Predicting increased DPP3 in patients with septic shock

Abstract

The present invention relates to a method for predicting increased dipeptidyl peptidase 3 (DPP3) levels in critically ill patients. Specifically, the method includes providing a sample from the patient, determining the level of dipeptidyl peptidase 3 (DPP3) in the sample, and comparing the level to a predetermined threshold, where the level of DPP3 in the sample is indicative of increased DPP3 if the level exceeds a predetermined threshold level in the range of 22 to 40 ng / ml. Furthermore, the present invention also relates to a method for preventing increased DPP3 levels in critically ill patients, in which a DPP3 inhibitor is administered to the patient when the DPP3 level exceeds a threshold of 40 to 22 ng / ml, and the DPP3 inhibitor is an anti-DPP3 antibody and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold. Furthermore, the present invention also relates to a DPP3 inhibitor for use in preventing increased DPP3 levels in critically ill patients.

Description

[Technical Field]

[0001] The present invention relates to a method for predicting an increase in dipeptidyl peptidase 3 (DPP3) in a critically ill patient. Furthermore, the present invention also relates to a method for preventing an increase in DPP3 in a critically ill patient, wherein a DPP3 inhibitor is administered to the patient when the DPP3 level exceeds a threshold of 40 ng / ml to 22 ng / ml, and the DPP3 inhibitor is an anti-DPP3 antibody and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold. Furthermore, the present invention also relates to a DPP3 inhibitor for use in preventing an increase in DPP3 in a critically ill patient. [Background technology]

[0002] Dipeptidyl peptidase 3, also known as dipeptidyl aminopeptidase III, dipeptidyl arylamidase III, dipeptidyl peptidase III, enkephalinase B, or erythrocyte angiotensinase (abbreviated as DPP3 or DPPIII), is a metallopeptidase that removes dipeptides from physiologically active peptides such as enkephalins and angiotensin. DPP3 was first identified, and its activity was measured in purified bovine anterior pituitary extracts by Ellis & Nuenke (1967). This enzyme, listed as EC 3.4.14.4, has a molecular weight of approximately 83 kDa and is highly conserved in prokaryotes and eukaryotes (Prajapati & Chauhan 2011). The amino acid sequence of the human variant is depicted in SEQ ID NO: 36. Dipeptidyl peptidase III is a ubiquitously expressed, primarily cytosolic peptidase. Despite the lack of a signal sequence, several studies have reported membrane-associated activity (Lee & Snyder 1982).

[0003] DPP3 is a zinc-dependent exopeptidase belonging to the peptidase family M49. DPP3 has broad substrate specificity for oligopeptides of 3 or 4 to 10 amino acids of various compositions and can also cleave after proline. DPP3 is known to hydrolyze dipeptides from the N-terminus of its substrates, including angiotensin II, III, and IV; Leu- and Met-enkephalins; and endomorphins 1 and 2. The metallopeptidase DPP3 has its activity optimum at pH 8.0-9.0 and is highly cleavable by Co. 2+ and Mg 2+ It can be activated by the addition of divalent metal ions such as

[0004] Structural analysis of DPP3 revealed the catalytic motifs HELLGH (hDPP3 450-455) and EECRAE (hDPP3 507-512), as well as the following amino acids important for substrate binding and hydrolysis: Glu316, Tyr318, Asp366, Asn391, Asn394, His568, Arg572, Arg577, Lys666, and Arg669 (Prajapati & Chauhan 2011; Kumar et al. 2016; numbering refers to the sequence of human DPP3, see SEQ ID NO: 36). Taking into account all known amino acids or sequence regions involved in substrate binding and hydrolysis, the active site of human DPP3 can be defined as the region from amino acids 316 to 669.

