encoded by a sequence amplified from a bovine cDNA template library, for example, prepared from RNA isolated from peripheral blood mononuclear cells (PBMC) from immunized bovine animals. In some embodiments, the amplification is by amplifying a sequence encoding a VH region of a bovine antibody family known or suspected to comprise an ultralong CDR3. In some embodiments, a sequence of a VH region of the IgHV1-7 family is amplified to produce a sequence encoding the VH region of the scFv. In some embodiments, the VH region of the IgHV1-7 family is amplified using a forward primer comprising the sequence shown in SEQ ID NO: 84 and a reverse primer comprising the sequence shown in SEQ ID NO: 85. In some embodiments, the forward primer and / or reverse primer further comprises a sequence specific for a restriction enzyme site to facilitate cloning. In some embodiments, the VH region of the IgHV1-7 family is amplified using the forward primer shown in SEQ ID NO:12 and the reverse primer shown in SEQ ID NO:13.

[0177] In some embodiments, preparation of sequences of VH regions of polypeptides for display also includes a size separation step. In some embodiments, after amplification of VH region sequences, for example of the IgHV1-7 family, such as from a bovine cDNA template library, sequences encoding VH regions with ultralong CDR3s are separated from shorter sequences encoding VH regions without ultralong CDR3s. In some embodiments, the size separation step further enriches the amplified sequences encoding VH regions with ultralong CDR3s.

[0178] In some embodiments, the size separation step comprises separating sequences that are, are about, or are more than 425, 450, 475, 500, 525, or 550 base pairs in length from the plurality of amplified VH region-encoding sequences, wherein the sequences that are, are about, or are more than 425, 450, 475, 500, 525, or 550 base pairs in length comprise sequences encoding VH regions with ultralong CDR3s. In some embodiments, sequences that are 550 base pairs in length, about 550 base pairs in length, or greater than 550 base pairs in length are separated from the remaining sequences.

[0179] In some embodiments, size separation is performed by agarose gel electrophoresis. In some embodiments, 1.2%, 1.5%, or 2% agarose gels are used. In some embodiments, 2% agarose gels are used.

[0180] In some embodiments, the scFv comprises a VL region that is fixed across the polypeptides of the display library. In some aspects, the use of a fixed VL region improves the selection and / or screening of scFvs that comprise a VH region with an ultralong CDR3. In some embodiments, the VL region is a variable lambda light (VL) region selected from the group consisting of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof. In some embodiments, the VL region is a BLV5B8 lambda VL region (SEQ ID NO: 110) or a humanized variant thereof. In some embodiments, the VL region is a BLV1H12 lambda VL region or a humanized variant thereof. In some embodiments, the BLV1H12 VL region is set forth in SEQ ID NO:2. In some embodiments, the humanized variant comprises one or more of the amino acid substitutions S2A, T5N, P8S, A12G, A13S, and P14L based on Kabat numbering, the amino acid substitutions I29V and N32G in the CDR1 region, and / or the DNN to GDT amino acid substitution in the CDR2 region. In some embodiments, the humanized variant of BLV1H12 comprises the sequence set forth in SEQ ID NO: 107.

[0181] In some embodiments, at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 30% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 40% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 50% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 60% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 70% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 80% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 90% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 95% of the displayed scFvs comprise a VH region that comprises an ultralong CDR3 region.

[0182] In some embodiments, the VH and VL regions of the scFv are directly linked. In some embodiments, the VH and VL regions of the scFv are indirectly linked, for example, via a peptide linker. In some embodiments, the linker is a flexible linker. In some embodiments, the peptide linker is (Gly4 Ser)3 (SEQ ID NO:94).

[0183] b. Knob peptides for display In some embodiments, the polypeptide for display is an ultralong CDR3 knob, e.g., a bovine ultralong CDR3. In some embodiments, the ultralong CDR3 knob is encoded by a sequence amplified from a bovine cDNA template library, e.g., one prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from immunized bovine.

[0184] In some embodiments, the amplification is by amplifying a sequence encoding the ultralong CDR3 knob. In some embodiments, primers specific for the up stalk domain and the down stalk domain of the bovine ultralong CDR3 region are used to amplify the sequence encoding the ultralong CDR3 knob. In some embodiments, the ultralong CDR3 knob comprises a portion of the up stalk domain, such as 1, 2, 3, 4, 5, or 6 amino acids. In some embodiments, the ultralong CDR3 knob comprises a portion of the down stalk domain, such as 1, 2, 3, 4, 5, 6, 7, 8, or 9 amino acids. In some embodiments, the up stalk domain comprises the sequence CX2TVX5Q, where X2 and X5 are any amino acid. In some embodiments, X2 is Ser, Thr, Gly, Asn, Ala, or Pro, and X5 is His, Gln, Arg, Lys, Gly, Thr, Tyr, Phe, Trp, Met, Ile, Val, or Leu. In some embodiments, X2 is Ser, Ala, or Thr and X5 is His or Tyr. In some embodiments, the primers used for amplification comprise or consist of the sequences shown in SEQ ID NOs: 7-11. In some embodiments, the primers used for amplification comprise or consist of the sequences shown in SEQ ID NOs: 8-11. In some embodiments, the primers used for amplification comprise or consist of the sequences shown in SEQ ID NOs: 121-130. In some embodiments, the primers used for amplification comprise or consist of the sequences shown in SEQ ID NOs: 123, 127, and 128.

[0185] In some embodiments, the primers used for amplification are a pool of different primers specific for the ascending stalk domain and the descending stalk domain. In some embodiments, the pool of primers comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different primers. In some embodiments, the pool of primers comprises at least 2, 3, 4, 5, 6, 7, 8, 9, or 10 different primers from the primers set forth in SEQ ID NOs: 7-11 and 121-130. In some embodiments, the pool of primers comprises at least 2, 3, 4, 5, 6, or 7 different primers from the primers set forth in SEQ ID NOs: 8-11, 123, 127, and 128. In some embodiments, the pool of primers comprises the primers set forth in SEQ ID NOs: 8-11. In some embodiments, the pool of primers comprises the primers set forth in SEQ ID NOs: 123, 127, and 128. In some embodiments, the pool of primers comprises the primers set forth in SEQ ID NOs: 8-11, 23, 27, and 28.

[0186] In some embodiments, the knob peptide is a peptide identified using the methods described in Section II.C. Once identified, the knob peptide sequence can be amplified using methods known to those of skill in the art. In other embodiments, the knob peptide can be synthetically produced. A variety of techniques can be used, including recombinant methods, chemical synthesis, or a combination thereof. In some embodiments, chemical synthesis methods can include known chemical synthesis techniques, such as phosphoramidite methods. In some cases, recombinant or synthetic nucleic acids can be produced by polymerase chain reaction (PCR).

[0187] c. Synthetic peptides for display In some embodiments, the polypeptides for display are synthetic peptides. In some embodiments, the synthetic peptides are random sequence polypeptides having cysteine ​​motifs and disulfide bonds as described herein, e.g., having 2-20 cysteine ​​residues and 1-10 disulfide bonds. In some embodiments, the synthetic peptides are selected from a random sequence library to have cysteine ​​motifs and disulfide bonds as described herein, e.g., having 2-20 cysteine ​​residues and 1-10 disulfide bonds. Methods for generating random sequence libraries are known.

[0188] In some embodiments, the polypeptide for display is a semi-synthetic ultralong CDR3 knob. In some embodiments, the semi-synthetic ultralong CDR3 knob is derived from a bovine ultralong CDR3 knob that is used as a scaffold for modification. In some embodiments, the bovine ultralong CDR3 knob has been modified to include random mutations, e.g., while preserving the cysteine ​​motif and disulfide bond structures described herein, such that the semi-synthetic ultralong CDR3 knob still includes 2-20 cysteine ​​residues and 1-10 disulfide bonds. In some embodiments, the bovine ultralong CDR3 knob has been modified to include an exogenous peptide sequence. In some embodiments, the bovine ultralong CDR3 knob has been modified to delete one or more peptide sequences therein, e.g., while preserving the cysteine ​​motif and disulfide bond structures described herein, such that the semi-synthetic ultralong CDR3 knob still includes 2-20 cysteine ​​residues and 1-10 disulfide bonds.

[0189] In some embodiments, the polypeptide for display is a cyclotide. In some embodiments, the polypeptide for display is a modified cyclotide that has been modified, for example, to include an exogenous peptide sequence. In some embodiments, the modified cyclotide includes an ultralong CDR3 knob sequence or a portion thereof, including any of those identified by the methods described or provided herein.

[0190] Cysteine-knot microproteins (cyclotides) comprise a naturally occurring family of cysteine-knot microproteins or cyclotides found in various plant species. Cysteine-knot microproteins (cyclotides) are small peptides, typically consisting of about 30-40 amino acids, that can be found in nature as cyclic or linear forms, the cyclic forms having no free N- or C-terminal amino or carboxyl termini. They have a well-defined structure based on three intramolecular disulfide bonds and a small triple-stranded β-sheet (Craik et al., 2001; Toxicon 39, 43-60). The cyclic proteins exhibit a conserved cysteine ​​residue that defines a structure referred to herein as a "cysteine ​​knot." The family includes both naturally occurring cyclic molecules and their linear derivatives, as well as linear molecules that have undergone cyclization. These molecules are useful as molecular framework structures with greater stability than less structured peptides. (Colgrave and Craik,2004;Biochemistry 43,5965-5975).

[0191] The main cyclotide features are their remarkable stability due to the cysteine ​​knot, their small size making them easily accessible for chemical synthesis, and their excellent tolerance to sequence mutations. The cyclotide scaffold is found in almost 30 different protein families, among which conotoxins, spider venoms, pumpkin inhibitors, agouti-related proteins, and plant cyclotides are the most abundant families. Cyclotides from plants of the Rubiaceae and Violaceae families have been found to be mostly head-to-tail cyclic peptides (Craik et al. 2010. Cell. Mol. Life Sci. 67:9-16). However, within the Cucurbita inhibitor family of cyclotides, both cyclic and linear cyclotides have been identified from Momordica cochinchinensis: cyclic trypsin inhibitor (MCoTI)-I and -II, and their linear counterparts MCoTI-III (Hernandez et al. 2000. Biochemistry, 39, 5722-5730). It is now clear that both cyclic and linear variants can exist in different cyclotide families, but the effects of cyclization are less understood. Cyclic peptides are expected to show improved stability, better resistance to proteases, and reduced mobility when compared to their linear counterparts, hopefully resulting in enhanced biological activity. However, linear cyclotides have the advantage that they can be more easily conjugated to other peptides or proteins.

[0192] For example, cyclotides are commonly found in plants. In aspects of the embodiments provided, the cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae, Rubiaceae, and Violaceae plant species. In a preferred aspect, the cyclotides of the present invention are derived from the linear or cyclic forms of cyclotides of Momordicae species, including the Cucurbita serine protease inhibitor family (Otlewski & Korowarsch Acta Biochim Pol. 1996; 43(3): 431-44), and in a more preferred aspect, from the following Momordica cochinchinensis trypsin inhibitors MCoTI-I [SEQ ID NO: 95] and -II [SEQ ID NO: 96] (cyclic in nature), and MCoTI-III (linear in nature) [SEQ ID NO: 97]. Mcoti-I GGVCPKILQRCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 95] McOti-II GGVCPKILKKCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 96] McOti-III ERACPRILKKCRRDSDSPGACICRGNGYCG [SEQ ID NO: 97]

[0193] In some embodiments, the cyclotide molecular framework comprises a sequence of amino acids or analogs thereof that form a cysteine-knot backbone, the cysteine-knot backbone comprising sufficient disulfide bonds or chemical equivalents thereof to impart a knot topology to the three-dimensional structure of the cysteine-knot backbone, and at least one exposed amino acid residue, such as on one or more beta turns and / or within one or more loops, has been inserted or substituted (replaced) compared to the naturally occurring amino acid sequence. In some embodiments, the cyclotide is modified by insertion of or replacement with an exogenous peptide sequence. Thus, the cyclotides described herein are modified cyclotides compared to a natural or wild-type unmodified cyclotide, the modified cyclotide having one or more amino acid sequences, e.g., one or more loops, inserted or replaced by an exogenous peptide sequence. In aspects of the embodiments provided, the modified cyclotide incorporates sufficient amino acid structure to provide high enzyme stability.

[0194] In some embodiments, a modified cyclotide sequence may be defined as having a cysteine ​​knot backbone portion and an exogenous peptide sequence, the modified cyclotide comprising: i) an exogenous peptide sequence, the exogenous peptide sequence being about 2-50 amino acid residues; and ii) a cysteine ​​knot backbone grafted onto the sequence in step i), the cysteine ​​knot backbone having the structure (I): [ka]

[0195] wherein C1-C6 are cysteine ​​residues, and each of C1 and C4, C2 and C5, and C3 and C6 are linked by a disulfide bond to form a cysteine ​​knot, each X represents an amino acid residue in the loop, which amino acid residues are the same or different, and d is about 1 to 2, and one or more of loops 1, 2, 3, 5, or 6 have an amino acid sequence that includes a sequence of clause i), and any loop that includes the sequence of clause i) includes from 2 to about 50 amino acids, and for any of loops 1, 2, 3, 5, or 6 that do not include the sequence of clause i), a, b, c, e, and f are the same or different and each is any number between 3 and 10, and b, c, e, and f are each any number between 1 and 20.

[0196] In some embodiments, the modified cyclotide sequence can be either linear or cyclic.

[0197] In some embodiments, the modified cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae, Rubiaceae, and Violaceae plant species. In some embodiments, the modified cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae species, including the Cucurbita serine protease inhibitor family (Otlewski & Korowarsch Acta Biochim Pol. 1996;43(3):431-44). In some embodiments, the modified cyclotides are derived from the following Momordica cochinchinensis trypsin inhibitors MCoTI-I [SEQ ID NO:95] and -II [SEQ ID NO:96] (cyclic in nature), and MCoTI-III (linear in nature) [SEQ ID NO:97]. Mcoti-I GGVCPKILQRCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 95] McOti-II GGVCPKILKKCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 96] McOti-III ERACPRILKKCRRDSDSPGACICRGNGYCG [SEQ ID NO: 97]

[0198] For example, an unmodified or wild-type cyclotide can be a cyclotide set forth in any one of SEQ ID NOs: 95-97, in which one or more loops have been inserted or replaced by one or more amino acid sequences (e.g., exogenous peptide sequences). In certain embodiments, the modified cyclotide is derived from a loop replacement library based on Mcoti-II (SEQ ID NO: 96).

[0199] In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 1. In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 5. In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 6, as formed upon cyclization.

[0200] In some embodiments, the exogenous peptide sequence inserted or substituted into an unmodified cyclotide, e.g., cyclotide Mcoti-II (SEQ ID NO: 96), is 2 to 50 amino acid residues. In some embodiments, the exogenous peptide sequence is 2 to 40 amino acids, 2 to 30 amino acids, 2 to 25 amino acids, 2 to 20 amino acids, 2 to 15 amino acids, 2 to 10 amino acids, 2 to 5 amino acids, 5 to 50 amino acids, 5 to 40 amino acids, 5 to 30 amino acids, 5 to 25 amino acids, 5 to 20 amino acids, 5 to 15 amino acids, 5 to 10 amino acids, 10 to 50 amino acids, 10 to 40 amino acids, 10 to 30 amino acids, 5 to 25 amino acids, 5 to 20 amino acids, 5 to 15 amino acids, 5 to 10 amino acids, 10 to 50 amino acids, 10 to 40 amino acids, 10 to 30 amino acids, 5 to 20 amino acids, 5 to 20 amino acids, 5 to 15 amino acids, 5 to 10 amino acids, 10 to 50 amino acids, 10 to 40 amino acids, 10 to 30 amino acids, 5 to 5 ... , 10 to 25 amino acids, 10 to 15 amino acids, 15 to 50 amino acids, 15 to 40 amino acids, 15 to 30 amino acids, 15 to 25 amino acids, 15 to 20 amino acids, 20 to 50 amino acids, 20 to 40 amino acids, 20 to 30 amino acids, 20 to 25 amino acids, 25 to 50 amino acids, 25 to 40 amino acids, 25 to 30 amino acids, 30 to 50 amino acids, 30 to 40 amino acids, or 40 to 50 amino acids. In some embodiments, the exogenous peptide sequence is 2 to 30 amino acids, e.g., 2 to 24 amino acids, 2 to 18 amino acids, 2 to 12 amino acids, 2 to 6 amino acids, 6 to 30 amino acids, 6 to 24 amino acids, 6 to 18 amino acids, 6 to 12 amino acids, 12 to 30 amino acids, 12 to 24 amino acids, 12 to 18 amino acids, 18 to 30 amino acids, 18 to 24 amino acids, or 24 to 30 amino acids.

[0201] B. Display Library Also provided herein are libraries of display particles, eg, phagemid particles, including any produced by any of the provided methods.

[0202] Also provided herein is a phagemid that includes or is a replicable expression vector, comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a single chain variable fragment having a bovine variable heavy (VH) region comprising an ultralong CDR3 linked to a variable lambda light (VL) region selected from the group consisting of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof, and a second nucleic acid sequence encoding at least a portion of a phage coat protein. In some embodiments, the VL region is the VL region of BLV1H12.

[0203] Also provided herein is a phagemid that includes or is a replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a bovine ultralong CDR3 knob and a second nucleic acid sequence encoding at least a portion of a phage coat protein.

[0204] Also provided herein is a phagemid that includes or is a replicable expression vector that includes a gene fusion encoding a fusion protein that includes a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif that includes 2-12 cysteine ​​residues capable of forming linked disulfide bonds, and a second nucleic acid sequence encoding at least a portion of a phage coat protein.

[0205] Also provided herein in some embodiments are libraries of display particles, eg, phagemid particles, encoded by any of the phagemids described herein.

[0206] In some embodiments, the display particle comprises an ultralong CDR3 knob, such as any described herein.

[0207] In some embodiments, the display particle comprises a synthetic or semi-synthetic ultralong CDR3 knob, such as any of those described herein.

[0208] In some embodiments, the display particle includes a cyclotide, such as any described herein.

[0209] In some embodiments, the display particle includes a modified cyclotide, such as any of those described herein.

[0210] In some embodiments, the display particles comprise scFvs having a VH that comprises an ultralong CDR3 region. In some embodiments, at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the display particles, e.g., phagemid particles, in a library comprise scFvs having a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 30% of the display particles, e.g., phagemid particles, in a library comprise scFvs having a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 35% of the display particles, e.g., phagemid particles, in a library comprise scFvs having a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 40% of the display particles, e.g., phagemid particles, in a library comprise scFvs having a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 45% of the display particles, e.g., phagemid particles, in a library comprise scFvs that comprise a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 50% of the display particles, e.g., phagemid particles, in a library comprise scFvs that comprise a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 60% of the display particles, e.g., phagemid particles, in a library comprise scFvs that comprise a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 70% of the display particles, e.g., phagemid particles, in a library comprise scFvs that comprise a VH region with an ultralong CDR3 region. In some embodiments, at least or at least about 80% of the display particles, e.g., phagemid particles, in a library comprise scFvs that comprise a VH region with an ultralong CDR3 region. In some embodiments, at least, or at least about 90% of the display particles, eg, phagemid particles, in a library comprise an scFv that comprises a VH region with an ultralong CDR3 region.In some embodiments, at least, or at least about 95% of the display particles, eg, phagemid particles, in a library comprise an scFv that comprises a VH region with an ultralong CDR3 region.

[0211] C. Cell Selection Methods Also provided herein is a method for selecting antibody binding proteins specific to a target molecule from any of the display libraries described herein.These display libraries are then contacted with the target molecule, and the library members with the highest affinity to the target are separated from the members with lower affinity.These display libraries are then contacted with the target molecule, and the library members with the highest affinity to the target are separated from the members with lower affinity.The high affinity binders are then amplified by any suitable system.This process is repeated until a polypeptide of the desired affinity is obtained.

[0212] For example, the display library is a phage display library described herein, in which ultralong CDR3 scFv polypeptides or CDR3-knob peptides are fused to phage coat proteins and displayed on the surface of phagemid particles containing DNA encoding the polypeptides, usually as a single copy of each relevant polypeptide on average. These phagemid particles are then contacted with target molecules, and particles with the highest affinity to the target are separated from particles with lower affinity. High affinity binders are then amplified by infection of bacterial hosts, and the competitive binding step is repeated. This process is repeated until a polypeptide of the desired affinity is obtained.

[0213] In some embodiments, the methods provided include contacting any of the display libraries provided herein with a target molecule under conditions that allow binding of the display particles, e.g., phagemid particles, to the target molecule. In some embodiments, the methods further include separating the display particles, e.g., phagemid particles, that bind from those that do not, thereby selecting display particles, e.g., phagemid particles, that include an antibody binding protein that binds to the target molecule. In some embodiments, the methods include sequencing the fusion gene in the selected particles to identify the antibody binding protein.