[0005] The most prominent substrate of DPP3 is angiotensin II (Ang II), a major effector of the renin-angiotensin system (RAS). The RAS is activated in cardiovascular disease (Dostal et al. 1997. J Mol Cell Cardiol 29:2893-902; Roks et al. 1997. Heart Vessels. Suppl 12:119-24), sepsis, and septic shock (Correa et al. 2015. Crit Care 19:98). Specifically, Ang II has been shown to regulate many cardiovascular functions, including the control of blood pressure and cardiac remodeling.

[0006] Recently, two assays have been developed, characterized, and validated to specifically detect DPP3 in human body fluids (e.g., blood, plasma, and serum): a luminescence immunoassay (LIA) to detect DPP3 protein concentration and an enzyme capture activity assay (ECA) to detect specific DPP3 activity (Rehfeld et al. 2019. JALM 3(6):943-953). After a wash step to remove all interfering substances, the actual detection of DPP3 activity is performed. Both methods are highly specific and allow for reproducible detection of DPP3 in blood samples.

[0007] Circulating DPP3 levels have been shown to be elevated in patients with cardiogenic shock and have been associated with an increased risk of short-term mortality and severe organ dysfunction (Deaniau et al. 2020. Eur J Heart Fail. 22(2):290-299). Furthermore, DPP3 was measured in a randomized controlled trial of cardiogenic shock patients who developed refractory versus non-refractory shock, and DPP3 concentrations ≥ 59.1 ng / mL were associated with a greater risk of death (Takagi et al. 2020. Eur J Heart Fail. 22(2):279-286).

[0008] The peptide adrenomedullin (ADM) was first described in 1993 as a novel antihypertensive peptide containing 52 amino acids (Kitamura et al., 1993. Biochem Biophys Res Comm 192(2):553-560), which was isolated from a human pheochromocytoma cell line (SEQ ID NO: 20). In the same year, a precursor peptide containing 185 amino acids and a cDNA encoding the complete amino acid sequence of this precursor peptide were also described. Specifically, the precursor peptide containing a 21-amino acid signal sequence at its N-terminus is referred to as "pre-proadrenomedullin" (pre-proADM). In this specification, all specified amino acid positions generally refer to the 185-amino acid pre-proADM. The peptide ADM is a 52-amino acid peptide (SEQ ID NO: 20) that contains amino acids 95 to 146 of pre-proADM, from which it is formed by proteolytic cleavage. To date, only a few of the peptide fragments formed upon cleavage of pre-pro-ADM have been investigated more precisely: specifically, the physiologically active peptide ADM and "PAMP," a peptide containing the 20 amino acids (22-41) following the 21 amino acids of the signal peptide in pre-pro-ADM. The discovery and characterization of ADM in 1993 triggered intensive research activity, the results of which have been summarized in various review articles, the present context specifically referring to the articles found in the issue of "Peptides" devoted to ADM (Takahashi 2001, Peptides 22:1691; Eto 2001, Peptides 22:1693-1711). A further review is Hinson et al. 2000 (Hinson et al. 2000, Endocrine Reviews 21(2):138-167). Scientific research to date has found, inter alia, that ADM can be considered a multifunctional regulatory peptide: ADM is released into the circulation in a prolonged inactive state by glycine (Kitamura et al. 1998. Biochem Biophys Res Commun 244(2):551-555).There are also binding proteins specific for ADM that likely modulate its effects as well (Pio et al. 2001. The Journal of Biological Chemistry 276(15):12292-12300). The most important physiological effect of ADM and PAMPs investigated to date is their effect on blood pressure.

[0009] Therefore, ADM is an effective vasodilator, and therefore, its antihypertensive effect can be associated with a specific peptide segment in the C-terminal portion of ADM. Furthermore, the physiologically active peptide PAMP formed from pre-proADM has been found to similarly exhibit antihypertensive effects, even though it appears to have a different mechanism of action from that of ADM (see, in addition to the above-mentioned review articles, Eto et al. 2001 and Hinson et al. 2000, Kuwasaki et al. 1997. FEBS Lett 414(1):105-110; Kuwasaki et al. 1999. Ann. Clin. Biochem. 36:622-628; Tsuruda et al. 2001 Life Sci. 69(2):239-245, and European Patent Application Publication No. A20622458). Furthermore, the concentration of ADM that can be measured in circulation and other biological fluids has been found to be significantly higher than that found in healthy control subjects in some pathological conditions.Therefore, the ADM level in patients with congestive heart failure, myocardial infarction, kidney disease, hypertensive disorders, diabetes mellitus, acute shock, and sepsis and septic shock is significantly increased, although to different degrees.PAMP concentration also increases in some of these pathological conditions, but its plasma level is lower than that of ADM (Eto 2001.Peptides 22:1693-1711).Abnormally high concentrations of ADM have been observed in sepsis, with the highest concentrations reportedly observed in septic shock (Eto 2001. Peptides 22:1693-1711; Hirata et al. Journal of Clinical Endocrinology and Metabolism 81(4):1449-1453; Ehlenz et al. 1997. Exp Clin Endocrinol Diabetes 105:156-162; Tomoda et al. 2001. Peptides 22:1783-1794; Ueda et al. 1999. Am. J. Respir. Crit. Care Med. 160:132-136, and Wang et al. 2001. Peptides 22:1835-1840).

[0010] Plasma concentrations of ADM are elevated in patients with heart failure and correlate with disease severity (Hirayama et al. 1999. J Endocrinol 160:297-303; Yu et al. 2001. Heart 86:155-160). High plasma ADM is an independent negative prognostic indicator in these subjects (Poyner et al. 2002. Pharmacol Rev 54:233-246).

[0011] WO 2004 / 097423 describes the use of antibodies against ADM for the diagnosis, prognosis, and treatment of cardiovascular disorders. Treatment of diseases by blocking ADM receptors has also been described in the art (e.g., WO 2006 / 027147, PCT / EP 2005 / 012844), and the diseases may be sepsis, septic shock, cardiovascular diseases, infectious diseases, skin diseases, endocrine diseases, metabolic diseases, gastrointestinal diseases, cancer, inflammation, blood diseases, respiratory diseases, musculoskeletal diseases, neurological diseases, or urinary diseases.

[0012] During the early stages of sepsis, ADM has been reported to improve cardiac function and blood supply in the liver, spleen, kidneys, and small intestine. Anti-ADM neutralizing antibodies neutralize the aforementioned effects during the early stages of sepsis (Wang et al. 2001. Peptides 22:1835-1840).

[0013] For other diseases, blocking ADM may be beneficial to a certain extent. However, because a certain amount of ADM may be required for some physiological functions, completely neutralizing ADM may also be harmful. Many reports have emphasized that administering ADM may be beneficial in certain diseases. In contrast, other reports have reported that ADM is life-threatening when administered in certain conditions.

[0014] WO 2013 / 072510 describes non-neutralizing anti-ADM antibodies for use in therapy of a serious chronic or acute disease or acute condition in a patient to reduce the risk of death for said patient.

[0015] WO 2013 / 072511 describes non-neutralizing anti-ADM antibodies for use in the therapy of chronic or acute diseases or conditions in patients for the prevention or reduction of organ dysfunction or organ failure.

[0016] WO 2013 / 072512 describes the half-life (t 1 / 2 We describe a non-neutralizing anti-ADM antibody that enhances the half-retention time of ADM. This ADM-stabilizing antibody blocks the biological activity of ADM by less than 80%.

[0017] WO 2013 / 072513 describes non-neutralizing anti-ADM antibodies for use in the therapy of acute diseases or conditions in patients to stabilize circulation.

[0018] WO 2013 / 072514 describes non-neutralizing anti-ADM antibodies for regulating fluid balance in patients with chronic or acute diseases or conditions.

[0019] WO 2017 / 182561 describes a method for determining total or active DPP3 in a patient sample for the diagnosis of diseases associated with necrotic processes. It further describes a method for treating necrosis-associated diseases with antibodies directed against DPP3.