[0214] The target molecule can be isolated from natural sources or prepared by recombinant methods according to procedures known in the art. The purified target molecule can be bound to a suitable matrix, such as agarose beads, acrylamide beads, glass beads, cellulose, various acrylic copolymers, hydroxyalkyl methacrylate gels, polyacrylic and polymethacrylic copolymers, nylon, neutral and ionic carriers, etc. Binding of the target protein to the matrix can be accomplished by the methods described in Methods in Enzymology, 44 1976, or by other means known in the art.

[0215] After binding of the target molecule to the matrix, the immobilized target can be contacted with a library of display particles, e.g., phagemid particles, under conditions suitable for binding of at least a portion of the display particles to the immobilized target molecule. Typically, the conditions, including pH, ionic strength, temperature, etc., mimic physiological conditions. Exemplary "contact" conditions can include incubation at 4°C to 37°C, e.g., room temperature, for 15 minutes to 4 hours, e.g., 1 hour. However, these may be varied as appropriate depending on the nature of the interacting binding partners, etc. The mixture can be subjected to gentle rocking, mixing, or rotation. In addition, other suitable reagents, e.g., blocking agents to reduce non-specific binding, can be added. For example, 1 to 4% BSA or other suitable blocking agents (e.g., milk) can be used. However, it will be understood that the contact conditions can be modified and adapted by those skilled in the art depending on the purpose of the screening method. For example, if the incubation temperature is, for example, room temperature or 37° C., this may increase the likelihood of identifying binding agents that are stable under these conditions (e.g., stable under conditions found in the human body in the case of incubation at 37° C.). Such properties may be highly advantageous if one or both of the binding partners are candidates for use in certain therapeutic applications, e.g., antibodies. Again, such adaptations to conditions are within the skill of the art.

[0216] Bound display particles ("binders") that have a high affinity for the immobilized target molecule can be separated from those that have a lower affinity (and therefore do not bind to the target) by washing. Binders can be dissociated from the immobilized target molecule by a variety of methods. These methods include competitive dissociation using wild-type ligands, alterations in pH and / or ionic strength, as well as methods known in the art.

[0217] In some embodiments, the target molecule is a non-pathogenic bacterium, a virus, a viral protein, a cancer antigen, human IgG, or a recombinant protein thereof. In some embodiments, the target molecule is a viral protein. In some embodiments, the target molecule is a coronavirus, a coronavirus pseudovirus, a recombinant coronavirus spike protein, or a receptor binding domain (RBD) of a coronavirus spike protein. In some embodiments, the coronavirus is selected from the group consisting of 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. In some embodiments, the coronavirus is a SARS-CoV2 selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, or the B.1.1.7 UK variant.

[0218] In some embodiments, the method includes a step in which the previously selected display particles are re-expressed and subjected to a further selection step involving using the same or a different target molecule. In some embodiments, the selection step is repeated one or more times. In some embodiments, the further selection step includes infecting a suitable host cell with a replicable expression vector encoding the previously selected display particles, collecting additional amplified display particles, and contacting the additional amplified display particles with the same or a different target antigen. In some embodiments, the different target molecule is related to the target molecule and is the same type of pathogen, the same group of pathogens, or a variant of the target molecule. In some embodiments, the target molecule and the different target molecule are related to any combination of coronaviruses 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. In some embodiments, the target molecule and the different target molecule are related to any combination of SARS-CoV2 variants selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, and the B.1.1.7 UK variant.

[0219] Once one or more sets of binders have been selected or isolated by the methods provided, they can be subjected to further analysis. In some embodiments, further analysis involves isolation of binders by bacterial infection as an amplification step, isolation of phage or phagemid DNA, and cloning of DNA sequences encoding candidate binders contained in said phage or phagemid DNA into a suitable expression vector. Such an infection step may also allow amplification of the binders. Alternatively, the binders may be amplified at this stage by other suitable methods, for example by PCR of the nucleic acid encoding said binders or transformation of said nucleic acid into a suitable host cell (in the context of a suitable expression vector).

[0220] Once the DNA encoding the binding agent is cloned into a suitable expression vector, the DNA encoding the binding agent can be sequenced or the protein can be expressed in soluble form (including, for example, by the methods provided herein) and subjected to suitable binding studies to further characterize the candidate at the protein level. Suitable binding studies depend on the nature of the binding agent and include, but are not limited to, ELISA, filter screening assays, FACS, or immunofluorescence assays, BiaCore affinity measurements, or other methods for quantifying binding constants, staining of tissue slides or cells, and other immunohistochemistry methods. One or more of these binding studies can be used to analyze the binding agent.

[0221] Also provided herein is a method for identifying an ultralong CDR H3 knob, such as a bovine CDR H3 knob, by amino acid sequence, including from a sequence library. In some embodiments, the method for identifying an ultralong CDR H3 knob includes defining the region of the knob domain, for example, by referring to the formula as described herein, for example, as shown below.

[0222] In some embodiments, the method for identifying an ultralong CDR H3 knob comprises determining the knob region N-terminal boundary at the first D in the "CPDG" motif. HIn some embodiments, the method further comprises defining the C-terminal boundary as a position located by subtracting the number of elevated stalk residues from the framework 4 tryptophan position. In some aspects, the method can be used to identify ultralong CDR H3 knobs from any antibody sequence. In certain embodiments, the antibody sequence is a bovine antibody, such as any of the antibodies described herein.

[0223] A representation of this embodiment of the method is given below:

[0224] Knob boundary position (C-terminus) = position of conserved framework 4 tryptophan-X; where X = number of amino acids starting from the framework 3 canonical cysteine ​​that defines the ascending stalk and ending with the amino acid before the first conserved D-region cysteine ​​in the "CPDG" motif.

[0225] Number of residues in the knob (K)=L−2X; where L=the number of amino acids encompassing the stalk and knob domains, starting with the canonical framework 3 cysteine ​​and ending with the canonical framework 4 tryptophan. K position=(X+1)~(X+K)

[0226] III. Expression of Soluble Peptides Also provided herein, in some embodiments, are methods for producing soluble disulfide bond-containing peptides, including methods for producing any of the antibody binding proteins (also referred to as binders) identified by any of the methods described herein. The soluble peptides produced by the provided methods are peptides (e.g., 25-70 amino acids in length) that contain two or more cysteine ​​residues for which it is desired to produce a disulfide-bonded soluble protein. In some embodiments, the provided methods include transforming a host cell, e.g., E. coli, with an expression vector encoding the soluble peptide. In some embodiments, the expression vector encodes a fusion protein comprising the soluble peptide and a chaperone, e.g., a bacterial chaperone. In some embodiments, the soluble peptide and the chaperone, e.g., a bacterial chaperone, are linked by a linker. In some embodiments, the linker is a cleavable linker.

[0227] Techniques for manipulating nucleic acids, such as for generating mutations in sequences, subcloning, labeling, probing, sequencing, hybridization, etc., are described in detail in the scientific and patent literature. See, for example, Sambrook J, Russell DW (2001) Molecular Cloning: a Laboratory Manual, 3rd ed. Cold Spring Harbor Laboratory Press, New York; Current Protocols in Molecular Biology, Ausubel ed., John Wiley & Sons, Inc., New York (1997); Laboratory Techniques in Biochemistry and Molecular Biology: Hybridization With Nucleic Acid Probes, Part I, Theory and Nucleic Acid Preparation, Tijssen ed., Elsevier, NY (1993).

[0228] In some embodiments, the fusion protein has increased solubility compared to the soluble protein alone. In some embodiments, this increased solubility is conferred at least in part by the inclusion of a chaperone, e.g., a bacterial chaperone. In some embodiments, the inclusion of a chaperone, e.g., a bacterial chaperone, promotes solubility of the fusion protein while allowing disulfide bond formation in the soluble peptide, including a host cell environment engineered or modified to promote disulfide bond formation. In some embodiments, the chaperone, e.g., a bacterial chaperone, is thioredoxin A (TrxA).

[0229] In some embodiments, the methods provided further comprise culturing a host cell, e.g., a bacterium such as E. coli, under conditions permissive for expression of the fusion protein. In some embodiments, the methods provided further comprise isolating the expressed fusion protein from a lysate supernatant of the host cell, e.g., a bacterium such as E. coli, after culturing. In some embodiments, the methods provided further comprise cleaving the cleavable linker, thereby producing a soluble peptide free of the bacterial chaperone.

[0230] In some embodiments, the cleavable linker is an enterokinase cleavage tag. In some embodiments, the cleavable linker comprises the amino acid sequence DDDDK (SEQ ID NO: 106). In some embodiments, cleavage of the cleavable linker comprises adding enterokinase. In some embodiments, enterokinase is added to the supernatant of the host cell lysate. In some embodiments, the methods provided further comprise removing enterokinase and / or bacterial chaperones from the solution comprising the soluble peptide after cleaving the cleavable linker.

[0231] In some embodiments, the soluble peptide is up to 70 amino acids in length. In some embodiments, the soluble peptide is 40-60 amino acids in length. In some embodiments, the soluble peptide is at least 42 amino acids in length. In some embodiments, the soluble peptide is 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids in length.

[0232] In some embodiments, the soluble peptide is 25-70 amino acids long. For example, in some embodiments, the soluble peptide is 35 or more amino acids long, 40 or more amino acids long, 45 or more amino acids long, 50 or more amino acids long, 55 or more amino acids long, or 60 or more amino acids long. In some embodiments, the soluble peptide is 35-70 amino acids long, 40-70 amino acids long, 45-70 amino acids long, 50-70 amino acids long, 55-70 amino acids long, or 60-70 amino acids long, or about 35-70 amino acids long, 40-70 amino acids long, 45-70 amino acids long, 50-70 amino acids long, 55-70 amino acids long, or 60-70 amino acids long.

[0233] In some embodiments, the soluble peptide is 6-50 amino acids, 6-40 amino acids, 6-30 amino acids, 6-25 amino acids, 6-20 amino acids, 6-15 amino acids, 6-10 amino acids, 10-50 amino acids, 10-40 amino acids, 10-30 amino acids, 10-25 amino acids, 10-15 amino acids, 15-50 amino acids, 15-40 amino acids, 15-30 amino acids, 15-25 amino acids, 15-20 amino acids, 20-50 amino acids, 20-40 amino acids, 20-30 amino acids, 20-25 amino acids, 25-50 amino acids, 25-40 amino acids, 25-30 amino acids, 30-50 amino acids, 30-40 amino acids, or 40-50 amino acids. In some embodiments, the soluble peptide is 6-30 amino acids, 6-24 amino acids, 6-18 amino acids, 6-12 amino acids, 12-30 amino acids, 12-24 amino acids, 12-18 amino acids, 18-30 amino acids, 18-24 amino acids, or 24-30 amino acids.

[0234] In some embodiments, the soluble peptide comprises a cysteine ​​motif capable of forming a disulfide bond. In some embodiments, the cysteine ​​motif comprises 2 to 20 cysteine ​​residues, e.g., 2 to 18, 2 to 16, 2 to 14, 2 to 12, 2 to 10, 2 to 8, 2 to 6, 2 to 4, 4 to 20, 4 to 18, 4 to 16, 4 to 14, 4 to 12, 4 to 10, 4 to 8, 4 to 6, 6 to 20, 6 to 18, 6 to 16, 6 to 14, 6 to 12, 6 to 10, 6 to 8, 8 to 20, 8 to 18, 8 to 16, 8 to 14, 8 to 12, 8 to 10, 10 to 20, 10 to 18, 10 to 16, 10 to 14, 10 to 12, 12 to 20, 12 to 18, 12 to 16, 12 to 14, 14 to 20, 14 to 18, 14 to 16, 16 to 20, 16 to 18, or more. or about 2-18, 2-16, 2-14, 2-12, 2-10, 2-8, 2-6, 2-4, 4-20, 4-18, 4-16, 4-14, 4-12, 4-10, 4-8, 4-6, 6-20, 6-18, 6-16, 6-14, 6-12, 6-10, 6-8, 8-20, 8-18, 8- In some embodiments, the cysteine ​​motif comprises 2-12 cysteine ​​residues. In some embodiments, the soluble peptide comprises at least 4 Cys residues. In some embodiments, the soluble peptide comprises 4 Cys residues. In some embodiments, the soluble peptide comprises 6, 8, 10, or 12 Cys residues.

[0235] In some embodiments, the soluble peptide has 1-10 disulfide bonds, e.g., 1-9, 1-8, 1-7, 1-6, 1-5, 1-4, 1-3, 1-2, 2-10, 2-9, 2-8, 2-7, 2-6, 2-5, 2-4, 2-3, 3-10, 3-9, 3-8, 3-7, 3-6, 3-5, 3-4, 4-10, 4-9, 4-8, 4-7, 4-6, 4-5, 5-10, 5-9, 5-8, 5-7, 5-6, 6-10, 6-9, 6-8, 6-7, 7-10, 7-9, 7-8, 8-10, 8-9, or more. In some embodiments, the soluble peptide comprises about 1 to 9, 1 to 8, 1 to 7, 1 to 6, 1 to 5, 1 to 4, 1 to 3, 1 to 2, 2 to 10, 2 to 9, 2 to 8, 2 to 7, 2 to 6, 2 to 5, 2 to 4, 2 to 3, 3 to 10, 3 to 9, 3 to 8, 3 to 7, 3 to 6, 3 to 5, 3 to 4, 4 to 10, 4 to 9, 4 to 8, 4 to 7, 4 to 6, 4 to 5, 5 to 10, 5 to 9, 5 to 8, 5 to 7, 5 to 6, 6 to 10, 6 to 9, 6 to 8, 6 to 7, 7 to 10, 7 to 9, 7 to 8, 8 to 10, 8 to 9, or 9 to 10 disulfide bonds (each including the boundary value). In some embodiments, the soluble peptide comprises 1 to 6 disulfide bonds. In some embodiments, the soluble peptide comprises 2-6 disulfide bonds. In some embodiments, the soluble peptide has at least 2 disulfide bonds. In some embodiments, the soluble peptide has 2 disulfide bonds. In some embodiments, the soluble peptide has 3, 4, or 5 disulfide bonds.

[0236] In some embodiments, the soluble peptide comprises 3 to 6 amino acids prior to the most N-terminal cysteine ​​residue present in the soluble peptide, hi some embodiments, the soluble peptide comprises 3, 4, 5, or 6 amino acids prior to the most N-terminal cysteine ​​residue present in the soluble peptide.

[0237] In some embodiments, the soluble peptide comprises at least 6 amino acids after the most C-terminal cysteine ​​residue present in the soluble peptide. In some embodiments, the soluble peptide comprises 6-9 amino acids after the most C-terminal cysteine ​​residue present in the soluble peptide. In some embodiments, the soluble peptide comprises 6, 7, 8, or 9 amino acids after the most C-terminal cysteine ​​residue present in the soluble peptide.

[0238] In some embodiments, the soluble peptide comprises a flexible linker. In some embodiments, the flexible linker is included at the N-terminus of the soluble peptide. In some embodiments, the flexible linker is added 3-6 amino acids before the most N-terminal cysteine ​​residue present in the soluble peptide. In some embodiments, the flexible linker is included 3-6 amino acids before the most N-terminal cysteine ​​residue present in the soluble peptide. In some embodiments, the flexible linker is included at the C-terminus of the soluble peptide. In some embodiments, the flexible linker is added at least 6 amino acids after the most C-terminal cysteine ​​residue present in the soluble peptide. In some embodiments, the flexible linker is included at least 6 amino acids after the most C-terminal cysteine ​​residue present in the soluble peptide.

[0239] In some embodiments, the flexible linker is GGGGAMGS (SEQ ID NO: 108). In some embodiments, the flexible linker is GGS (SEQ ID NO: 109). In some embodiments, the flexible linker (e.g., GGGGAMGS, SEQ ID NO: 108) allows for cyclization of the soluble peptide. In some embodiments, the cyclization is via chemical or enzymatic methods. In some embodiments, the flexible linker (e.g., GGGGAMGS, SEQ ID NO: 108) allows for sortase-mediated cyclization of the soluble peptide. In some embodiments, the methods provided further include cyclizing the soluble peptide, e.g., via chemical or enzymatic methods.

[0240] In some embodiments, the methods provided further include enriching the soluble peptide. In some embodiments, the methods provided further include separating the soluble peptide from any soluble aggregates present in the solution, including soluble aggregates of the soluble peptide. In some embodiments, the separation involves separating the active soluble peptide from its larger, inactive, or less active soluble aggregates. In some embodiments, the separation is accomplished using a chromatographic method. In some embodiments, the enrichment or separation is by size exclusion chromatography. In some embodiments, the separation involves collecting one or more elution fractions that contain the soluble peptide but not its soluble aggregates, thereby producing an enriched or purified composition of the soluble peptide.

[0241] In some embodiments, the methods provided further comprise producing a multispecific binding molecule comprising a soluble peptide. In some embodiments, the multispecific binding molecule comprises multiple copies of a soluble peptide. In some embodiments, the multispecific binding molecule comprises different soluble peptides. In some embodiments, the multispecific binding molecule comprises a flexible linker (e.g., Gly-Gly-Gly-Ser) between the soluble peptides (e.g., between the C-terminus of one soluble peptide copy and the N-terminus of the other soluble peptide copy). In some embodiments, one soluble peptide is present in a VH region expressed with a light chain as an IgG, and a second soluble peptide is fused to a heavy chain constant region. In some embodiments, the multispecific binding molecule comprises two VH regions with the same soluble peptide. In some embodiments, the multispecific binding molecule comprises VH regions with different soluble peptides, e.g., using heavy chains with constant region mutations such that only heterologous heavy chains effectively pair with each other to form dimers. In some embodiments, these mutations are "knob-into-hole" mutations in the CH3 domain of the Fc, such as T22Y on one chain and Y86T on the other chain.

[0242] In some embodiments, the expression vector further comprises an inducible promoter sequence for controlling the expression of the fusion protein. As used herein, the term "promoter sequence" refers to a DNA sequence that is generally located upstream of a gene present in a DNA polymer and provides a start site for the transcription of the gene into mRNA. Promoter sequences suitable for use in the present invention may be derived from viruses, bacteriophages, prokaryotic cells or eukaryotic cells, and may be constitutive or inducible promoters.

[0243] In some embodiments, the inducible promoter sequence is operably linked to the sequence encoding the fusion protein. As used herein, the term "operably linked" means that the first sequence is located close enough to the second sequence so that the first sequence can affect the second sequence or region under the control of the second sequence. For example, the promoter sequence may be operably linked to the gene sequence, and is usually located at the 5' end of the gene sequence, so that the expression of the gene sequence is under the control of the promoter sequence. In addition, a regulatory sequence may be operably linked to the promoter sequence to enhance the ability of the promoter sequence in promoting transcription. In such cases, the regulatory sequence is generally located at the 5' end of the promoter sequence.

[0244] The promoter sequences suitable for use in the present invention are preferably derived from any one of the following: viruses, bacterial cells, yeast cells, fungal cells, algae cells, plant cells, insect cells, animal cells, and human cells. For example, promoters useful in bacterial cells include, but are not limited to, tac promoter, T7 promoter, T7 A1 promoter, lac promoter, trp promoter, trc promoter, araBAD promoter, and lambda PRPL promoter. Promoters useful in plant cells include, for example, 35S CaMV promoter, actin promoter, ubiquitin promoter, etc. Regulatory elements suitable for use in mammalian cells include CMV-HSV thymidine kinase promoter, SV40, RSV promoter, CMV enhancer, or SV40 enhancer.

[0245] Vectors suitable for use in the present invention include those commonly used in genetic engineering techniques, such as bacteriophages, plasmids, cosmids, viruses, or retroviruses.

[0246] Vectors suitable for use in the present invention may also contain other expression control elements such as transcription initiation sites, transcription termination sites, ribosome binding sites, RNA splicing sites, polyadenylation sites, translation termination sites, etc. Vectors suitable for use in the present invention may further contain additional regulatory elements such as transcription / translation enhancer sequences, and at least a marker or reporter gene that allows screening of the vector under suitable conditions. Marker genes suitable for use in the present invention include, for example, the dihydrofolate reductase gene and the G418 or neomycin resistance gene, which are useful in eukaryotic cell culture, and the ampicillin, streptomycin, tetracycline, or kanamycin resistance genes, which are useful in E. coli and other bacterial culture. Vectors suitable for use in the present invention may further contain a nucleic acid sequence encoding a secretion signal. These sequences are well known to those skilled in the art.

[0247] Depending on the vector and host cell system used, the recombinant gene product (protein) produced by the present invention may either remain within the recombinant cell, be secreted into the culture medium, be secreted into the periplasm, or be retained on the outer surface of the cell membrane. The recombinant gene product (protein) produced by the method of the present invention may be purified by using a variety of standard protein purification techniques, including, but not limited to, affinity chromatography, ion exchange chromatography, gel filtration, electrophoresis, reverse phase chromatography, isoelectric focusing, and the like. The recombinant gene product (protein) produced by the method of the present invention is preferably recovered in a "substantially pure" form. As used herein, the term "substantially pure" refers to a purity of the purified protein that allows for the effective use of the purified protein as a commercial product.

[0248] A. host cell The term "host cell" is used to refer to a cell that has been transformed, transfected, or infected with a nucleic acid sequence, or that is capable of transforming, transfecting, or infected with a nucleic acid sequence and then expressing a selected gene of interest for the recombinant production of a protein of interest. The term includes the progeny of a parent cell, whether or not the progeny is identical in morphology or genetic make-up to the original parent, so long as the selected gene or genetic modification is present.

[0249] The provided methods for producing soluble peptides or fusion proteins comprising soluble peptides and chaperones, e.g., bacterial chaperones, can be carried out using any host organism capable of expressing heterologous polypeptides and capable of being genetically modified. The host organism is preferably a unicellular host organism, although the use of multicellular organisms is also encompassed by the provided methods, so long as the organism can be modified as described herein and the polypeptide of interest can be expressed therein. For purposes of clarity, the term "host cell" is used throughout this specification, although it should be understood that a host organism can be substituted for a host cell, unless this is impracticable for technical reasons.

[0250] In some embodiments, the host cell is a prokaryotic cell, such as a bacterial cell. The host cell can be a gram-positive bacterial cell, such as Bacillus, or a gram-negative bacterium, such as E. coli. The host organism can be an aerobe or an anaerobe. In some embodiments, the host cell is one that has favorable characteristics for expressing a polypeptide, such as a host cell that has fewer proteases than other cell types. Bacteria suitable for this purpose include archaea and eubacteria, such as Enterobacteriaceae. Other examples of useful bacteria include Escherichia, Enterobacter, Azotobacter, Erwinia, Bacillus, Pseudomonas, Klebsiella, Proteus, Salmonella, Serratia, Shigella, Rhizobia, Vitreoscilla, and Paracoccus. Further examples of useful bacteria include Corynebacterium, Lactococcus, Lactobacillus, and Streptomyces species, particularly Corynebacterium glutamicum, Lactococcus lactis, Lactobacillus plantarum, Streptomyces coelicolor, Streptomyces lividans. Suitable E. coli hosts include E. coli DHB4, E. coli BL-21 (defective in both lon (Phillips et al. J. Bacteriol. 159:283, 1984) and ompT protease), E. coli AD494, E. coli W3110 (ATCC 27,325), E. coli 294 (ATCC 31,446), E. coli B, and E. coli X1776 (ATCC 31,537). Other strains are methionine deficient and therefore 35E. coli B834 allows for high specific activity labeling of target proteins with S-methionine or selenomethionine (Leahy et al. Science 258:987, 1992). Still other strains of interest include the BLR strain, as well as the K-12 strains HMS174 and NovaBlue, which are recA derivatives that improve plasmid monomer yields and can help stabilize target plasmids containing repetitive sequences.

[0251] In some embodiments, the E. coli host cells used in the provided methods are engineered or modified to improve soluble expression of disulfide-linked proteins in the E. coli cytosol. In some embodiments, the cytoplasmic thiol-redox equilibrium environment is altered via changes in a reductive pathway, such as thioredoxin reductase. In some embodiments, the E. coli host cells have an oxidized cytoplasm that allows for disulfide bond formation. A variety of mutant strains, including SHuffle (New England Biolabs) and Origami™ (DE3) (Novagen, Germany), are commercially available that lack glutathione reductase Δgor, thioredoxin reductase, and / or the glutathione biosynthetic pathway. In some embodiments, the E. coli strain transformed as part of the provided methods is an Origami™ (DE3) (Novagen, Germany) mutant.

[0252] Suitable Bacillus strains include Bacillus subtilis, Bacillus anzyloliguelaciens, Bacillus licheniformis, Bacillus brevis, Bacillus alcalophilus, Bacillus clauseii, Bacillus cereus, Bacillus pumilus, Bacillus thuringiensis, or Bacillus halodurans. The gram-positive bacterium B. subtilis is the preferred organism for secreted protein production in the biotechnology industry. The demand is mainly based on the fact that B. subtilis lacks the outer membrane that keeps many proteins in the periplasm of gram-negative bacteria such as Escherichia coli. Thus, the majority of B. subtilis proteins that are transported across the cytoplasmic membrane end up directly in the growth medium. In addition, the lack of an outer membrane means that proteins produced in B. subtilis are free of lipopolysaccharides (endotoxins). Other advantages of using B. subtilis as a protein production host are its high genetic tractability, the availability of strains with mutations in almost all of its approximately 4100 genes, a toolbox of strains and vectors for gene expression, and the fact that this bacterium is generally recognized as safe (Braun et al., Curr. Opin. Biotechnol. 10:376-381, 1999; Kobayashi et al., Proc. Natl. Acad. Sci. USA 100:4678-4683, 2003; Kunst et al. Nature 390:249-256, 1997; Zeigler et al., In E. Goldman and L. Green (ed.), Practical Handbook of Microbiology. CRC Press, Boca Raton, Fla., 2008).

[0253] In another embodiment, the host cell is a eukaryotic cell, such as a yeast cell or a mammalian cell. Examples of mammalian cells include Chinese hamster ovary cells (CHO) (ATCC No. CCL61), CHO DHFR cells (Urlaub et al., Proc. Natl. Acad. Sci. USA, 97:4216-4220 (1980)), human embryonic kidney (HEK) 293 or 293T cells (ATCC No. CRL1573), or 3T3 cells (ATCC No. CCL92). Selection of suitable mammalian host cells and methods for transformation, culture, amplification, screening, and product production and purification are known in the art. Other suitable mammalian cell lines are the monkey COS-1 cell line (ATCC No. CRL1650) and COS-7 cell line (ATCC No. CRL1651), and the CV-1 cell line (ATCC No. CCL70). Further exemplary mammalian host cells include primate and rodent cell lines, including transformed cell lines. Normal diploid cells, cell lines derived from in vitro culture of primary tissues, and primary explants are also suitable. Candidate cells may be genotypically deficient in the selection gene or may contain a dominantly acting selection gene. Other suitable mammalian cell lines include, but are not limited to, mouse neuroblastoma N2A cells, HeLa, mouse L-929 cells, 3T3 lines derived from Swiss, Balb-c, or NIH mice, BHK or HaK hamster cell lines, which are available from the ATCC. Each of these cell lines is known and available to those skilled in the art of protein expression.

[0254] Many strains of yeast cells known to those skilled in the art are also available as host cells for the expression of the polypeptides described herein. Exemplary yeast cells include, for example, Saccharomyces cerivisae and Pichia pastoris. Fungi such as Aspergillum are also available as host cells for the expression of the polypeptides described herein.

[0255] In addition, if desired, insect cell systems can be utilized in the provided methods. Such systems are described, for example, in Kitts et al., Biotechniques, 14:810-817 (1993), Lucklow, Curr. Opin. Biotechnol., 4:564-572 (1993), and Lucklow et al. (J. Virol., 67:4566-4579 (1993). Exemplary insect cells are Sf-9 and Hi5 (Invitrogen, Carlsbad, Calif.).

[0256] B. Soluble peptides In some embodiments, the soluble peptides produced in the provided methods are soluble ultralong CDR3 knobs. In some embodiments, the soluble peptides produced in the provided methods are soluble synthetic or semi-synthetic peptides. In some embodiments, the soluble peptides produced in the provided methods are cyclotides. In some embodiments, the soluble peptides produced in the provided methods are modified cyclotides. In some embodiments, the soluble peptides produced in the provided methods are semi-synthetic or modified ultralong CDR3 knobs.

[0257] 1. Soluble Bovine Ultralong CDR3 Knob In some embodiments, the soluble peptides produced in the methods provided are soluble verylong CDR3 knobs. In some embodiments, the soluble verylong CDR3 knobs are bovine verylong CDR3. In some embodiments, the soluble verylong CDR3 knobs are encoded by sequences amplified from a bovine cDNA template library, e.g., prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from immunized bovine animals. In some embodiments, the soluble verylong CDR3 knobs comprise all or part of sequences amplified from a bovine cDNA template library by any of the methods provided herein (see, e.g., Sections II-A-1-a and II-A-1-b). In some embodiments, the soluble verylong CDR3 knobs are any identified or selected as binders of the target molecule. In some embodiments, the soluble verylong CDR3 knobs are, or are part of, any verylong CDR3 knobs identified or selected as binders of the target molecule by any of the methods provided herein (see, e.g., Sections II-C).

[0258] 2. Soluble synthetic peptides In some embodiments, the soluble peptides produced in the provided methods are soluble synthetic or semi-synthetic peptides. In some embodiments, the soluble peptides produced in the provided methods are semi-synthetic or modified ultralong CDR3 knobs. In some embodiments, the soluble peptides produced in the provided methods are cyclotides. In some embodiments, the soluble peptides produced in the provided methods are modified cyclotides.

[0259] a. Soluble synthetic ultralong CDR3 knob In some embodiments, the soluble peptide is a semi-synthetic ultralong CDR3 knob. In some embodiments, the semi-synthetic ultralong CDR3 knob is derived from a bovine ultralong CDR3 knob that is used as a scaffold for modification. In some embodiments, the bovine ultralong CDR3 knob is encoded by a sequence amplified from a bovine cDNA template library, e.g., one prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from an immunized cow. In some embodiments, the bovine ultralong CDR3 knob comprises all or a portion of a sequence amplified from a bovine cDNA template library by any of the methods provided herein (see, e.g., Sections II-A-1-a and II-A-1-b). In some embodiments, the bovine ultralong CDR3 knob is any identified or selected as a binder of the target molecule. In some embodiments, the bovine ultralong CDR3 knob is, or is a portion of, any ultralong CDR3 knob identified or selected as a binder of the target molecule by any of the methods provided herein (see, e.g., Sections II-C).

[0260] In some embodiments, the bovine ultralong CDR3 knob is modified to include random mutations, e.g., while preserving the cysteine ​​motif and disulfide bond structures described herein, such that the semi-synthetic ultralong CDR3 knob still includes 2-20 cysteine ​​residues and 1-10 disulfide bonds. In some embodiments, the bovine ultralong CDR3 knob is modified to include exogenous peptide sequences. In some embodiments, the bovine ultralong CDR3 knob is modified to delete one or more peptide sequences therein, e.g., while preserving the cysteine ​​motif and disulfide bond structures described herein, such that the semi-synthetic ultralong CDR3 knob still includes 2-20 cysteine ​​residues and 1-10 disulfide bonds.

[0261] B soluble cyclotide In some embodiments, the soluble peptide produced in the methods provided is a soluble cyclotide. In some embodiments, the cyclotide is a cyclotide that has been modified to include an exogenous peptide sequence.

[0262] Cysteine-knot microproteins (cyclotides) comprise a naturally occurring family of cysteine-knot microproteins or cyclotides found in various plant species. Cysteine-knot microproteins (cyclotides) are small peptides, typically consisting of about 30-40 amino acids, that can be found in nature as cyclic or linear forms, the cyclic forms having no free N- or C-terminal amino or carboxyl termini. They have a well-defined structure based on three intramolecular disulfide bonds and a small triple-stranded β-sheet (Craik et al., 2001; Toxicon 39, 43-60). The cyclic proteins exhibit a conserved cysteine ​​residue that defines a structure referred to herein as a "cysteine ​​knot." The family includes both naturally occurring cyclic molecules and their linear derivatives, as well as linear molecules that have undergone cyclization. These molecules are useful as molecular framework structures with greater stability than less structured peptides. (Colgrave and Craik,2004;Biochemistry 43,5965-5975).

[0263] The main cyclotide features are their remarkable stability due to the cysteine ​​knot, their small size making them easily accessible for chemical synthesis, and their excellent tolerance to sequence mutations. The cyclotide scaffold is found in almost 30 different protein families, among which conotoxins, spider venoms, pumpkin inhibitors, agouti-related proteins, and plant cyclotides are the most abundant families. Cyclotides from plants of the Rubiaceae and Violaceae families have been found to be mostly head-to-tail cyclic peptides (Craik et al. 2010. Cell. Mol. Life Sci. 67:9-16). However, within the Cucurbita inhibitor family of cyclotides, both cyclic and linear cyclotides have been identified from Momordica cochinchinensis: cyclic trypsin inhibitor (MCoTI)-I and -II, and their linear counterparts MCoTI-III (Hernandez et al. 2000. Biochemistry, 39, 5722-5730). It is now clear that both cyclic and linear variants can exist in different cyclotide families, but the effects of cyclization are less understood. Cyclic peptides are expected to show improved stability, better resistance to proteases, and reduced mobility when compared to their linear counterparts, hopefully resulting in enhanced biological activity. However, linear cyclotides have the advantage that they can be more easily conjugated to other peptides or proteins.

[0264] For example, cyclotides are commonly found in plants. In aspects of the embodiments provided, the cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae, Rubiaceae, and Violaceae plant species. In a preferred aspect, the cyclotides of the present invention are derived from the linear or cyclic forms of cyclotides of Momordicae species, including the Cucurbita serine protease inhibitor family (Otlewski & Korowarsch Acta Biochim Pol. 1996; 43(3): 431-44), and in a more preferred aspect, from the following Momordica cochinchinensis trypsin inhibitors MCoTI-I [SEQ ID NO: 95] and -II [SEQ ID NO: 96] (cyclic in nature), and MCoTI-III (linear in nature) [SEQ ID NO: 97]. Mcoti-I GGVCPKILQRCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 95] McOti-II GGVCPKILKKCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 96] McOti-III ERACPRILKKCRRDSDSPGACICRGNGYCG [SEQ ID NO: 97]

[0265] In some embodiments, the cyclotide molecular framework comprises a sequence of amino acids or analogs thereof that form a cysteine-knot backbone, the cysteine-knot backbone comprising sufficient disulfide bonds or chemical equivalents thereof to impart a knot topology to the three-dimensional structure of the cysteine-knot backbone, and at least one exposed amino acid residue, such as on one or more beta turns and / or within one or more loops, has been inserted or substituted (replaced) compared to the naturally occurring amino acid sequence. In some embodiments, the cyclotide is modified by insertion of or replacement with an exogenous peptide sequence. Thus, the cyclotides described herein are modified cyclotides compared to a natural or wild-type unmodified cyclotide, the modified cyclotide having one or more amino acid sequences, e.g., one or more loops, inserted or replaced by an exogenous peptide sequence. In aspects of the embodiments provided, the modified cyclotide incorporates sufficient amino acid structure to provide high enzyme stability.

[0266] In some embodiments, a modified cyclotide sequence may be defined as having a cysteine ​​knot backbone portion and an exogenous peptide sequence, the modified cyclotide comprising: i) an exogenous peptide sequence, the exogenous peptide sequence being about 2-50 amino acid residues; and ii) a cysteine ​​knot backbone grafted onto the sequence in step i), the cysteine ​​knot backbone having the structure (I): [ka]

[0267] wherein C1-C6 are cysteine ​​residues, and each of C1 and C4, C2 and C5, and C3 and C6 are linked by a disulfide bond to form a cysteine ​​knot, each X represents an amino acid residue in the loop, which amino acid residues are the same or different, and d is about 1 to 2, and one or more of loops 1, 2, 3, 5, or 6 have an amino acid sequence that includes a sequence of clause i), and any loop that includes the sequence of clause i) includes from 2 to about 50 amino acids, and for any of loops 1, 2, 3, 5, or 6 that do not include the sequence of clause i), a, b, c, e, and f are the same or different and each is any number between 3 and 10, and b, c, e, and f are each any number between 1 and 20.

[0268] In some embodiments, the modified cyclotide sequence can be either linear or cyclic.

[0269] In some embodiments, the modified cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae, Rubiaceae, and Violaceae plant species. In some embodiments, the modified cyclotides are derived from the linear or cyclic forms of cyclotides of Momordicae species, including the Cucurbita serine protease inhibitor family (Otlewski & Korowarsch Acta Biochim Pol. 1996;43(3):431-44). In some embodiments, the modified cyclotides are derived from the following Momordica cochinchinensis trypsin inhibitors MCoTI-I [SEQ ID NO:95] and -II [SEQ ID NO:96] (cyclic in nature), and MCoTI-III (linear in nature) [SEQ ID NO:97]. Mcoti-I GGVCPKILQRCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 95] McOti-II GGVCPKILKKCRRDSDSPGACICRGNGYCGSGSD [SEQ ID NO: 96] McOti-III ERACPRILKKCRRDSDSPGACICRGNGYCG [SEQ ID NO: 97]

[0270] For example, an unmodified or wild-type cyclotide can be a cyclotide set forth in any one of SEQ ID NOs: 95-97, in which one or more loops have been inserted or replaced by one or more amino acid sequences (e.g., exogenous peptide sequences). In certain embodiments, the modified cyclotide is derived from a loop replacement library based on Mcoti-II (SEQ ID NO: 96).

[0271] In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 1. In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 5. In some embodiments, the loop into which the exogenous peptide sequence is inserted or replaced is loop 6, as formed upon cyclization.

[0272] IV. Peptide-Containing Antibodies Also provided herein, in some embodiments, is a method comprising producing a full length IgG or Fab. In some embodiments, the full length IgG or Fab is produced from an antibody binding protein or peptide selected by any of the methods provided herein. In some embodiments, the full length IgG or Fab is produced from a soluble peptide produced by any of the methods provided herein.

[0273] In some embodiments, the antibody binding protein is an scFv and the method comprises constructing a heavy chain or portion thereof comprising linking the VH region of the scFv to a constant region or portion thereof.

[0274] In some embodiments, the method comprises constructing a humanized VH region by replacing the knob region of the ultralong CDR3 region of the humanized bovine VH region with the ultralong CDR3 region of a selected antibody binding protein. In some embodiments, the ultralong CDR3 region of the selected antibody binding protein is replaced between the up-stalk strand and the down-stalk strand of the humanized bovine VH region. In some embodiments, the VH region comprises the formula V1-X-V2, where the V1 region of the heavy chain comprises the sequence set forth in SEQ ID NO:111, the X region comprises the ultralong CDR3 of the selected antibody, and the V2 region comprises the sequence set forth in SEQ ID NO:112.

[0275] In some embodiments, the method further comprises constructing a heavy chain or portion thereof comprising linking a humanized VH region to a constant region or portion thereof. In some embodiments, the heavy chain or portion thereof is a human IgG1 heavy chain or portion thereof. In some embodiments, the method further comprises co-expressing the heavy chain or portion thereof with a light chain.

[0276] In some embodiments, the light chain is a bovine light chain of BLVH12, BLV5D3, BLV8C11, BF1H1, BLV5B8, or F18, or a humanized variant thereof. In some embodiments, the light chain is a BLV1H12 light chain (SEQ ID NO: 113) or a humanized variant thereof. In some embodiments, the light chain is a humanized light chain set forth in SEQ ID NO: 114. In some embodiments, the light chain is a BLV5B8 light chain (SEQ ID NO: 115) or a humanized variant thereof. In some embodiments, the light chain is a human light chain. In some embodiments, the light chain is selected from the group consisting of VL1-47, VL1-40, VL1-51, and VL2-18. In some embodiments, the light chain is set forth in any one of SEQ ID NOs: 116-120.

[0277] In some embodiments, the antibody binding proteins or peptides selected or produced by the method are formatted as multispecific binding proteins that include any of a plurality of provided peptides (e.g., knob peptides). In some embodiments, the plurality of peptides, such as knob peptides, are paratopes. In some embodiments, the plurality of peptides, such as knob peptides, are 2, 3, or 4 peptides. An exemplary format for generating multispecific polypeptides is shown in FIG.

[0278] In some embodiments, one or more peptides, such as knob peptides, are linked in tandem in a single polypeptide chain separated by flexible linkers (e.g., GGGS or other similar flexible linkers, including longer linkers of (GGGS)n, where n is 1 to 3). In some embodiments, a tandem single polypeptide may include two, three, four or more peptides, such as knob peptides, to produce bivalent, trivalent, tetravalent, or other multivalent molecules.

[0279] In some embodiments, a peptide such as a knob peptide is reformatted by substitution of the knob region of an ultralong CDR-H3 scaffold comprising any of the humanized ultralong heavy chain molecules described herein. The heavy chain can be complexed with a light chain such as any of the light chain molecules described herein. In some embodiments, when produced in a cell, a two-chain polypeptide is formed by dimerization resulting from disulfide formation between two heavy chain molecules. In some embodiments, a modified immunoglobulin comprising a peptide such as a knob peptide is a homodimer comprising a peptide, e.g., a knob peptide. In other embodiments, two different heavy chains can be co-expressed in a cell using a knobs-into-hole engineering strategy or other strategy to produce a heterodimer in which two different heavy chains, each carrying a different peptide (e.g., a knob peptide), can interact to form a heterodimer. In some embodiments, residues of the constant chain are modified by amino acid substitution to promote heterodimer formation. In some of the optional embodiments, the one or more amino acid modifications are selected from knobs-into-holes modifications and charge mutations to reduce or prevent self-association due to charge repulsion. Heterodimers can be formed by transforming into a cell both a first nucleic acid molecule encoding a first polypeptide subunit and a second nucleic acid molecule encoding a second, different polypeptide subunit. In some aspects, heterodimers are produced upon expression and secretion from a cell as a result of covalent or non-covalent interactions between residues of the two polypeptide subunits to mediate the formation of the dimer. In such processes, a mixture of dimeric molecules, including homodimers and heterodimers, is generally formed. For the generation of heterodimers, further steps for purification may be necessary. For example, the first and second polypeptides can be engineered to include tags with metal chelating or other epitopes, where the tags are different. Tagged domains can be used for rapid purification by metal chelating chromatography and / or antibodies to allow detection by activity depletion / blocking in Western blots, immunoprecipitation, or bioassays.Methods include those described in U.S. Patent No. 10,995, 127. In some embodiments, the human IgG1 comprises a T22Y amino acid substitution in the CH3 domain and the second IgG1 heavy chain comprises a Y86T amino acid substitution in the heavy chain.

[0280] V. Immunization In some embodiments, the methods provided include the use of or amplification from a cDNA template library prepared from RNA isolated from an immunized bovine. In some embodiments, the methods further include immunizing the bovine with a target antigen.

[0281] In some embodiments, the target antigen is a non-pathogenic bacterium, a virus, a viral protein, a cancer antigen, human IgG, or a recombinant protein thereof. In some embodiments, the target antigen is a virus or viral protein associated with, for example, a coronavirus, such as SARS CoV-2.

[0282] In some embodiments, the cattle are immunized by administering at least one dose of an antigen composition comprising a target antigen or a group of related target antigens, such as an antigen associated with a variant of a virus. In some embodiments, the antigen composition further comprises an adjuvant. Those skilled in the art are familiar with many potentially useful adjuvants, such as Freund's complete adjuvant, alum, and squalene. See, for example, U.S. Patent Application Publication No. 2015 / 0361160, which is incorporated herein by reference in its entirety for all purposes. Adjuvants that may be used in the compositions of the invention include, but are not limited to, oil-based emulsion compositions (oil-in-water emulsions and water-in-oil emulsions), complete Freund's adjuvant (CFA), and incomplete Freund's adjuvant (IFA). In one embodiment, the adjuvant comprises RIBI, Iscomatrix, or ENABL Cl (VaxLiant). Adjuvants suitable for use in the present invention include bacterial or microbial derivatives such as derivatives of enterobacterial lipopolysaccharide (LPS), lipid A derivatives, immunostimulatory oligonucleotides, and ADP-ribosylating toxins, and their detoxified derivatives.

[0283] Methods for immunizing bovines, such as cattle, to produce, for example, high titer colostrum, milk, serum, or immune tissue (e.g., PBMCs) are known in the art. Such methods are disclosed, for example, in U.S. Patent Application Publication Nos. 2007 / 0053917 and 2013 / 0022619, each of which is incorporated by reference herein in its entirety for all purposes.

[0284] In some embodiments, immunization comprises administering a priming dose and at least one booster dose of an antigenic composition. In some embodiments, immunization comprises administering two or more booster doses of an antigenic composition. In one embodiment, the priming dose and at least one booster dose comprise the same antigenic composition. In some embodiments, the two or more booster doses comprise the same antigenic composition. The animal may be administered the immunogenic composition at intervals over a period of days, weeks, or months. At the end of the immunization regimen, hyperimmune material such as blood, milk, or colostrum is collected. In one embodiment, the hyperimmune material is collected less than 2 months, less than 3 months, less than 4 months, less than 5 months, less than 6 months, less than 9 months, or less than 12 months after administration of the priming dose. In one embodiment, the hyperimmune material is collected about 3 months to about 6 months after administration of the priming dose. In one embodiment, the hyperimmune material is collected about 3 months to about 9 months after administration of the priming dose. In some embodiments, the hyperimmune material is harvested about 3 months to about 12 months after administration of the priming dose, hi one embodiment, the hyperimmune material is harvested about 6 months to about 12 months after administration of the priming dose.

[0285] In some embodiments, the method further comprises isolating a biological sample from the bovine. In some embodiments, the biological sample is milk, blood, serum, colostrum, or peripheral blood mononuclear cells (PBMCs). In one embodiment, the biological sample is collected less than 2 months, less than 3 months, less than 4 months, less than 5 months, less than 6 months, less than 9 months, or less than 12 months after administration of the priming dose. In one embodiment, the biological sample is collected about 3 months to about 6 months after administration of the priming dose. In some embodiments, the biological sample is collected about 3 months to about 9 months after administration of the priming dose. In some embodiments, the biological sample is collected about 3 months to about 12 months after administration of the priming dose. In some embodiments, the biological sample is collected about 6 months to about 12 months after administration of the priming dose.

[0286] In some embodiments, the method further comprises isolating peripheral blood mononuclear cells (PBMCs) from the cow and cloning a polynucleotide encoding a candidate binding peptide, e.g., comprising an ultralong CDR3. In one embodiment, cloning the polynucleotide comprises performing single cell RT-PCR amplification.

[0287] VI. Compositions and Formulations Also provided are compositions comprising a binding polypeptide, such as an antibody or antigen-binding fragment or knob peptide, described herein, including pharmaceutical compositions and formulations. In one embodiment, the composition comprises a soluble peptide produced as described herein. In one embodiment, the composition comprises a fusion protein comprising a soluble peptide produced as described herein. In one embodiment, the composition comprises a soluble peptide identified for its ability to bind to a target molecule, for example, identified as described herein. In some embodiments, the composition comprises a knob polypeptide or a synthetic peptide comprising an ultralong CDR3. Pharmaceutical compositions and formulations generally include one or more of any pharma- ceutically acceptable carrier or excipient.

[0288] The term "pharmaceutical formulation" refers to a preparation that is in a form that allows the biological activity of the active ingredients contained therein to be effective and that does not contain additional components that are unacceptably toxic to the subject to which the formulation is administered.

[0289] "Pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, that is non-toxic to a subject. Pharmaceutically acceptable carriers include, but are not limited to, buffers, excipients, stabilizers, or preservatives.

[0290] In some embodiments, the choice of carrier is determined in part by the particular cells, binding molecules, and / or antibodies, and / or by the method of administration. Thus, there are a variety of suitable formulations. For example, the pharmaceutical composition can include a preservative. Suitable preservatives can include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some embodiments, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001% to about 2% by weight of the total composition. Carriers are described, for example, in Remington's Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed and include buffers, such as phosphate, citric acid, and other organic acids; antioxidants, including ascorbic acid and methionine; preservatives (e.g., octadecyldimethylbenzyl ammonium chloride, hexamethonium chloride, benzalkonium chloride, benzethonium chloride, phenol, butyl, or benzyl alcohol, alkyl parabens, such as methyl or propyl paraben, catechol, resorcinol, cyclohexanol, 3-pentanol, and m-cresol); low molecular weight (less than about 10 residues) polysaccharides, such as saccharides that are not soluble in water, and / or are insoluble in water. proteins such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other carbohydrates, including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose, or sorbitol; salt-forming counterions such as sodium; metal complexes (e.g., Zn-protein complexes); and / or non-ionic surfactants such as polyethylene glycol (PEG).

[0291] In some embodiments, a buffering agent is included in the composition. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some embodiments, a mixture of two or more buffering agents is used. The buffering agent or mixture thereof is typically present in an amount of about 0.001% to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail, for example, in Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).

[0292] Formulations of the antibodies described herein may include lyophilized formulations and aqueous solutions.

[0293] In some embodiments, the antibodies described herein may be administered in a unit dose form in a pharma- ceutically acceptable diluent, carrier, or excipient. Conventional pharmaceutical practice may be used to provide suitable formulations or compositions for administration to an individual undergoing treatment for SARS CoV-2 infection. In some embodiments, administration is prophylactic. Any suitable route of administration may be used, for example, administration may be parenteral, intravenous, intraarterial, subcutaneous, intramuscular, intraperitoneal, intranasal, aerosol, suppository, oral administration, or by inhalation.

[0294] Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. In some embodiments, the cell population is administered parenterally. As used herein, the term "parenteral" includes intravenous, intramuscular, subcutaneous, rectal, vaginal, intracranial, intrathoracic, and intraperitoneal administration.

[0295] In some embodiments, the composition is provided as a sterile liquid preparation, such as an isotonic aqueous solution, suspension, emulsion, dispersion, or viscous composition, which in some aspects may be buffered to a selected pH. Liquid preparations are usually easier to prepare than gels, other viscous compositions, and solid compositions. In addition, liquid compositions are somewhat more convenient to administer, especially by injection. On the other hand, viscous compositions may be formulated within an appropriate viscosity range to provide a longer contact period with a particular tissue. The liquid or viscous composition may include a carrier, which may be a solvent or dispersion medium, including, for example, water, saline, phosphate buffered saline, polyol (e.g., glycerol, propylene glycol, liquid polyethylene glycol), and suitable mixtures thereof.

[0296] Sterile injectable solutions can be prepared by incorporating the binding molecule in a solvent, for example, by mixing with a suitable carrier, diluent, or excipient, such as sterile water, physiological saline, glucose, dextrose, and the like. The composition can also be lyophilized. The composition can contain auxiliary substances, such as wetting agents, dispersing or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, coloring agents, and the like, depending on the route of administration and the preparation desired. In some embodiments, standard textbooks can be consulted for preparing suitable preparations.

[0297] Various additives can be added that enhance the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, etc. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.

[0298] The pharmaceutical composition according to the present invention may be in unit dose form, such as, for example, in the form of ampoules, vials, suppositories, tablets, pills, or capsules. The formulations can be administered to a human individual in a therapeutically or prophylactically effective amount (e.g., an amount that prevents, eliminates, or reduces a pathological condition) to provide therapy for a disease or condition. The preferred dosage of the therapeutic agent administered may depend on variables such as the type and extent of the disorder, the overall health of a particular patient, the formulation of the compound excipient, and its route of administration.

[0299] In certain embodiments, the compositions described herein can be formulated for pneumonal administration, and in certain embodiments, the compositions are formulated for administration by inhalation (e.g., intrabronchial, intranasal, or oral inhalation, intranasal drops). The compositions can be administered using a nebulizer, inhaler, atomizer, aerosolizer, mister, dry powder inhaler, metered dose inhaler, metered dose sprayer, metered dose mister, metered dose atomizer, or other suitable delivery device.

[0300] In some embodiments, the composition is a lyophilized composition, in some embodiments, the composition is formulated for aerosol administration, and in certain embodiments, the composition is formulated for oral administration or administration by inhalation.

[0301] The pharmaceutical compositions described herein are prepared in a manner known per se, for example by conventional dissolving, lyophilizing, mixing, granulating or confectioning processes. Pharmaceutical compositions can be formulated according to conventional pharmaceutical practice (e.g., Remington: The Science and Practice of Pharmacy (21st ed.), ed. A. R. Gennaro, 2005, Lippincott Williams & Wilkins, Philadelphia, PA and Encyclopedia of Pharmaceutical Technology, eds. J. Swarbrick and J. C. Boylan, 2013, Marcel Dekker, New York, NY).

[0302] Where aerosol administration is appropriate, squalamine or a derivative thereof may be formulated as an aerosol using standard procedures. The term "aerosol" includes any gaseous suspension phase of squalamine or a derivative thereof that can be inhaled into the bronchioles or nasal passages, including dry powder and aqueous aerosols as well as pulmonary and nasal aerosols. Specifically, aerosols include gaseous suspensions of droplets of squalamine or a derivative thereof, such as may be provided in a metered dose inhaler or nebulizer, or a mist sprayer. Aerosols also include dry powder compositions of the compounds of the invention suspended in air or other carrier gas, which may be delivered, for example, by insufflation from an inhaler device. See Ganderton & Jones, Drug Delivery to the Respiratory Tract (Ellis Horwood, 1987); Gonda, Critical Reviews in Therapeutic Drug Carrier Systems, 6:273-313 (1990); and Raeburn et al. Pharmacol. Toxicol. Methods, 27:143-159 (1992).

[0303] The preparations used for in vivo administration are generally sterile.The composition for injection is prepared in a conventional manner under aseptic conditions.The same applies to the composition being introduced into ampoules or vials and the container being sealed.Sterility can be easily achieved, for example, by filtration through a sterile filtration membrane.

[0304] In some embodiments, the pharmaceutical composition can use time-release delivery system, delayed release delivery system, and sustained release delivery system, so that the delivery of the composition occurs before the sensitization of the site to be treated and at a sufficient time to cause sensitization.Many types of release delivery systems are available and known.Such systems can avoid repeated administration of the composition, thereby increasing the convenience for subjects and physicians.

[0305] In some embodiments, the pharmaceutical composition comprises a binding polypeptide, such as an antibody or an antigen-binding fragment, in an amount effective for treating or preventing a disease or condition, e.g., a therapeutically or prophylactically effective amount. In some embodiments, therapeutic or prophylactic effectiveness is monitored by periodic evaluation of the treated subject. In the case of repeated administration over several days or more, depending on the condition, treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosing regimens may be useful and can be determined. The desired dosage can be delivered by a single bolus administration of the composition, by multiple boluses of the composition, or by continuous infusion administration of the composition.

[0306] VII.How to use Provided herein are therapeutic methods and uses for treating a disease or condition in a subject. In some embodiments, the methods and uses include administering a provided binding polypeptide, such as an antibody or antigen-binding fragment or a knob peptide, to a subject (e.g., a human). In some embodiments, the binding polypeptide or a composition comprising the same is administered to the subject by parenteral administration. In some embodiments, the binding polypeptide or a composition comprising the same is administered intramuscularly, subcutaneously, intravenously, topically, orally, or by inhalation. In certain embodiments, particularly for delivery of knob peptides, administration is by inhalation. In some embodiments, the provided binding polypeptide, such as a knob peptide, can be administered by aerosol administration, for example, delivery using an inhaler or nebulizer or mist sprayer.

[0307] In some embodiments, the embodiments provided relate to methods for treating or preventing cancer or a proliferative disease in a subject. In some embodiments, the embodiments provided relate to methods for treating or preventing a coronavirus infection in a subject. In some embodiments, the methods are for prophylactic treatment of a viral infection in a subject at risk of viral infection. In some embodiments, the methods are for treating a subject known or suspected to have a viral infection. In some embodiments, the methods may prevent a viral infection, such as a coronavirus infection, in a subject. In some embodiments, the methods may reduce the manifestation of a symptom of a coronavirus infection in a subject, such as alleviating the presence or severity of one or more signs or symptoms. In some embodiments, the binding molecule, such as an antibody or antigen-binding fragment or knob peptide, is administered to the subject in an amount effective to effect treatment of the infection. Also provided herein are uses of binding polypeptides, such as antibodies or antigen-binding fragments or knob peptides, in such methods and treatments, and in the preparation of medicaments for carrying out such treatment methods. In some embodiments, the methods are carried out by administering a binding polypeptide or a composition comprising the same to a subject who has, has had, or is suspected of having a disease or condition. In some embodiments, the methods thereby treat a disease or condition or disorder in the subject. Also provided herein is the use of any of the compositions, such as pharmaceutical compositions, provided herein for the treatment of a disease or disorder associated with a coronavirus infection, e.g., caused by SARS-CoV-2.

[0308] In some embodiments, the provided binding polypeptides, e.g., antibodies or antigen-binding fragments or knob peptides, are administered to a subject in an effective or therapeutically effective amount. An effective or therapeutically effective dose of a provided binding polypeptide, e.g., antibodies or antigen-binding fragments or knob peptides, for treating or preventing a viral infection is an amount sufficient to alleviate one or more signs and / or symptoms of the infection in the treated subject, whether by inducing regression or elimination of such signs and / or symptoms or by inhibiting the progression of such signs and / or symptoms. The dosage may vary depending on the age and size of the subject to which it is administered, the target disease, condition, route of administration, and the like. In embodiments, an effective or therapeutically effective dose of a provided binding polypeptide, e.g., an antibody or antigen-binding fragment thereof or knob peptide, for treating or preventing a viral infection in, for example, an adult human subject, is about 0.001 mg / kg to about 200 mg / kg, e.g., 0.01 mg / kg to 200 mg / kg or 0.1 mg / kg to 200 mg / kg. Depending on the severity of the infection, the frequency and duration of treatment can be adjusted.

[0309] The methods and uses provided include methods and uses for treating a viral infection in a subject. For example, a method of treatment includes administering a provided binding polypeptide, e.g., an antibody or antigen-binding fragment, or a knob peptide, in an effective or therapeutically effective amount or dose to a subject having one or more signs or symptoms of a disease or infection, e.g., a viral infection.

[0310] In some embodiments, the methods and uses provided include prophylactic methods and uses. In some embodiments, methods are provided herein for prophylactically administering a provided binding polypeptide, such as an antibody or antigen-binding fragment or knob peptide, to a subject at risk of viral infection to prevent such infection. In some embodiments, the amount administered is an effective or therapeutically effective amount or dose. In some embodiments, the methods and uses provided prevent viral infection in a subject. In some embodiments, preventing viral infection by the provided methods involves administering a provided binding polypeptide, such as an antibody or antigen-binding fragment or knob peptide, to a subject to inhibit signs of disease or infection (e.g., viral infection) in the subject. In some embodiments, the method reduces one or more signs or symptoms of viral infection.

[0311] VIII. Exemplary Embodiments Among the embodiments provided are the following: 1. A method for preparing a bovine ultralong CDR3 antibody display library, comprising: (a) amplifying sequences encoding multiple variable heavy (VH) regions of the IgHV1-7 family from a bovine antibody VH chain complementary DNA (cDNA) template library; (b) constructing a plurality of replicable expression vectors for a plurality of VH regions, each replicable expression vector comprising a first nucleic acid sequence encoding a single chain variable fragment (scFv) comprising an amplified VH region linked to a variable lambda light (VL) region selected from the group consisting of the VL regions of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof; (c) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; (d) collecting the amplified display particles, wherein the amplified display particles include display particles that display a fusion protein that includes an scFv. 2. The method of embodiment 1, wherein the VL region is a BLV1H12 VL region. 3. A method for preparing a bovine ultralong CDR3 antibody display library, comprising: (a) amplifying sequences encoding multiple variable heavy (VH) regions of the IgHV1-7 family from a bovine antibody VH chain complementary DNA (cDNA) template library; (b) constructing a plurality of replicable expression vectors for the plurality of VH regions, each replicable expression vector comprising a first nucleic acid sequence encoding a single chain variable fragment (scFv) comprising the amplified VH region linked to a BLV1H12 lambda variable light (VL) region or a humanized variant thereof; (c) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; (d) collecting the amplified display particles, wherein the amplified display particles include display particles that display a fusion protein that includes an scFv. 4. The method of any one of embodiments 1 to 3, wherein the cDNA template library is prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from immunized cows. 5. The method of any one of embodiments 1 to 3, further comprising preparing a cDNA template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. 6. The method of embodiment 4 or 5, further comprising immunizing the bovine with the target antigen. 7. The method of any one of embodiments 1 to 6, wherein the amplified display particles comprise bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. 8. The method of any one of embodiments 1 to 7, wherein the amplified display particles are phage display particles. 9. The method of any one of embodiments 1 to 8, wherein the amplified display particles are phagemid particles. 10. The method of embodiment 9, wherein each replicable expression vector further comprises a second nucleic acid encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein. 11. A method for preparing a bovine ultralong CDR3 antibody phage display library, comprising: (a) immunizing a bovine with a target antigen; (b) preparing an antibody variable heavy (VH) chain complementary DNA (cDNA) template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow; (c) amplifying sequences encoding multiple VH regions of the IgHV1-7 family from a cDNA template library; (d) constructing a plurality of replicable expression vectors for the plurality of VH regions, each replicable expression vector comprising (1) a first nucleic acid sequence encoding a single chain variable fragment (scFv) comprising the amplified VH region linked to a BLV1H12 lambda variable light (VL) region or a humanized variant thereof, and (2) a second nucleic acid encoding at least a portion of a phage coat protein; (e) transforming a suitable host cell with the plurality of replicable expression vectors; (f) infecting the transformed host cells with a sufficient amount of a helper phage carrying a gene encoding a phage coat protein to produce amplified phagemid particles; (g) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles that display a fusion protein comprising at least a portion of a phage coat protein and an scFv. 12. The method of any one of embodiments 1 to 11, wherein the BLV1H12 lambda VL region is set forth in SEQ ID NO:2. 13. The method of any one of embodiments 1 to 11, wherein the BLV1H12 lambda VL region is a humanized variant of the lambda VL region of BLV1H12. 14. The method of embodiment 13, wherein the humanized variant comprises one or more of the amino acid substitutions S2A, T5N, P8S, A12G, A13S, and P14L based on Kabat numbering, the amino acid substitutions I29V and N32G in the CDR1 region, and / or the amino acid substitution DNN to GDT in the CDR2 region. 15. The method of embodiment 13 or 14, wherein the humanized variant comprises the sequence shown in SEQ ID NO: 107. 16. The method of any one of embodiments 2 to 15, wherein the amplified VH region is indirectly linked to the BLV1H12 lambda VL region via a peptide linker. 17. The method of embodiment 16, wherein the peptide linker is (Gly4Ser)3 (SEQ ID NO: 94). 18. The method according to any one of embodiments 1 to 17, wherein a plurality of VH regions of the IgHV1-7 family from a cDNA template library are amplified with a forward primer comprising the sequence shown in SEQ ID NO: 84 and a reverse primer comprising the sequence shown in SEQ ID NO: 85. 19. The method of any one of embodiments 1 to 18, wherein prior to assembly, the method further comprises performing size separation on the sequences encoding the multiple amplified VH regions to enrich for VH regions having ultralong CDR3.

[0312] 20. The method of embodiment 19, wherein size separation is performed by gel electrophoresis. 21. The method of embodiment 20, wherein gel electrophoresis is performed using a 1.2%, 1.5%, or 2% agarose gel, optionally using a 2% agarose gel. 22. The method of any one of embodiments 19-21, wherein size separation comprises separating sequences that are, about, or more than 550 base pairs in length from the plurality of amplified VH region-encoding sequences, wherein the sequences that are, about, or more than 550 base pairs in length comprise sequences encoding a VH region with an ultralong CDR3. 23. The method of any one of embodiments 1 to 22, wherein at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. 24. The method according to any one of embodiments 1 to 23, wherein at least or at least about 30% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. 25. The method according to any one of embodiments 1 to 24, wherein at least or at least about 40% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. 26. The method according to any one of embodiments 1 to 25, wherein at least or at least about 50% of the amplified particles display scFvs comprising a VH region comprising an ultralong CDR3 region. 27. The method according to any one of the preceding embodiments, wherein the ultralong CDR3 is a peptide sequence of 25 to 70 amino acids containing a cysteine ​​motif comprising 2 to 12 cysteine ​​residues capable of forming 1 to 6 disulfide bonds. 28. The method of any one of embodiments 1 to 27, wherein the ultralong CDR3 is 40 to 60 amino acids in length. 29. The method of any one of embodiments 1 to 28, wherein the ultralong CDR3 is at least 42 amino acids in length. 30. The method of any one of embodiments 1-29, wherein the ultralong CDR3 is 42 amino acids, 43 amino acids, 44 amino acids, 45 amino acids, 46 amino acids, 47 amino acids, 48 ​​amino acids, 49 amino acids, 50 amino acids, 51 amino acids, 52 amino acids, 53 amino acids, 54 amino acids, 55 amino acids, 56 amino acids, 57 amino acids, 58 amino acids, 59 amino acids, or 60 amino acids in length. 31. The method of any one of embodiments 1 to 30, wherein the ultralong CDR3 comprises at least four cysteine ​​residues. 32. The method of any one of embodiments 1 to 31, wherein the ultralong CDR3 comprises four cysteine ​​residues. 33. The method of any one of embodiments 1-31, wherein the ultralong CDR3 comprises 6, 8, 10, or 12 cysteine ​​residues. 34. The method of any one of embodiments 1 to 33, wherein the ultralong CDR3 has at least two disulfide bonds. 35. The method of any one of embodiments 1 to 34, wherein the ultralong CDR3 has two disulfide bonds. 36. The method of any one of embodiments 1-34, wherein the ultralong CDR3 has 3, 4, or 5 disulfide bonds. 37. A method for preparing an ultralong CDR3-knob display library, comprising: (a) amplifying sequences encoding multiple CDR3-knob-only antibodies from a bovine antibody variable heavy (VH) chain complementary DNA (cDNA) template library using forward and reverse primers specific for the up-stalk domain and down-stalk domain of a bovine ultralong CDR3 region; (b) constructing a plurality of replicable expression vectors for a plurality of CDR3 knob-only antibodies, each replicable expression vector comprising a first nucleic acid sequence encoding an amplified CDR3 knob; (c) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; (d) collecting the amplified display particles, wherein the amplified display particles include display particles that display a fusion protein comprising an amplified CDR3 knob. 38. The method of embodiment 37, wherein the cDNA template library is prepared from RNA isolated from peripheral blood mononuclear cells (PBMCs) from immunized cows. 39. The method of embodiment 37, further comprising preparing a cDNA template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow. 40. The method of embodiment 38 or 39, further comprising immunizing the bovine with the target antigen. 41. The method of any one of embodiments 37 to 40, wherein the amplified display particles comprise bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. 42. The method of any one of embodiments 37 to 41, wherein the amplified display particles are phage display particles. 43. The method of any one of embodiments 37 to 42, wherein the amplified display particles are phagemid particles. 44. The method of embodiment 43, wherein each replicable expression vector further comprises a second nucleic acid encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein. 45. A method for preparing an ultralong CDR3-knob phage display library, comprising: (a) immunizing a bovine with a target antigen; (b) preparing an antibody variable heavy (VH) chain complementary DNA (cDNA) template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from the immunized cow; (c) amplifying sequences encoding multiple CDR3-knob-only antibodies from a cDNA template library using forward and reverse primers specific for the up-stalk domain and down-stalk domain of the bovine ultralong CDR3 region; (d) constructing a plurality of replicable expression vectors for a plurality of CDR3-knob-only antibodies, each replicable expression vector comprising (1) a first nucleic acid sequence encoding an amplified CDR3 knob, and (2) a second nucleic acid encoding at least a portion of a phage coat protein; (e) transforming a suitable host cell with the plurality of replicable expression vectors; (f) infecting the transformed host cells with a sufficient amount of a helper phage carrying a gene encoding a phage coat protein to produce amplified phagemid particles; (g) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles displaying a fusion protein comprising at least a portion of a phage coat protein and an amplified CDR3 knob. 46. ​​The method according to any one of embodiments 37 to 45, wherein the primer comprises or consists of any of the sequences set forth in SEQ ID NOs: 7 to 11. 47. The method of any one of embodiments 37 to 46, wherein each of the multiple CDR3-knob-only antibodies comprises a peptide sequence of 25 to 70 amino acids having a cysteine ​​motif containing 2 to 12 cysteine ​​residues capable of forming 1 to 6 disulfide bonds. 48. The method of embodiment 47, wherein the peptide sequence is 40 to 60 amino acids in length. 49. The method of embodiment 47 or 48, wherein the peptide sequence is at least 42 amino acids in length. 50. The method of any one of embodiments 47-49, wherein the peptide sequence is 42 amino acids long, 43 amino acids long, 44 amino acids long, 45 amino acids long, 46 amino acids long, 47 amino acids long, 48 amino acids long, 49 amino acids long, 50 amino acids long, 51 amino acids long, 52 amino acids long, 53 amino acids long, 54 amino acids long, 55 amino acids long, 56 amino acids long, 57 amino acids long, 58 amino acids long, 59 amino acids long, or 60 amino acids long. 51. The method of any one of embodiments 47 to 50, wherein the peptide sequence comprises at least four cysteine ​​residues. 52. The method of any one of embodiments 47 to 51, wherein the peptide sequence comprises four cysteine ​​residues. 53. The method of any one of embodiments 47 to 51, wherein the peptide sequence comprises 6, 8, 10, or 12 cysteine ​​residues. 54. The method of any one of embodiments 47 to 53, wherein the peptide sequence has at least two disulfide bonds. 55. The method of any one of embodiments 47 to 54, wherein the peptide sequence has two disulfide bonds. 56. The method of any one of embodiments 47 to 54, wherein the peptide sequence has 3, 4, or 5 disulfide bonds. 57. The method of any one of embodiments 6 to 36 and 40 to 56, wherein the target antigen is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein, a cancer antigen, human IgG, or a recombinant protein thereof. 58. The method according to any one of the preceding embodiments, wherein the cDNA template library is synthesized using a pool of IgM (SEQ ID NO: 4), IgA (SEQ ID NO: 5), and IgG-specific (SEQ ID NOs: 3 and 6) primers. 59. A method for preparing an ultralong CDR3-knob display library, comprising: (a) constructing a plurality of replicable expression vectors for a plurality of CDR3-knob-only antibodies, each replicable expression vector comprising a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds; (b) transforming a suitable host cell with the plurality of replicable expression vectors under conditions suitable to produce amplified display particles; (c) collecting the amplified display particles, wherein the amplified display particles include display particles that display a fusion protein that includes a CDR3 knob. 60. The method of embodiment 59, wherein the amplified display particles comprise bacterial display particles, yeast display particles, mammalian display particles, phage display particles, mRNA display particles, ribosome display particles, or DNA display particles. 61. The method of embodiment 59 or 60, wherein the amplified display particles are phage display particles. 62. The method of any one of embodiments 59 to 61, wherein the amplified display particles are phagemid particles. 63. The method of embodiment 62, wherein each replicable expression vector further comprises a second nucleic acid encoding at least a portion of a phage coat protein, and the method further comprises infecting the transformed host cell with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce phagemid particles, whereby the fusion protein comprises at least a portion of the phage coat protein. 64. A method for preparing an ultralong CDR3-knob phage display library, comprising: (a) constructing a plurality of replicable expression vectors for a plurality of CDR3-knob-only antibodies, each replicable expression vector comprising (1) a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds, and (2) a second nucleic acid encoding at least a portion of a phage coat protein; (b) transforming a suitable host cell with the plurality of replicable expression vectors; (c) infecting the transformed host cells with a helper phage carrying a gene encoding a phage coat protein sufficient to produce amplified phagemid particles; (d) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles that display a fusion protein comprising at least a portion of a phage coat protein and a CDR3 knob. 65. The method of any one of embodiments 27-36 and 47-64, wherein the peptide sequence comprises an up stalk domain and a down stalk domain, and a cysteine ​​motif is between the up stalk domain and the down stalk domain. 66. The method of embodiment 64 or 65, wherein the peptide sequence is amplified from DNA from a cow immunized with the target antigen. 67. The method of embodiment 66, wherein the peptide sequences are amplified from a variable heavy chain cDNA library from immunized cattle using primers specific for either side of the stalk domain of the bovine very long CDR3 region. 68. The method of any one of embodiments 27-36, 47-64, 66, and 67, wherein the peptide sequence does not include a rising stalk domain N-terminal to the cysteine ​​motif. 69. The method of any one of embodiments 27-36, 47-64, and 66-68, wherein the peptide sequence does not include a descending stalk domain C-terminal to the cysteine ​​motif. 70. The method of any one of embodiments 65-67 and 69, wherein the ascending stalk domain comprises the sequence CX2TVX5Q, wherein X2 and X5 are any amino acid. 71. The method of embodiment 70, wherein X2 is Ser, Thr, Gly, Asn, Ala, or Pro, and X5 is His, Gln, Arg, Lys, Gly, Thr, Tyr, Phe, Trp, Met, Ile, Val, or Leu. 72. The method of embodiment 70 or 71, wherein X2 is Ser, Ala, or Thr, and X5 is His or Tyr. 73. The method of any one of embodiments 64, 65, and 68 to 72, wherein the peptide sequence is a synthetic CDR3-knob. 74. The method of any one of embodiments 64, 65, and 68-73, wherein the peptide sequence is a cyclotide or a modified cyclotide. 75. The method of any one of embodiments 64, 65, and 68 to 73, wherein the peptide sequence is a semi-synthetic CDR3-knob derived from a bovine CDR3-knob. 76. The method of any one of claims 64 to 75, wherein the peptide sequence is 40 to 60 amino acids in length. 77. The method of any one of embodiments 64-76, wherein the peptide sequence is at least 42 amino acids in length. 78. The method of any one of embodiments 64-77, wherein the peptide sequence is 42 amino acids long, 43 amino acids long, 44 amino acids long, 45 amino acids long, 46 amino acids long, 47 amino acids long, 48 amino acids long, 49 amino acids long, 50 amino acids long, 51 amino acids long, 52 amino acids long, 53 amino acids long, 54 amino acids long, 55 amino acids long, 56 amino acids long, 57 amino acids long, 58 amino acids long, 59 amino acids long, or 60 amino acids long. 79. The method of any one of embodiments 64 to 78, wherein the peptide sequence comprises at least four cysteine ​​residues. 80. The method of any one of embodiments 64-79, wherein the peptide sequence comprises four cysteine ​​residues. 81. The method of any one of embodiments 64 to 79, wherein the peptide sequence comprises 6, 8, 10, or 12 cysteine ​​residues. 82. The method of any one of embodiments 64 to 81, wherein the peptide sequence has at least two disulfide bonds. 83. The method of any one of embodiments 64 to 82, wherein the peptide sequence has two disulfide bonds. 84. The method of any one of embodiments 64 to 82, wherein the peptide sequence has 3, 4, or 5 disulfide bonds. 85. The method of any one of embodiments 64, 65, and 68 to 84, wherein a plurality of CDR3 knobs are mutated at one or more selected positions within the nucleic acid sequence encoding the peptide sequence, and the plurality of replicable expression vectors is a family of mutated vectors. 86. The method of any one of embodiments 1 to 85, wherein the expression vector further comprises a secretory signal sequence. 87. The method of embodiment 86, wherein the secretion signal sequence is the pelB signal sequence. 88. The method of any one of embodiments 1 to 87, wherein the suitable host cell is an E. coli cell. 89. The method of any one of embodiments 1 to 88, wherein the suitable host cell is a TG1 electrocompetent cell. 90. The method of any one of embodiments 9-36, 43-58, and 62-89, wherein the phagemid particles are derived from an M13 phage. 91. The method of any one of embodiments 10-36, 44-58, and 63-90, wherein the coat protein is M13 phage gene III coat protein (pIII). 92. The method of any one of embodiments 10-36, 44-58, and 63-91, wherein the helper phage is selected from the group consisting of M13K07, M13R408, M13-VCS, and phiX174. 93. The method of any one of embodiments 10-36, 44-58, and 63-92, wherein the helper phage is M13K07. 94. The method of any one of embodiments 1 to 93, wherein the display particle displays, on average, one copy of the fusion protein on the surface of the particle. 95. A library of display particles produced by the method according to any one of embodiments 1 to 94. 96. A replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a single chain variable fragment comprising a bovine variable heavy (VH) region comprising an ultralong CDR3 linked to a variable lambda light (VL) region selected from the VL regions of BLV1H12, BLV5D3, BLV8C11, BF1H1, BLV5B8, and F18, or a humanized variant thereof. 97. A replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a single chain variable fragment comprising a bovine variable heavy (VH) region comprising an ultralong CDR3 linked to a BLV1H12 lambda variable light (VL) region, or a humanized variant thereof. 98. The replicable expression vector of embodiment 96 or 97, further comprising a second nucleic acid sequence encoding at least a portion of a phage coat protein. 99. A display particle encoded by a replicable expression vector according to any one of embodiments 96 to 98. 100. A library of display particles comprising a plurality of display particles according to embodiment 95 or 99. 101. The library described in embodiment 100, wherein at least or at least about 20%, 30%, 35%, 40%, 45%, 50%, 60%, 70%, 80%, 85%, 90%, or 95% of the display particles in the library comprise scFvs comprising a VH region that comprises an ultralong CDR3 region. 102. The library of embodiment 100 or 101, wherein at least or at least about 30% of the display particles in the library comprise scFvs comprising a VH region that comprises an ultralong CDR3 region. 103. A library according to any one of embodiments 100 to 102, wherein at least or at least about 40% of the display particles in the library comprise an scFv comprising a VH region comprising an ultralong CDR3 region. 104. A library according to any one of embodiments 100 to 103, wherein at least or at least about 50% of the display particles in the library comprise an scFv comprising a VH region comprising an ultralong CDR3 region. 105. A replicable expression vector comprising a gene fusion encoding a fusion protein comprising a first nucleic acid sequence encoding a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming disulfide bonds. 106. The replicable expression vector of embodiment 105, further comprising a second nucleic acid sequence encoding at least a portion of a phage coat protein. 107. A display particle encoded by a replicable expression vector according to embodiment 105 or 106. 108. A library of display particles comprising a plurality of the display particles of embodiment 107. 109. The library of any one of embodiments 95, 100-104, and 108, wherein the display particles are phage display particles. 110. The library of any one of embodiments 95, 100-104, 108, and 109, wherein the display particles are phagemid particles. 111. A method for selecting an antibody-binding protein, comprising: (1) contacting a library of display particles according to any one of embodiments 95, 100-104, and 108-110 with a target molecule under conditions that allow binding of the display particles to the target molecule; (2) separating the display particles that bind from those that do not, thereby selecting display particles that contain antibody binding proteins that bind to the target molecule. 112. The method of embodiment 111, wherein the display particle is a phage display particle. 113. The method of embodiment 111 or 112, wherein the display particles are phagemid particles. 114. The method according to any one of embodiments 111 to 113, wherein the target molecule is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein, a cancer antigen, human IgG, or a recombinant protein thereof. 115. The method of any one of embodiments 111 to 114, wherein the target molecule is a coronavirus, a coronavirus pseudovirus, a recombinant coronavirus spike protein, or the receptor binding domain (RBD) of the coronavirus spike protein. 116. The method of embodiment 115, wherein the coronavirus is selected from the group consisting of 229E, NL63, OC43, HKU1, MERS-CoV, SARS-CoV, and SARS-CoV2. 117. The method of embodiment 115 or 116, wherein the coronavirus is a SARS-CoV2 selected from the Wuhan-Hu-1 isolate, the B.1.351 South African variant, or the B.1.1.7 UK variant. 118. (i) infecting a suitable host cell with a replicable expression vector encoding the selected display particle bound in (2); (ii) collecting the amplified display particles; and The method of any one of embodiments 111 to 117, further comprising: (iii) repeating steps (1) and (2) using the amplified display particles as a library of display particles. 119. The method of embodiment 118, wherein the display particles are phagemid particles and the method further comprises infecting the transformed host cells with a helper phage carrying a gene encoding a phage coat protein in an amount sufficient to produce amplified phagemid particles. 120. The method of embodiment 118 or 119, wherein the steps are repeated one or more times. 121. The method according to any one of embodiments 118 to 120, wherein the steps are repeated using the same target molecule or a different target molecule. 122. The method of embodiment 121, wherein the steps are repeated with a different target molecule, the different target molecule being associated with the target molecule. 123. The method of embodiment 121 or 122, wherein the different target molecule is of the same type of pathogen as the target molecule, of the same group of pathogens as the target molecule, or is a variant of the target molecule. 124. The method of any one of embodiments 111 to 123, further comprising sequencing the fusion genes in the selected display particles to identify the antibody-binding proteins. 125. The method of embodiment 124, further comprising producing full-length IgG or Fab from the selected antibody binding protein. 126. The method of embodiment 124 or 125, wherein the antibody binding protein is an scFv and the method comprises constructing a heavy chain or a portion thereof comprising linking the VH region of the scFv with a constant region or a portion thereof. 127. The method according to embodiment 124 or 125, wherein the method comprises constructing a humanized VH region by replacing the knob region of the very long CDR3 region of a humanized bovine VH region with the very long CDR3 region of a selected antibody binding protein. 128. The method of embodiment 127, wherein the ultralong CDR3 region of the selected antibody binding protein is replaced between the ascending and descending stalk strands of a humanized bovine VH region. 129. The method of embodiment 128, wherein the VH region comprises the formula V1-X-V2, the V1 region of the heavy chain comprises the sequence set forth in SEQ ID NO: 111, the X region comprises the ultralong CDR3 of the selected antibody, and the V2 region comprises the sequence set forth in SEQ ID NO: 112. 130. The method of any one of embodiments 127-129, wherein the method further comprises constructing a heavy chain or a portion thereof, comprising linking the humanized VH region to a constant region or a portion thereof. 131. The method of embodiment 126 or 130, wherein the heavy chain or part thereof is a human IgG1 heavy chain or part thereof. 132. The method of any one of embodiments 126, 130, and 131, further comprising co-expressing the heavy chain or a portion thereof with the light chain. 133. The method of embodiment 132, wherein the light chain is the bovine light chain of BLVH12, BLV5D3, BLV8C11, BF1H1, BLV5B8, or F18, or a humanized variant thereof. 134. The method of embodiment 132 or 133, wherein the light chain is the BLV1H12 light chain (SEQ ID NO: 113) or a humanized variant thereof. 135. The method of any one of embodiments 131-134, wherein the light chain is a humanized light chain as set forth in SEQ ID NO: 114. 136. The method of embodiment 132 or 133, wherein the light chain is the BLV5B8 light chain (SEQ ID NO: 115) or a humanized variant thereof. 137. The method of embodiment 132, wherein the light chain is a human light chain. 138. The method of embodiment 132 or 137, wherein the light chain is selected from the group consisting of VL1-47, VL1-40, VL1-51, and VL2-18. 139. The method of any one of embodiments 132, 137, and 138, wherein the light chain is set forth in any one of SEQ ID NOs: 116-120. 140. A method for producing a soluble ultralong CDR3 knob, comprising: (a) transforming E. coli with an expression vector encoding a fusion protein comprising an ultralong CDR3 knob and a bacterial chaperone linked by a cleavable linker, wherein the ultralong CDR3 knob is a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds; (b) culturing the bacteria under conditions permissive for expression of the fusion protein; (c) isolating the fusion protein from the supernatant of the bacterial cell lysate; (d) cleaving the cleavable linker of the fusion protein, thereby producing a soluble ultralong CDR3 knob containing 1 to 6 disulfide bonds that is free of bacterial chaperones. 141. The method according to embodiment 140, wherein the ultralong CDR3 knob is an antibody-binding protein identified by the method according to any one of embodiments 111 to 124. 142. The method of embodiment 140 or 141, wherein the fusion protein has increased solubility compared to the ultralong CDR3 knob alone. 143. The method of any one of embodiments 140 to 142, wherein the bacterial chaperone is thioredoxin A (TrxA). 144. The method of any one of embodiments 140 to 143, wherein the cleavable linker is an enterokinase cleavage tag having the amino acid sequence DDDDK (SEQ ID NO: 106). 145. The method of any one of embodiments 140 to 144, wherein cleaving the cleavable linker comprises adding enterokinase to the supernatant. 146. The method according to any one of embodiments 140 to 145, wherein the soluble ultralong CDR3 knob comprises an additional linker that allows cyclization of the soluble ultralong CDR3 knob via chemical or enzymatic methods, optionally wherein the additional linker allows sortase-mediated cyclization. 147. The method of embodiment 146, further comprising circularizing the soluble ultralong CDR3 knob. 148. The method of any one of embodiments 140 to 147, further comprising (e) removing enterokinase and / or bacterial chaperones from the solution containing the soluble ultralong CDR3 knob. 149. The method of any one of embodiments 140 to 148, further comprising enriching the soluble ultralong CDR3 knobs from a solution containing the soluble ultralong CDR3 knobs, optionally wherein the enriching comprises size exclusion chromatography. 150. The method of any one of embodiments 140 to 149, further comprising producing a multispecific binding molecule comprising a soluble ultralong CDR3 knob. 151. The method of any one of embodiments 140 to 150, wherein the ultralong CDR3 knob is 3 to 8 kDa or 4 to 5 kDa in size. 152. A fusion protein comprising an ultralong CDR3 knob and a bacterial chaperone linked by a cleavable linker, wherein the ultralong CDR3 knob is a peptide sequence of 25-70 amino acids having a cysteine ​​motif containing 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds. 153. The fusion protein of embodiment 152, wherein the bacterial chaperone is thioredoxin A (TrxA). 154. The fusion protein according to embodiment 152 or 153, wherein the cleavable linker is an enterokinase cleavage tag having the amino acid sequence DDDDK (SEQ ID NO: 106). 155. A fusion protein according to any one of embodiments 152 to 154, wherein the ultralong CDR3 knob comprises 1 to 6 disulfide bonds. 156. A composition comprising a fusion protein according to any one of embodiments 152 to 155. 157. A purified soluble very long CDR3 knob produced by a method according to any one of embodiments 140 to 151, wherein the soluble very long CDR3 is 25 to 75 amino acids long and comprises 1 to 6 disulfide bonds. 158. The purified soluble ultralong CDR3 knob according to embodiment 157, wherein the ultralong CDR3 knob is 3-8 kDa in size. 159. The purified soluble ultralong CDR3 knob according to embodiment 157 or 158, wherein the ultralong CDR3 knob is 4 to 5 kDa in size. 160. A composition comprising a purified soluble ultralong CDR3 according to any one of embodiments 157 to 159. 161. The composition according to embodiment 160, further comprising a pharma- ceutically acceptable carrier. 162. The composition of embodiment 160 or 161, formulated for parenteral administration. 163. The composition of any one of embodiments 160-162, formulated for intravenous, intramuscular, topical, otic, conjunctival, nasal, inhalation, or subcutaneous administration. 164. The composition of any one of embodiments 160-163, formulated for administration by inhalation. EXAMPLES

[0313] The following examples are included for illustrative purposes only and are not intended to limit the scope of the invention in any way.

[0314] Example 1: Generation of anti-SARS CoV-2 antibodies Cattle were immunized with the SARS CoV-2 spike protein or its receptor binding domain (RBD) portion, and sera were collected to assess binding activity.

[0315] A. Expression and purification of spike protein and receptor binding domain SARS CoV-2 spike trimer protein from the parental Wuhan-Hu-1 isolate (NCBI YP_009724390.1) or the B.1.351 “South African” variant carrying the mutations E484K (as well as K417N and N501Y), or the parental receptor binding domain (RBD) protein (amino acids 319-541 of the spike protein) were produced by transfection of HEK293 cells at approximately 120 × 10 6 HEK293 Freestyle cells (Invitrogen) were combined with 120 μg of pCAGGS-based vectors containing (1) a sequence encoding the extracellular domain of the spike protein with the furin cleavage site removed and the K986P and V987P stabilizing mutations, the T4-fibritin trimerization domain, and a c-terminal 6x His tag, or (2) the spike RBD domain (amino acids 319-541 of the spike protein) with a c-terminal 6x His tag.

[0316] Cells were shaken at 37°C with 8% CO2 for 4 days, and 150 μl of TCM-ProteaseArrest tissue culture protease inhibitor (G-Biosciences) was added on day 3. The supernatant containing the secreted spike or RBD protein was clarified from the supernatant by centrifugation at 4000 RPM for 5 minutes followed by filtration through a 0.45 μm PES filter. The supernatant was concentrated and buffer exchanged into PBS using Amicon Ultra Centrifugal Filter units (MWCO = 50,000 for S protein preparations and 10,000 for RBD protein) (EMD-Millipore) at 4°C. The concentrated supernatant was then purified using TALON cobalt metal affinity resin (Takara Bio) according to the manufacturer's protocol, except that 50 mM, 100 mM, 200 mM, 300 mM, and 400 mM imidazole gradient elution fractions (1 column volume each) were collected. Each elution fraction was resolved on an SDS-PAGE gel stained with InstantBlue Coomassie Protein Stain (Abcam). Fractions containing a single spike protein band or a single RBD band were pooled and buffer exchanged into PBS as described above, and protein concentrations were quantified using a Nanodrop One (Thermo Scientific) based on the extinction coefficient and molecular weight of the spike or RBD protein, respectively.

[0317] B. Immunization Protocol Two calves were immunized with purified Wuhan-Hu-1 spike protein or RBD protein variants at 200 μg / dose spread across five neck locations and boosted according to published methods (Sok et al. Nature 2017,548(7665108-111; Wang et al. Cell 2013,153(6):1379-1393). Serum was collected and IgG ELISA was performed against the RBD domain of the SARS-CoV-2 spike against sera from RBD-immunized calves at serum dilution ranges of 1:100 to 1:10,000. Spike protein reactivity was observed 7 to 21 days after immunization. As shown in Figure 2A, binding activity against the RBD domain was prominent after the first immunization.

[0318] Serum IgG was also assessed for neutralization of the spike protein and virus using the plaque reduction and neutralization test (PRNT). In this in vitro assay, virus and serum IgG are pre-incubated together before being simultaneously applied to permissive cells, such that virus successfully bound by antibodies can no longer penetrate the cells and / or further propagate the infection. As a result, foci of infection and cellular lesions called "plaques" appear smaller in size and / or number when cell monolayers are stained.

[0319] Pseudoviruses expressing the SARS CoV-2 spike protein were used as model viruses to assay the neutralization rates of serum IgG from both parental spike protein and RBD immunized cows in Vero6 cells. Compared to the native virus, the pseudoviruses could be handled with consideration of BSL-2 at high titers and only infect the cells in one round. As shown in Figure 2B, IgG obtained from cows in either of the immunization protocols was able to successfully neutralize the pseudovirus in a dose-dependent manner. At higher concentrations, serum IgG (ng / mL) from cows immunized with RBD alone was observed to neutralize 100% of the pseudovirus.

[0320] Taken together, these results support that immunized bovine serum and the antibodies it contains are capable of neutralizing SARS-CoV-2.

[0321] Example 2: Generation of ultralong CDR3 scFv antibody or CDR3-knob only phage display libraries for antibody discovery Peripheral blood mononuclear cells (PBMCs) were collected from the immunized cattle described in Example 1, and RNA was extracted and used to generate the two phage display libraries described below. Specifically, approximately 1-5×10 7 PBMCs were collected and stored prior to RNA extraction and cDNA synthesis.

[0322] Two library strategies were used, either using antibodies in scFv format in which the variable heavy (VH) and variable light (VL) fragments are linked by a flexible linker peptide ((Gly4Ser)315 amino acid linker, SEQ ID NO:94) or using independent CDR3-knobs. In both approaches, the scFv or CDR3-knob was fused to pIII via a flexible Gly4Ser linker. Figure 3A shows the pIII fusion constructs in each display library. The generation of the display libraries is summarized below.

[0323] A. scFv library construction In the first strategy, VH DNA fragments from immunized cattle were combined with the fixed light chain BLV1H12 (Stanfield et al. Science immunology 2016,1(1):aaf7962.) RBD and full-length spike protein immune libraries were constructed for different immunization time points.

[0324] RNA was purified using the RNAeasy kit (Qiagen) at 5 × 10 6 ~10 7Immune bovine antibody VH repertoires were obtained by cDNA synthesis from 5 μg of total RNA using the Superscript IV First-Strand cDNA Synthesis Kit (ThermoFisher, #18091050), followed by PCR amplification. To generate the VH template library, cDNA templates for VH were synthesized using a pool of IgM (SEQ ID NO: 4), IgA (SEQ ID NO: 5), and IgG specific (SEQ ID NOs: 3 and 6) primers.

[0325] In these hybrid libraries, full-length donor ultralong VHs were amplified from the VH template library using VH family-specific primer pairs. Specifically, to enrich for VH regions with ultralong CDR3 regions, both VH regions were amplified using FR1 and FR4 primers (SEQ ID NOs: 12 and 13, respectively) specific for the bovine IgHV1-7 family. The amplified products were combined with the linker-BLV1H12 lambda light chain variable region (BLV1H12 light chain shown in SEQ ID NO: 2 and encoded by the DNA sequence shown in 1) by cloning into a pre-cloned pTAU1 pIII fusion phage display vector (pTAU1-BLV1H12(-VH) (see FIG. 3C). The amplified products were digested with NcoI and XhoI (NEB) for 2 hours and purified with NcoI for separation of VH and VL by a flexible linker peptide ((Gly4Ser)3, SEQ ID NO: 94). The ultralong VH fragments were subcloned into pTAU1-BLV1H12(-VH) as -XhoI fragments. In a further step, some ultralong VH fragments were further enriched by separating them from shorter VH fragments using agarose gel electrophoresis before digestion with NcoI and XhoI restriction enzymes. As shown in Figure 3D, a 2% agarose gel achieved the most separation between the ultralong VH fragments (about 550 base pairs long) and the shorter VH fragments without the ultralong CDR3 region (about 400 base pairs long).

[0326] This was then ligated overnight at 16°C using T4 DNA ligase. Final libraries were obtained by electroporation of electrocompetent TG1 cells (Lucigen) with the purified ligation products. Each library contained a minimum of 10 7 It was a clone of.

[0327] B. CDR3-knob library construction In the second strategy, a library of VH templates was generated essentially as described in the first strategy. An ultralong VH-only immune bovine-derived CDR3-knob (also called "CDR3-knob only") library was then constructed by amplifying the stalk-knob CDRs from the VH template library using conserved primers and cloning as pIII fusions into the pTAU1 phage display pIII fusion vector.

[0328] Specifically, RNA was diluted to 5 × 10 6 ~10 7 The VH templates were isolated from bovine PBMCs. The immune bovine antibody CDR3-knob repertoire was obtained by cDNA synthesis from 5 μg of total RNA using the Superscript IV First-Strand cDNA Synthesis Kit (ThermoFisher), followed by PCR amplification. To generate the VH template library, cDNA templates for the CDR3-knob were synthesized using a pool of IgM (SEQ ID NO: 4), IgA (SEQ ID NO: 5), and IgG specific (SEQ ID NOs: 3 and 6) primers.

[0329] Primary stalk-knob CDR3s were amplified from first strand cDNA using IgHV1-7 family specific primers specific for either side of the stalk domain of the CDR3 region (SEQ ID NOs: 7-11). These were then cloned into pTAU1 phage vector as NcoI-NotI fragments after 2 h digestion with NcoI and NotI (NEB) and ligated overnight at 16°C with T4 DNA ligase (see Figure 3B). Final libraries were obtained by electroporation of electrocompetent TG1 cells (Lucigen) with purified ligation products. Each library contained a minimum of 10 ribozymes with >90% insert. 7 It was a clone of.

[0330] Example 3: Screening of phage display libraries and selection of ultralong VH or CDR3-knob domains against SARS Cov-2 VH ultralong CDR3 scFv antibodies or CDR-knob only libraries generated as described in Example 2 were subjected to 2-5 rounds of phage display selection against SARS CoV-2 target proteins (both parental Wuhan Hu-1 or "South African" B.1.351 variant spike proteins or parental Wuhan Hu-1 RBD). Spike proteins from either viral isolates or parental RBD were coated onto NUNC immunotubes containing 1 mL of 10 μg / mL target protein in PBS overnight at 4°C. The tubes were then blocked with 3-4 mL of 2% milk powder dissolved in PBS in a blood mixer for 1 h at room temperature and washed 3 times with PBS.

[0331] For each selection, approximately 10 immunized scFvs or CDR3 knobs from the library were generated as described in Example 2. 12 Phage particles were added to 1 mL of 4% milk powder dissolved in PBS, brought up to a total volume of 2 mL with PBS, then added to the tube containing the target protein and incubated in a blood mixer for 2 hours at room temperature. The tube was then washed with 10x PBS / 0.1% Tween 20 and 10x PBS.

[0332] Bound phages were harvested with 1 mL of fresh 0.1 M triethylamine for 10 min in a blood mixer and neutralized with 0.5 mL of 1 M Tris (pH 7.0) on ice. Log-phase TG1 Phage-Competent™ cells were infected with eluted phages for 1 h at 37° C. / 200 rpm and then grown overnight at 30° C. on 2xTY agar supplemented with 2% glucose / 50 μg / mL carbenicillin.

[0333] After each round of selection described above, TG1 bacteria were scraped off the master plate into 20 mL of 2xTY medium supplemented with 20% glycerol / 2% glucose / 50 μg / mL carbenicillin. Approximately 4-5 mL of this solution was added to 20 mL of 2xTY medium supplemented with 2% glucose / 50 μg / mL carbenicillin containing 100 μl of M13K07 helper phage (MOI=10). This suspension was incubated for 1 h at 37 °C / 200 rpm and then added to 200 mL of 2xTY / 0.2 M sucrose / 50 μg / mL carbenicillin / 25 μg / mL kanamycin / 20 μM IPTG, followed by overnight incubation at 30 °C / 200 rpm. Amplified phages were precipitated from the clarified culture supernatants with 1 / 5 volume of 2.5 M NaCl, 20% PEG 8000 in 250 mL Oakridge centrifuge tubes after 1 h incubation on ice. Phage-containing material was pelleted at 14,000 g for 20 min in a Sorvall centrifuge, resuspended in 2 mL PBS, and 1 mL was saved for use in the next round of selection. Two to five rounds of selection were performed for each library, and phage ELISA was performed for each round starting from round 2.

[0334] From each selection, individual colonies were picked into 600 μL of 2xTY medium supplemented with 50 μg / mL carbenicillin and 2% w / v glucose in 96 deep-well culture plates and incubated (with shaking) at 200 rpm overnight at 37°C. For each culture, 50 μL was transferred to a new 96 deep-well plate containing 200 μL / well of the same medium and grown for 3 hours. Approximately 10 of the M13K07 kanamycin-resistant helper phage were isolated and incubated for 3 hours. 8 kanamycin resistance units (kru) were added to each well and the plates were incubated for 1 hour at 37° C. Expression medium (800 μL / well of 2xTY medium supplemented with 0.2 M sucrose, 100 μg / mL carbenicillin, 25 μg / mL kanamycin, and 20 μM IPTG) was added to each well and amplification was continued overnight at 30° C.

[0335] Culture plates were centrifuged at 2000g for 10 min at 4°C and 25 μL of culture supernatant per well was used for ELISA. Half-area Costar ELISA plates were coated overnight at 4°C with 50 μL / well of RBD or spike target protein at 1 μg / mL in PBS, blocked with 100 μL / well of 2% milk powder in PBS for 1 h at room temperature, then washed with 2×100 μL / well of PBS. Approximately 25 μL of phage culture supernatant per well was added to each target plate or negative control plate containing 25 μL / well of 4% milk powder / PBS and allowed to bind for 1 h at room temperature. Each plate was washed twice with 200 μL / well of PBS containing 0.1% Tween 20, then twice with 200 μL / well of PBS. Bound phages were detected with 50 μL / well of anti-M13-HRP conjugate (Sinobiologicals) diluted 1:5000 in 2% milk powder / PBS for 1 h at room temperature. Plates were washed and developed with 50 μL / well of TMB (3,3',5,5'-tetramethylbenzidine) substrate buffer (Thermofisher) for 5-10 min at room temperature. The reaction was stopped with 100 μL / well of 0.5 N H2SO4 according to the manufacture's protocol and the optical density was read at 450 nm.

[0336] Positive clones from the scFv library screening were sequenced and both short and ultralong VH sequences were transferred into the pFUSE human IgG1 Fc heavy chain expression vector for co-expression with the chimeric BLV1H12 lambda light chain-human lambda light chain constant region in mammalian HEK293 cells. Positive clones from the knob-CDR3 only library screening were synthesized as complete VH gene fragments, cloned into the pFUSE human IgG1 Fc vector, and similarly expressed with the chimeric BLV1H12 lambda light chain as described above. Specifically, each V H 2X Phusion Hot Start II High-Fidelity PCR Master Mix (Thermo Scientific) and V H Framework 1 (Forward) and J H The PCR-generated insert was cloned into the pFUSE mammalian expression vector at the 5'EcoRI and 3'NheI sites on the 5' end of the human IgG1 Fc gene. This was then used to transfect the bovine V gene into HEK293F cells. L (BLV1H12) and human λC L The cells were cultured at 1 × 10 in 30–60 mL of Freestyle 293 Expression Medium (Gibco). 6Cells were seeded at a density of 10000 cells / mL and then incubated in a humidified environment at 37°C and 8% CO2. Heavy and light chain plasmids were combined 1:1 for a total of 1 μg DNA per mL of 293F culture and then diluted in Opti MEM I medium (Gibco) to a final volume of 1 mL per 30 mL of 293F culture. For each 30 mL of 293F culture, approximately 60 μL of 293fectin transfection reagent (Gibco) and 940 μL of Opti MEM I were combined, then gently mixed and incubated at room temperature for 5 minutes before being added to the diluted DNA. This mixture was incubated at room temperature for 30 minutes and then transferred to the 293F culture.

[0337] Media was harvested 5 days after transfection and the expressed chimeric bovine human IgG1 antibody was purified by immobilized Protein A Sepharose (Cytiva Life Sciences) chromatography and then tested for antigen binding and neutralization of live and pseudoviruses.

[0338] Selected candidate antibodies from library screening were identified and sequenced (Table E1). Some selected antibodies contained ultralong CDR3 domains. Thus, although ultralong CDR3 antibodies only represent about 10% of naturally occurring bovine antibodies, the candidate antibodies from the immunization described in Example 1 generated and screened by the above phage display approach were highly enriched for bovine antibodies with ultralong CDR3 (i.e., more than 40% of the candidates are characterized by a CDR3 of at least 50 amino acids).

[0339] Exemplary antibodies SA-R2C3 and SA-R2D9 were derived from an ultralong scFv library (immunization with the parental Wuhan-Hu1 S protein) and identified by screening with selection against the South African variant spike protein. Exemplary SKM and SKD antibodies were identified from screening from a phage library derived directly from the described CDR3-knob library.

[0340] A sequence alignment of exemplary ultralong antibodies SKD (SEQ ID NO:68), SKM (SEQ ID NO:69), R4C1 (SEQ ID NO:70), R5C1 (SEQ ID NO:71), SR3A3 (SEQ ID NO:72), R2F12 (SEQ ID NO:73), and R2G3 (SEQ ID NO:74), along with the germline reference sequence (SEQ ID NO:75), is shown in Figure 4. The length of the CDR3 and the number of cysteine ​​residues are also shown for each.

[0341] [Table 2]

[0342] Example 4: Binding evaluation to spike protein and RBD Selected clones, expressed and purified as chimeric bovine-human IgG1 antibodies as described in Example 3, were then assayed for their ability to bind to the RBD and spike proteins.

[0343] A. SARS-CoV-2 RBD and spike binding of chimeric bovine-human IgG1 antibodies was assessed by ELISA. Approximately 50 μL of RBD or spike protein at 1 μg / mL in PBS was added to each well of a half-area Costar ELISA plate (Corning) and coated overnight at 4° C. Plates were blocked with 180 μL / well of 2% milk powder / TBS / 0.1% Tween 20 for 2 hours at room temperature. Purified chimeric bovine-human IgG1 antibodies were diluted 5-fold from 20 nM to 0.00129 nM in 2% milk powder / TBS / 0.1% Tween 20 and 50 μL / well of each dilution was added in duplicate to coated / uncoated wells. Plates were incubated for 1 h at room temperature, then washed 4 times with 180 μL TBS / 0.1% Tween 20, and bound IgG was detected with 50 μL / well anti-human Fc-HRP (Jackson ImmunoResearch Laboratories, Inc.) diluted 1:5000 in 2% milk powder / TBS / 0.1% Tween 20 for 30 min at room temperature. Plates were then washed 5 times with 180 μL TBS / 0.1% Tween 20, followed by the addition of 50 μL / well TMB (3,3',5,5'-tetramethylbenzidine) substrate buffer (Thermo Scientific). After 1-2 min at room temperature, the reaction was stopped with 50 μL / well 1N H2SO4, and OD 450 nm values ​​were recorded.

[0344] Representative results for three clones tested are shown in Figures 5A and 5B. As shown in Figure 5A, each of the purified chimeric bovine-human IgG1 antibodies (R2G3, R2F12, and R4C1) showed binding to the spike protein. An unrelated bovine-human IgG1 (136S IgG) showed no binding to the spike protein. As shown in Figure 5B, the V of clones R2G3 and R2F12 showed no binding to the spike protein. H A purified chimeric bovine-human IgG1 antibody with the V HThe chimeric antibody having the sequence shown in FIG. 1 did not show binding to the RBD protein. These results are consistent with the finding that antibody R4C1 binds to a non-RBD epitope in the spike protein, whereas R2G3 and R2F12 bind to an RBD epitope.

[0345] [Table 3]

[0346] B. SARS CoV-2 variants RBD and spike binding of chimeric bovine-human IgG1 antibodies was evaluated by ELISA against additional isolates of SARS CoV-2, including variants from the beta, delta, and omicron lineages, as well as SARS CoV-1 viruses. Approximately 50 μL of 1 μg / ml RBD or spike protein in PBS was added to each well and coated overnight at 4°C, as described in Example 4. Plates were blocked for 2 hours at room temperature. Purified chimeric bovine-human IgG1 antibodies were diluted 5-fold from 20 nM to 0.00129 nM, and 50 μL / well of each dilution was added in duplicate to coated / uncoated wells. Plates were incubated for 1 hour at room temperature, then washed 4 times, and bound IgG was detected with anti-human Fc-HRP (Jackson ImmunoResearch Laboratories, Inc.). Plates were then washed 5 times before adding TMB substrate buffer. After 1–2 min at room temperature, the reaction was stopped with H2SO4 and the OD 450 nm values ​​were recorded.

[0347] Figure 5C shows ELISA binding of IgG antibodies to recombinant stabilized spike proteins from wild-type (WT) Wuhan-Hu-1, beta (previously described as South African), or delta strains. Exemplary antibodies SKD and SKM were observed to lose detectable binding to beta but appear to maintain binding to WT and delta SARS CoV-2. Other antibodies have been shown to bind across the range of concentrations tested for each S protein.

[0348] In a complementary set of experiments performed with the RBD, Figure 5D shows ELISA binding curves of select IgG antibodies to the omicron variant RBD (left) or recombinant stabilized spike trimer (right). Of the exemplary RBD binders tested, only R2D9 was observed to maintain binding to the omicron variant spike RBD. R4C1, R5C1, and R2D9 were also observed to bind to the full-length omicron spike with EC50s in the sub-nanomolar range.

[0349] FIG. 5E reflects exemplary ELISA data for R4C1 and R2D9 against SARS-CoV-2 compared to SARS-CoV-1. P1B4, also known as NC-Cowl, was used as a negative control. See Sok, et.al. Nature 2017. These data show that R4C1 maintains full binding activity against SARS-CoV-1, whereas the alternative exemplary antibody R2D9 loses binding >10-fold. However, R2D9 was observed to still maintain some binding activity in the low nanomolar range against SARS-CoV-1.

[0350] Finally, Figure 5F shows ELISA binding activity (top) for three different exemplary antibody knob candidates against WT (Wuhan) SARS CoV-2 spike protein. In this experiment, each exemplary knob was expressed with a DO1 epitope tag, which was detected with an anti-DO1 antibody reflected on the X-axis. Figure 5G further shows a modified Western blot, where the exemplary antibody knobs shown were heated to 70°C in the presence of SDS and then separated by SDS-PAGE before being transferred to a nitrocellulose membrane and detected with biotinylated RBD. RBD was biotinylated using an EZ-Link NHS-LC-LC-Biotin (Thermo Fisher). NHS-LC-LC-Biotin was reconstituted in DMF and mixed with purified RBD in a 1:5 (RBD:biotin) molar ratio and then incubated at room temperature for 30 minutes. The reaction was then applied to a Pierce Polyacrylamide Spin Desalting Column 7K MWCO equilibrated in PBS. Aprotinin was chosen as a similar size control. The R2G3 knob was observed to maintain binding to the RBD despite heat and SDS treatment.

[0351] Example 5: Virus Neutralization In some embodiments, the binding of the antibody to the viral antigen protein is insufficient to reduce cell entry or infection spread. On the other hand, some antibodies, known as neutralizing antibodies, have the ability to inhibit the virus in vitro and / or in vivo and are therefore considered more relevant for therapeutic applications. Therefore, the candidate antibodies described above were tested for their ability to neutralize the infection of cells by SARS CoV-3 pseudovirus, which is a model virus for assaying the neutralizing ability of the candidate antibodies. Compared to naturally occurring isolates of SARS virus, pseudoviruses can be handled with consideration of BSL-2 at high titers and are therefore suitable for screening in pseudovirus luciferase assays (PVLA), etc.

[0352] Pseudoviruses expressing the SARS CoV-2 S protein of the parental Wuhan-Hu-1 spike protein sequence in their viral envelope were engineered to carry the gene for luciferase expression as their cargo. Upon successful cell penetration, luciferase is expressed such that the rate of pseudovirus neutralization inhibition is inversely proportional to the luciferase activity expressed as relative light units (RLU). These pseudoviruses were used in neutralization assays performed in CRFK-hACE2 cells. As a receptor for SARS-CoV-2 entry, ACE2 overexpression is considered a mechanism by which cell lines exhibiting "high infectivity" can be produced. Conversely, cell lines with minimal or lower ACE2 expression can be considered to exhibit "low infectivity".

[0353] Specifically, mock medium or serially diluted (5-fold) antibody Fabs were mixed with an equal amount of pseudotyped virus carrying SARS-CoV-2 wild type (WT) and incubated for 1 h at 37°C. The mixtures were then transduced into CRFK-hACE or CRFK-hDDP4 cells in the presence of polybrene (Santa Cruz Biotech, Santa Cruz, CA) (10 μg / mL). Transduced cells were incubated for 48 h at 37°C, after which lysis buffer was added and RLU was measured.

[0354] A summary of pseudovirus neutralization of the identified antibodies is shown in Table E3. The bovine ultralong CDR3 antibodies were highly potent, neutralizing mutant strains and with half-maximal inhibition at concentrations below 1-5 ng / mL for some antibodies. In general, the ultralong CDR3 antibodies showed more potent neutralization than antibodies with standard CDR3 lengths.

[0355] [Table 4]

[0356] Example 6: Bacterial expression and purification of CDR3-knob only antibodies We developed a system to express and purify the CDR3-knob, a small peptide sequence of 25-50 amino acids with 1-6 disulfide bonds derived from the ultralong CDR3 bovine antibodies described above. The expression system included fusion with the bacterial chaperone TrxA. The CDR3-knob as well as the trxA-CDR-knob fusions were tested for spike and RBD binding.

[0357] A. Expression and purification of TrxA-CDR3-knob fusions and CDR3-knob CDR3-knobs from candidate ultralong CDR3 antibodies described in Examples 2-5 were cloned as KpnI-XhoI (or NcoI-XhoI, as appropriate) fragments into pET32b vector (EMD-Millipore) ( FIG. 6A ), transformed into Origami 2 DE3 bacteria, and expressed as described below. These CDR3-knobs have the sequences shown in SEQ ID NOs: 60-67, respectively, and were encoded by the DNA sequences shown in SEQ ID NOs: 52-60.

[0358] The trxA-CDR3-knob fusion clone was grown overnight at 37° C. in 20 mL 2×TY / 50 μg / mL carbenicillin / 10 μg / mL tetracycline / 2% glucose, transferred to 200 mL of the same medium and grown at 37° C. until OD600nm was approximately 1.0, after which the bacteria were spun down and resuspended in 200 mL 2×TY / 50 μg / mL carbenicillin / 0.5 mM IPTG and grown overnight at 22° C. The bacteria were pelleted again and resuspended in 10 mL Bugbuster HT (EMD-Millipore), spun at room temperature for 30 minutes, and the debris pelleted at 14,000 g for 20 minutes at 4° C. The supernatant was added to an equilibrated Talon resin column (1 mL resin TaKaRa), rotated for 2 hours at 4°C, washed with 5 column volumes of wash buffer (5 mM imidazole), then 1 column volume of wash buffer (10 mM imidazole), eluted with 2.5 mL of 300 mM imidazole elution buffer, and then buffer exchanged into PBS / saline using a PD10 spin column (GE Healthcare). The trxA-CDR3-knob was adjusted to 50 mM Tris pH 7.4, 150 mM NaCl, and 2.5 mM CaCl2 (1× enterokinase (EK) reaction buffer), 400u recombinant his-tagged enterokinase (Genscript) was added, and incubated overnight at room temperature. Digested trxA and enterokinase were removed by incubation on a fresh equilibrated Talon resin column (1.2 mL of resin) for 2 hours at 4°C, and purified CDR-knobs were collected in the flow-through. Again, samples were buffer exchanged into saline / PBS. Optionally, endotoxin removal may be performed by anion exchange chromatography prior to use or testing (e.g., testing in a virus neutralization assay). CDR3-knobs cloned and expressed in E. coli as independent domains are shown in SEQ ID NOs: 60-67.

[0359] Stepwise purification is shown in Figure 6B. As shown in Figure 6C, stepwise purification monitored by SDS-PAGE efficiently purified both trxA-CDR3-knob fusion proteins and soluble CDR3-knob from E. coli lysates. Figure 6D shows an exemplary SDS-PAGE gel of several purified ultralong CDR H3 knob peptides. Samples were treated with the reducing agent DTT, which in some embodiments is sufficient to disrupt disulfide bonds. The similarly sized protein aprotinin was included as a size control.

[0360] IMAC purified trxA-CDR3-knob fusion spike or RBD binding To assess CDR3-knob binding as a trxA fusion, half-area Costar ELISA plates were coated with serial dilutions of IMAC-purified trxA-knob fusions from trxA fusions in 25 μL in 50 μl / well PBS overnight at 4° C. prior to enterokinase cleavage from trxA. RBD-binding clones R2G3, R2F12, SKM, and SKD (nucleic acid sequences shown in SEQ ID NO:52, SEQ ID NO:54, SEQ ID NO:56, and SEQ ID NO:57, respectively, and amino acid sequences shown in SEQ ID NO:60, SEQ ID NO:62, SEQ ID NO:64, and SEQ ID NO:65, respectively) and spike-binding clone R4C1 (nucleic acid sequence shown in SEQ ID NO:55, and amino acid sequence shown in SEQ ID NO:63) were tested.

[0361] The plates were then blocked with 100 μL / well of 2% milk powder / PBS for 1 hour at room temperature, then washed twice with 100 μL / well of PBS. Approximately 50 μL / well of Wuhan-Hu-1 spike protein at 1 μg / mL in 2% milk powder / PBS was incubated for 1 hour, then the wells were washed three times with 100 μL / well of PBS. To detect bound spike protein, 1 μg / mL of full-length IgG chimeric ultralong CDR3 was added to either anti-RBD R2G3 IgG1 (for R4C1) or anti-R4C1 IgG1 antibody (for R2F12, R2G3, SKD, and SKM fusions) in 2% milk powder / PBS, incubated for 1 hour, then the wells were washed three times with 100 μL / well of PBS. Bound IgG was then detected by incubation with 1:5000 diluted anti-human IgG-Fc-HRP conjugate in 2% milk powder / PBS for 1 hour, then the wells were washed 3 times with 100 μL / well of PBS. The plate was then washed and developed with 50 μL / well of TMB (3,3',5,5'-tetramethylbenzidine) substrate buffer (Thermofisher) for 5-10 minutes at room temperature. The reaction was stopped with 100 μL / well of 0.5N H2SO4 and read at 450 nm.

[0362] As shown in Figure 7A (R2F12 is shown as "F12" and R2G3 is shown as "G3"), the trxA-knob fusion proteins tested showed spike protein binding. Control conditions in which fusion proteins R3C1 and R2G3 were incubated in the absence of spike protein (shown as "R3C1 NO spike" and "G3 NO spike") showed no binding. Binding for the TrxA-R2G3 fusion protein is also shown separately in Figure 7B compared to uncoated plates.

[0363] B. Binding of purified R2G3 CDR3-knob to Wuhan-Hu-1 RBD. Binding of purified R2G3 CDR3-knob (after enterokinase cleavage from trxA as described above) to the RBD was assessed by ELISA. The nucleic acid sequence encoding the R2G3 CDR3-knob is shown in SEQ ID NO:52, and the amino acid sequence is shown in SEQ ID NO:60.

[0364] Wells of half-area Costar ELISA plates (Corning) were coated in duplicate with purified CDR3-knob diluted 2-fold from 84-0.082031 nM in PBS at 50 μL / well. Plates were incubated at 37°C for 1 h and then blocked with 180 μL / well of 2% milk powder / TBS / 0.1% Tween 20 for 2 h at room temperature. Biotinylated RBD was then diluted to 0.5 ng / μL in 2% milk / TBS / 0.1% Tween 20 and 50 μL / well was added to coated / uncoated wells. After 1 h at room temperature, wells were washed 4 times with 180 μL / well TBS / 0.1% Tween20 and bound biotinylated RBD was detected with 50 μL / well streptavidin-HRP (Invitrogen) diluted 1:5000 in 2% milk / TBS / 0.1% Tween20 for 30 min at room temperature. Wells were then washed 5 times with 180 μL / well TBS / 0.1% Tween20 before adding 50 μL / well TMB (3,3',5,5'-tetramethylbenzidine) substrate buffer (Thermo Scientific). After 1-2 min at room temperature, the reaction was stopped with 50 μL / well 1N H2SO4 and OD450nm values ​​were recorded. The average OD450 of the uncoated wells was subtracted from the OD450 of each coated well. Background subtracted OD450 values ​​were plotted versus Log(CDR3-knob nM) in GraphPad Prism (GraphPad Software LLC).

[0365] As shown in Figure 8A, the soluble R2G3 knob exhibited binding to the RBD, and as shown in Figure 8B, soluble R2G3 knob binding was increased compared to binding of the reference anti-spike protein antibody CR3022.

[0366] C. Binding of the truncated R2G3 CDR3-knob to the Wuhan-Hu-1 RBD The truncated R2G3 CDR3-knob was cloned and produced as described above using the pET32b vector encoding the R2G3 truncated mutants followed by an enterokinase cleavage site. The amino acid sequences of the truncated R2G3 mutants are shown in Figure 8C. As shown in Figure 8D, truncations 1-3 showed compact bands after enterokinase cleavage and gel electrophoresis (0.75 μg of truncated knob protein per lane, 250 mM DTT).

[0367] The truncated R2G3 CDR3-knob was also tested for RBD binding as described above. As shown in Figure 8E, truncations 1-3 retained RBD-binding ability, whereas truncations 4 and 5 lacked RBD binding.

[0368] D. Defining the Minimal CDR3-Knob C-Terminal Requirements To define the C-terminal requirements of the prototype CDR3-knob (i.e., the C-terminal minimal sequence), a series of R2G3 truncations were cloned into pET32b, expressed and purified as described above in Example 6. These truncations were as shown in Table E4 below.

[0369] [Table 5]

[0370] The quality of the expressed material was assessed by SDS-PAGE and RBD ELISA as described in Example 6D above. Only truncations 4 (G3 TRUNC4) and 5 (G3 TRUNC5) were observed to exhibit no RBD binding ability. Truncations 3A (G3 TRUNC3A) and 3B (G3 TRUNC3B) demonstrated reduced binding in ELISA and increased band diffuseness in SDS-PAGE as shown in Figure 8A. In ELISAs performed with truncations 1-3, no loss of binding activity was observed compared to the parental R2G3 CDR3-knob as shown in Figure 8B. These data support the requirement of a minimum of at least 9 amino acids after the last non-canonical Cys residue for R2G3 binding.

[0371] E. CDR3-knob purification by size exclusion chromatography Size exclusion chromatography (SEC) was used to elucidate whether the soluble CDR3-knobs purified after bacterial expression exist in multiple forms. Soluble R4C1 and R2G3 knobs were produced as described above and subjected to SEC.

[0372] As shown in Figure 9A, SEC revealed at least two distinct elution fractions (fractions A4 and A7) for the purified R4C1 knob, indicating that the purified R4C1 knob existed in multiple forms after bacterial expression. Gel electrophoresis was performed on fractions A4 and A7. As shown in Figure 9B, fraction A4 contained larger soluble aggregates and less active soluble CDR3-knob. Fraction A7 contained only less active soluble CDR3-knob.

[0373] As shown in Figure 9C, SEC revealed only one clear elution fraction (fraction A6) for the purified R2G3 knob (fraction A6), a result that was confirmed by gel electrophoresis performed on fraction A6 (Figure 9D).

[0374] Example 7: Comparison of SARS-CoV 2 virus neutralization of chimeric Fab ultralong CDR3 and CDR3-knob To assess virus neutralization of CDR3-knob only antibodies, assays were performed to assess neutralization of pseudovirus or live WT SARS-CoV2 virus. In this example, purified R2G3 CDR3-knob ("G3-knob") or chimeric R2G3 ultralong CDR3 antibody Fab ("G3-Fab"), or full-length IgG chimeric R2G3 ultralong CDR3 antibody ("G3") were tested as indicated.

[0375] A pseudovirus luciferase assay (PLSA) was performed substantially as described in Example 5. Virus neutralization was assessed against pseudotyped viruses carrying the SARS-CoV-2 (Wuhan-Hu-1) wild-type (WT) spike protein, or S variants (E484K / N507Y; B.1.1.7 or "UK" variant and K417N / E484K / N501Y; B.1.351 or "SA" variant). Mock media or serially diluted (5-fold) antibodies G3-knob, G3-Fab, or G3 were mixed with equal amounts of pseudotyped viruses carrying SARS-CoV-2 wild-type (WT), S variants (484K, B.1.1.7, and B.1.351) and incubated at 37°C for 1 hour. The mixture was then transduced into CRFK-hACE or CRFK-hDDP4 cells in the presence of polybrene (Santa Cruz Biotech, Santa Cruz, CA) (10 μg / mL). As a receptor for SARS-CoV-2 entry, ACE2 overexpression is considered a mechanism that can produce cell lines that exhibit "high infectivity". Conversely, cell lines with minimal or lower ACE2 expression can be considered to exhibit "low infectivity".

[0376] Transduced cells were incubated at 37°C for 48 hours before adding lysis buffer and measuring RLU. Inhibition curves of serial dilutions of each antibody, G3-Fab or G3-Knob against mock treatment were generated and 50% effective concentration (EC50) values ​​were determined by GraphPad Prism software (GraphPad, La Jolla, CA) using a variable slope. Results are summarized in Table E5.

[0377] To evaluate neutralizing activity against live SARS-CoV-2, selected antibodies of G3, G3-Fab, or G3-knob were investigated for their neutralizing activity against replication of SARS-CoV-2, or B.1.17 or B.1.351 variants in Vero E6 cells. Briefly, 50–100 plaque-forming units of SARS-CoV-2 hCoV / USA-WA1 / 2020 (wild type), SARS-CoV-2 hCoV-19 / UK / 204820464 / 2020 (B.1.1.7 variant), or SARS-CoV-2 hCoV-19 / South Africa / KRISP-EC-K005321 / 2020 (B.1.351 variant) were mixed with mock medium or serially diluted (5-fold) G3-Fab or G3-knob. After 1 hour of incubation at 37°C, the mixture was seeded onto confluent Vero E6 cells in 24-well plates. After 2 hours of incubation, medium containing agar (final concentration 1%) and neutral red was added to the cells. After 48-72 hours, plaques in each well were counted. EC50 values ​​were determined as described above and are shown in Table E5 below.

[0378] Taken together, the results shown in Table E5 demonstrate that the exemplary bovine ultralong CDR3 R2G3 in either the standard IgG Fab format or the CDR3-knob only format exhibited potent neutralizing activity against WT SARS-CoV-2 as well as the variants tested. The bovine ultralong CDR3 antibodies were highly potent, neutralizing the mutant strains and having half-maximal inhibition at concentrations below 1-5 ng / mL depending on the antibody format. Notably, despite being a short sequence of only 51 amino acids long, the CDR3-knob only antibodies retained sub-nanomolar potency. Due to the small size of the CDR3-knob antibodies, this example supports the utility of CDR3-knob antibodies as novel therapeutic antibody candidates for inhaled formulations for respiratory targets including other viruses, bacteria, other infectious diseases, asthma, or lung cancer.

[0379] [Table 6]

[0380] A. SARS CoV-2 variants In further evaluation of virus neutralization of ultralong CDR3 antibodies, additional assays were performed to evaluate neutralization of live WT SARS-CoV2 virus or several variant SARS CoV-2 viruses. In this example, full-length IgG chimeric ultralong CDR3 antibodies F12, G3, SKD, and SKM were tested as indicated.

[0381] A pseudovirus luciferase assay (PLSA) was performed substantially as described in Example 5. Virus neutralization was assessed against pseudotyped viruses carrying the SARS-CoV-2 (Wuhan-Hu-1) wild-type (WT) spike protein, S variants (E484K / N507Y; B.1.1.7 or "UK" variant and K417N / E484K / N501Y; B.1.351 or "SA" variant), or 484K. Mock media or serially diluted (5-fold) antibodies were mixed with equal amounts of pseudotyped viruses carrying SARS-CoV-2 wild-type (WT), S variants (484K, B.1.1.7, and B.1.351) and incubated at 37°C for 1 hour. The mixture was then transduced into Vero, CRFK-hACE, or CRFK-hDDP4 cells in the presence of polybrene (Santa Cruz Biotech, Santa Cruz, CA) (10 μg / mL). As a receptor for SARS-CoV-2 entry, ACE2 overexpression is considered a mechanism by which cell lines exhibiting "high infectivity" can be produced. Conversely, cell lines with minimal or lower ACE2 expression can be considered to exhibit "low infectivity."

[0382] The transduced cells were incubated at 37°C for 48 hours, after which lysis buffer was added and RLU was measured. As shown in Figures 10A-10D, each exemplary ultralong CDR3 antibody demonstrated activity against two or more variant SARS CoV-2 S proteins. Inhibition curves of serial dilutions of each antibody against mock treatment were generated and 50% effective concentration (EC50) values ​​were determined by GraphPad Prism software (GraphPad, La Jolla, CA) using a variable slope. The results are summarized in Table E6.

[0383] [Table 7]

[0384] Taken together, the results shown in Table E5 demonstrate that the exemplary bovine ultralong CDR3 antibodies, F12, G3, SKD, and SKM, exhibited potent neutralizing activity against WT SARS-CoV-2 as well as the variants tested. The bovine ultralong CDR3 antibodies are highly potent, neutralizing mutant strains and having half-maximal inhibition at concentrations below 1-5 ng / mL depending on the antibody format. Notably, despite being short sequences of only 51 amino acids in length, the CDR3-knob only antibodies retained sub-nanomolar potency. Due to the small size of the CDR3-knob antibodies, this example supports the utility of CDR3-knob antibodies as novel therapeutic antibody candidates for inhaled formulations for respiratory targets including other viruses, bacteria, other infectious diseases, asthma, or lung cancer.

[0385] Example 8: SARS CoV-1 cross-reactivity To assess the possible cross-reactivity and broad neutralization of the exemplary ultralong CDR3 antibodies, an assay was performed to assess the neutralization of pseudoviruses. In this example, the exemplary R4C1 and R2D9 ultralong CDR3 antibodies were tested as indicated.

[0386] A pseudovirus luciferase assay (PLSA) was performed substantially as described in Example 5. Virus neutralization was assessed against pseudotyped viruses carrying SARS-CoV-2 (Wuhan-Hu-1) wild-type (WT) spike protein, SARS-CoV-1 viral S protein, or VSV-G control. Mock media or serially diluted (5-fold) antibodies G3-knob, G3-Fab, or G3 were mixed with an equal amount of pseudotyped viruses carrying SARS-CoV-2 wild-type (WT), SARS-CoV-1 wild-type, or VSV-G and incubated at 37°C for 1 hour. The mixtures were then transduced into cells in the presence of polybrene (Santa Cruz Biotech, Santa Cruz, CA) (10 μg / mL).

[0387] Transduced cells were incubated at 37° C. for 48 hours before the addition of lysis buffer and the percent neutralization was measured. Inhibition curves of serial dilutions of each antibody against mock treatment were generated and the maximum percent neutralization (MPN), i.e., the percent at which the neutralization curve plateaus for neutralized virus, was determined using a variable slope with GraphPad Prism software (GraphPad, La Jolla, Calif.).

[0388] Figure 11A shows IC50 values ​​of different IgG antibodies against pseudoviruses from various coronavirus strains. Note that R4C1 and R2D9 maintain activity against the omicron variant of SARS-CoV-2. All antibodies show subnanomolar potency, with some in the low picomolar range.

[0389] Example 9: Neutralization of live mutant viruses To assess further cross-reactivity and potential broad neutralization of the exemplary antibodies, assays were performed to assess neutralization of pseudovirus in addition to live virus. In this example, the exemplary antibodies SKM, SKD, R4C1 (IgG, Fab, and knob), G3 (IgG, Fab, and knob), and R2D9 (IgG and knob) described above were tested as indicated.

[0390] A pseudovirus luciferase assay (PLSA) was performed substantially as described in Example 5. Virus neutralization was evaluated against pseudotyped viruses carrying SARS-CoV-2 (Wuhan-Hu-1) wild-type (WT) spike protein, SARS-CoV-2 beta lineage virus S protein, or SARS-CoV-2 delta lineage virus. Mock media or serially diluted (5-fold) antibodies, knobs, or fabs were mixed with an equal amount of pseudotyped viruses carrying SARS-CoV-2 spike protein and incubated at 37°C for 1 hour. The mixtures were then transduced into cells in the presence of polybrene (Santa Cruz Biotech, Santa Cruz, CA) (10 μg / ml). Transduced cells were incubated at 37°C for 48 hours, after which lysis buffer was added and RLU was measured.

[0391] Neutralization was also assayed using live virus under BSL-3 conditions. As above, serially diluted (5-fold) antibodies, knobs, or fabs were mixed with equal amounts of wild-type SARS-CoV-2 virus (Wuhan-Hu-1), or either alpha (UK) or beta (South Africa) lineage variants, and incubated at 37°C for 1 h. Cells were washed, and then plaque forming units (PFU) were measured after incubating the cells at 37°C for 48 h.

[0392] Percent neutralization was measured in experiments with mock or live virus. Inhibition curves of serial dilutions of each antibody against mock treatment were generated, and the maximum percent neutralization (MPN), i.e., the percent at which the neutralization curve plateaus for neutralized virus, was determined by GraphPad Prism software (GraphPad, La Jolla, CA) using a variable slope. For example, the results for the exemplary candidate R2G3 (IgG, Fab, and knob) are shown in Figure 11B. The results are summarized in Table E7 in ng / mL, and the standard deviation of three independent replicates is shown on the right.

[0393] [Table 8]

[0394] Example 10: Bispecific and multispecific antibodies with ultralong CDR3 Knobs from bovine ultralong CDRH3 antibodies are expressed as fusion proteins or as part of dimeric or multimeric molecules to create bivalent, bispecific, multivalent, or multispecific proteins (Figure 12). Two or more knobs are expressed, for example, as fusion proteins with a flexible linker (such as Gly-Gly-Gly-Ser) between the C-terminus of one knob and the N-terminus of another knob. In addition, bispecific molecules are created in which one knob is in its wild-type conformation as a bovine or humanized bovine VH region and expressed with a light chain as an IgG, and a second knob is fused to the C-terminus of the heavy chain constant region. In this situation, the two VH regions are identical and have the specificity of knob 1, but the C-terminus has a new specificity determined by knob 2.

[0395] Another approach uses the "knobs into holes" technique, where two heavy chains are co-expressed, where one heavy chain contains a VH region with one knob (knob 1) in its CDRH3 and the second heavy chain has a VH region with a second knob (knob 2) in its CDRH3. The two heavy chains also differ by having constant region mutations such that only heterologous heavy chains effectively pair with each other to form dimers. In this case, homodimers do not form to any appreciable extent. Such "knobs into holes" mutations include T22Y (on one chain) and Y86T (on the other chain) in the CH3 domain of the Fc.

[0396] DNA vectors encoding such molecules are generated by standard molecular biology techniques and expressed and purified as described above in the previous examples. Additionally, the individual knobs are chemically covalently linked together using small molecule linkers or polyethylene glycol (PEG) linkers, including heterobifunctional or heteromultifunctional linkers (e.g., Pierce). In this case, the individual knobs are expressed and purified, and then added together in the presence of the linker and appropriate reaction conditions to covalently link the linker to the knob protein. Amine, carboxyl, maleimide, NHS ester, and hydrazide chemistries are commonly used in these crosslinking approaches. Additionally, the knobs are used in conjunction with nanoparticles to provide specificity or activity to the nanoparticles. In this regard, the nanoparticles can be protein-based nanoparticles, including particles formed from viral proteins, albumin nanoparticles, and the like. Nanoparticles can also be derived from non-protein molecules, including lipids (e.g., lipoparticles), carbohydrates, and the like.

[0397] Example 11: Bioinformatics Identification of Bovine Ultralong CDR H3 Knob Domain Ends An algorithm was developed to identify the boundaries of the bovine ultralong CDR H3 knob domain by amino acid sequence. By sequence, the bovine ultralong CDR H3 region spans "from the third residue following the conserved cysteine ​​in framework 3 to the residue immediately preceding the conserved tryptophan in framework 4" (Wang et al. Cell 2013, 153(6):1379-1393). Structurally, the knob domain is defined as a small disulfide-rich domain located at the distal end of an antiparallel β-ribbon stalk domain (Figures 13A and 13B).

[0398] The crystal structure of an exemplary bovine ultralong antibody (Table E8) was analyzed in conjunction with the sequence (Figure 14) to formulate a precise definition of the knob boundary by both sequence and structure. In the analysis, the first residue of the knob domain is the first conserved D HThe C-terminal knob domain residue was defined as a cysteine ​​or, in rare exceptions such as A01, other residues at this position. The stalk domain was also defined for the purpose of identifying the location of the last knob domain residue. Crystal structure analysis observed symmetry in the length of the up and down stalk β-ribbon strands. A conserved framework 3 cysteine, three amino acid positions before the first CDR H3 residue (Wang et al. 2013), is located proximal to the base of the up stalk strand and directly opposite a conserved framework 4 tryptophan, one residue downstream of the last CDR H3 residue (Wang et al. 2013). In the analysis, the first up stalk residue was defined as the conserved framework 3 cysteine ​​and the last down stalk residue was defined as the conserved framework 4 tryptophan. The C-terminal knob boundary position was identified by subtracting the number of up stalk residues from the framework 4 tryptophan position (Table E8).

[0399] In summary, our algorithm (below) determines the N-terminal boundary of the knob region based on the first D in the "CPDG" motif. H The C-terminal boundary is defined as a cysteine ​​and the C-terminal boundary is defined as a position located by subtracting the number of elevated stalk residues from the framework 4 tryptophan position (Figure 15). The algorithm serves as a general rule that can be applied to bovine ultralong CDR H3 antibody sequences.

[0400] In summary, our algorithm (below) determines the N-terminal boundary of the knob region based on the first D in the "CPDG" motif. H The C-terminal boundary is defined as a cysteine ​​and the C-terminal boundary is defined as a position located by subtracting the number of elevated stalk residues from the framework 4 tryptophan position (Figure 15). The algorithm serves as a general rule that can be applied to bovine ultralong CDR H3 antibody sequences.

[0401] The algorithm is described as follows: L = the number of amino acids encompassing the stalk and knob domains, starting with the canonical framework 3 cysteine ​​and ending with the canonical framework 4 tryptophan. X = the number of amino acids starting with the canonical framework 3 cysteine ​​that defines the ascending stalk and ending with the amino acid before the first conserved D region cysteine ​​in the "CPDG" motif.

[0402] Conserved framework 4 tryptophan-X position = knob boundary position (C-terminus); number of residues in knob (K) = L-2X; K position = (X+1) to (X+K)

[0403] [Table 9] The bovine ultralong antibodies with published crystal structures analyzed have X amino acids in the ascending and descending strands. The total number of amino acids including the stalk and knob domains (L) and the knob domain alone (K) for each antibody are also listed.

[0404] Example 12: Defining the minimal CDR3-knob C-terminus and minimal CDR3-knob N-terminus The algorithm described in Example 11 was experimentally validated by expressing and testing C-terminal (subsection A below) and N-terminal (subsection B below) truncations of the stalk and knob regions from an antibody with unknown structure. In some cases, 1, 2, 3, 4, or 5 amino acids may be added to the knob end to improve expression or stability.

[0405] A. Defining the minimal CDR3-knob C-terminus To define the C-terminal requirements of the prototype CDR3-knob, a series of R2G3 truncations were cloned into pET32b and expressed as described above in Example 6. The quality of the expressed material was assessed by SDS-PAGE and RBD ELISA, also as described in Example 6. Exemplary R2G3 truncations tested are shown below in Table E9, with each truncation made with a reduced terminal linker.

[0406] [Table 10]

[0407] As shown in Figure 16A, only truncations 4 and 5 did not result in observed RBD binding. Truncations 3A and 3B demonstrated reduced binding in ELISA and increased band diffuseness in SDS-PAGE (Figure 16B). Truncations 1-3 had no loss of binding activity compared to the parent R2G3 CDR3-knob. Taken together, these results support a minimum of 9 amino acids after the last non-canonical Cys residue for R2G3 binding.

[0408] B. Defining the minimal CDR3-knob N-terminus A series of R2G3 truncations were cloned into pET32b to define the N-terminal requirements of the prototypical CDR3-knob, as described in Example 11, and expressed as described above in Example 6. The quality of the expressed material was assessed by SDS-PAGE and RBD ELISA, as described in Example 6. Exemplary R2G3 truncations tested are shown below in Table E10.

[0409] [Table 11]

[0410] Each of the exemplary N-terminal truncations tested was observed to exhibit similar binding profiles to biotinylated RBD by ELISA and band diffuseness on SDS-PAGE (Figures 17A and 17B, respectively). It was noted that truncation 5 resulted in two bands via SDS-PAGE, but this did not correlate with any reduction in binding activity. These results suggest that none of the amino acids deleted in these exemplary truncated R2G3 sequences are part of the knob domain.

[0411] Example 13: Selective amplification of ultralong CDR3-knob domains Ultralong CDR3-knob domains were selectively amplified from a bovine VH template library. The bovine VH template library was prepared essentially as described in Example 2.

[0412] Specifically, RNA was diluted to 5 × 10 6 ~10 7 The VH templates were isolated from bovine PBMCs. The immune bovine antibody CDR3-knob repertoire was obtained by cDNA synthesis from 5 μg of total RNA using the Superscript IV First-Strand cDNA Synthesis Kit (ThermoFisher), followed by PCR amplification. To generate the VH template library, cDNA templates for the CDR3-knob were synthesized using a pool of IgM (SEQ ID NO: 4), IgA (SEQ ID NO: 5), and IgG specific (SEQ ID NOs: 3 and 6) primers.

[0413] The primary stalk-knob CDR3 was amplified from first strand cDNA using IgHV1-7 family specific primers specific for either side of the stalk domain of the CDR3 region. The primary stalk-knob CDR3 was amplified using a pool of primers including all of the primers shown in SEQ ID NOs: 8-11 as well as one of the primers shown in SEQ ID NOs: 122-130. The amplified sequences were then analyzed for the predominance of ultra-long CDR3-knob domains using gel electrophoresis on a 2% agarose gel.

[0414] Alignments of the primers set forth in SEQ ID NOs: 122-130 (primers p1-p9) to the sequences of exemplary standard short CDR3 antibodies (antibodies 028-030) and ultralong CDR3 antibodies (antibodies 01-026) are shown in Figure 18A. The sequence identifiers (SEQ ID NOs) of the sequences shown in Figure 18A are shown in Table E11.

[0415] [Table 12]

[0416] Gel electrophoresis results showed that amplification with a pool of primers including those shown in SEQ ID NOs: 123, 127, and 128 resulted in enrichment of the ultralong CDR3-knob domain, especially at annealing at 65-68° C. ( FIG. 18B ). Specifically, two bands were evident for the PCR products obtained using some primers, indicating amplification of the standard short CDR3-knob domain and the ultralong CDR3-knob domain, whereas only one band corresponding to the sequence of the ultralong CDR3-knob domain (expected PCR product size of about 300-350 bp) was obtained using the primers shown in SEQ ID NOs: 123, 127, and 128.

[0417] A stalk-knob CDR3 library was constructed from DNA amplified using primers shown in SEQ ID NOs: 8-11, 123, 127, and 128. The library was constructed essentially as described in Example 2 and selected against spike protein for two rounds of selection as described in Example 3. Over 90% of the clones screened were spike binding clones and all binding clones were ultralong CDR3 antibodies.

[0418] These results indicate that ultralong CDR3-knob domains can be selectively amplified from a VH template library using specific primers specific for the stalk domain of the CDR3 region.

[0419] The present invention is not intended to be limited in scope to the specific disclosed embodiments, which are provided, for example, to illustrate various aspects of the invention. Various modifications to the described compositions and methods will become apparent from the descriptions and teachings herein. Such variations can be made without departing from the true scope and spirit of the present disclosure and are intended to fall within the scope of the present disclosure.

[0420] [Table 13-1]

[0421]

Table 13-2

[0422]

Table 13-3

[0423]

Table 13-4

[0424]

Table 13-5

[0425]

Table 13-6

[0426]

Table 13-7

[0427]

Table 13-8

[0428] 【...

Claims

1. 1. A method for preparing an ultralong CDR3-knob phage display library, comprising: (a) preparing an antibody variable heavy (VH) chain complementary DNA (cDNA) template library from RNA isolated from peripheral blood mononuclear cells (PBMCs) from cattle immunized with a target antigen; (b) amplifying sequences encoding multiple CDR3-knob-only antibodies from said cDNA template library using forward and reverse primers specific for the up-stalk domain and down-stalk domain of the bovine ultralong CDR3 region; (c) constructing a plurality of replicable expression vectors for the plurality of CDR3-knob-only antibodies, each replicable expression vector comprising (1) a first nucleic acid sequence encoding an amplified CDR3 knob, and (2) a second nucleic acid sequence encoding at least a portion of a phage coat protein; (d) transforming a suitable host cell with said plurality of replicable expression vectors; and (e) infecting the transformed host cells with a helper phage carrying a gene encoding the phage coat protein in an amount sufficient to produce amplified phagemid particles; (f) collecting the amplified phagemid particles, wherein the amplified phagemid particles include phagemid particles that display a fusion protein comprising at least a portion of the phage coat protein and an amplified CDR3 knob; A method comprising:

2. 2. The method of claim 1, wherein the primer comprises or consists of any of the sequences set forth in SEQ ID NOs: 7-11 and 121-130, and optionally comprises or consists of any of the sequences set forth in SEQ ID NOs: 123, 127, and 128.

3. The method of claim 1, wherein the method further comprises identifying the CDR3-knob from a bovine antibody variable heavy (VH) chain template sequence.

4. The CDR3-knob is Identifying the conserved cysteine ​​in framework 3 and the conserved tryptophan in framework 4; and determining the sequence of the CDR-3 knob, the CDR-3 knob has an amino acid sequence length K; The sequence begins at position X+1 and ends at position X+K, K = L - 2X where L is the number of amino acids in the amino acid sequence starting from the conserved cysteine ​​in framework 3 and ending with the conserved tryptophan in framework 4, and X is the number of amino acids from the first cysteine ​​in framework 3 to the D in CDR H3. Ｈ 4. The method of claim 3, wherein said CDR-3 knob is identified from an antibody sequence by an algorithm comprising determining the sequence of said CDR-3 knob, said CDR-3 knob being the number of amino acids to the first conserved cysteine ​​encoded by the region.

5. The method of claim 4 , wherein the antibody sequence is a bovine antibody.

6. The method of claim 4, wherein the identified CDR3-knob is extended by 1, 2, 3, 4 or 5 amino acids at the N- and / or C-terminus compared to the identified sequence.

7. 2. The method of claim 1, wherein each of said plurality of CDR3-knob-only antibodies comprises a peptide sequence of 25-70 amino acids having a cysteine ​​motif comprising 2-12 cysteine ​​residues capable of forming 1-6 disulfide bonds.

8. The method of claim 7, wherein the peptide sequence is 40 to 60 amino acids in length.

9. The method of claim 7, wherein the peptide sequence is at least 42 amino acids in length.

10. 8. The method of claim 7, wherein the peptide sequence is 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60 amino acids in length.

11. The method of claim 7 , wherein the peptide sequence comprises at least four cysteine ​​residues.

12. 8. The method of claim 7, wherein the peptide sequence comprises 6, 8, 10, or 12 cysteine ​​residues.

13. 2. The method of claim 1, wherein the target antigen is a non-pathogenic bacterium, a virus, a viral protein, an immunomodulatory protein, a cancer antigen, human IgG, or a recombinant protein thereof.

14. 2. The method of claim 1, wherein the cDNA template library was synthesized using a pool of IgM, IgA, and IgG specific primers, including a primer comprising or consisting of the sequence shown in SEQ ID NO:4, a primer comprising or consisting of the sequence shown in SEQ ID NO:5, a primer comprising or consisting of the sequence shown in SEQ ID NO:3, and a primer comprising or consisting of the sequence shown in SEQ ID NO:

6.

15. A library of display particles produced by the method of any one of claims 1 to 14.

Images