[0020] WO 2021 / 170838 describes a method for therapy guidance and / or therapy monitoring and / or therapy stratification in shock patients and patients in a state of shock by determining the level of DPP3 and administering an anti-ADM antibody if the level is preferably below a threshold of 50 ng / ml.

[0021] High DPP3 blood levels are associated with higher organ dysfunction scores, the need for cardiovascular support, and the development of myocardial dysfunction, refractory shock, acute kidney injury, and increased short-term mortality. Based on these clinical associations, it is plausible that active DPP3 released into the blood of shock patients is a contributing factor to the deterioration of vascular tone in shock syndrome by neutralizing the hypertensive effect of endogenous Ang II (Malovan et al. 2023 FEBS Journal 290(9):2246-2262). In patients with shock, the presence of endothelial dysfunction is detected with the help of the biomarker bioADM, while cardiac dysfunction is detected by measuring DPP3. DPP3 levels above a threshold have been used as an exclusion criterion for the application of drugs that address pathways different from DPP3, such as anti-ADM antibodies, specifically the anti-ADM antibody adrecizumab directed against the N-terminus of ADM. Addressizumab therapy showed better efficacy when patients with DPP3 levels above 50 ng / ml were excluded from treatment (WO 2021 / 170838). However, in patients with initial DPP3 levels below 50 ng / ml, DPP3 levels may subsequently increase above 50 ng / ml, which would indicate exclusion for the application of medications addressing pathways other than DPP3. Thus, a surprising finding of the present invention is that in critically ill patients, if DPP3 levels are well below the 50 ng / ml threshold, preferably below the 40 ng / ml threshold or in the range of 22 ng / ml to 40 ng / ml, the patient is unlikely to experience an increase in DPP3 during follow-up. On the other hand, this means that in critically ill patients, if DPP3 levels are above the 40 ng / ml threshold, preferably above the threshold in the range of 40 ng / ml to 22 ng / ml, the patient is more likely to experience an increase in DPP3 during follow-up. Furthermore, the inventors found that this increase was a short-term increase occurring within a few hours or up to 7 days, respectively.

[0022] Consequently, this would mean that patients with DPP3 levels below a threshold in the range of 22 ng / ml to 40 ng / ml could be treated with medications that address a pathway different from DPP3, such as anti-ADM antibodies, specifically the anti-ADM antibody adrecizumab, and that patients with DPP3 levels above a threshold in the range of 40 ng / ml to 22 ng / ml could not be treated with medications that address a pathway different from DPP3, such as anti-ADM antibodies, specifically the anti-ADM antibody adrecizumab.

[0023] The objective of the present invention is to reduce the number of critically ill patients who experience a short-term increase (e.g., within a few hours to a maximum of 7 days) in DPP3 levels above a critical cutoff (e.g., above 40 ng / ml or 50 ng / ml), which means striving for high test sensitivity for this endpoint. Furthermore, a surprising finding of the present invention is the prediction of non-increase in DPP3 levels above a critical cutoff in critically ill patients during follow-up whose DPP3 levels fall below a predetermined threshold level in the range of 22 to 40 ng / ml. In this way, patients who may be suitably treated with drugs that address pathways other than DPP3, such as anti-ADM antibodies, specifically the anti-ADM antibody adrecizumab, can be identified. Surprisingly, the "point of no return"—at which DPP3 levels further increase above the critical cutoff in critically ill patients during short-term follow-up—is already reached at DPP3 levels much lower than those known in the art. Identifying patients who do not experience such short-term increases in DPP3 levels above a critical cutoff, particularly identifying patients as early as possible, would significantly improve the overall efficacy of treatment for this patient population that may be the standard of care treatment, or of medications that address pathways other than DPP3, such as anti-ADM antibodies, particularly the anti-ADM antibody adrecizumab. DETAILED DESCRIPTION OF THE INVENTION

[0024] The subject of the present invention is a method for the prediction of an increase in dipeptidyl peptidase 3 (DPP3) in critically ill patients, said method comprising: determining the level of DPP3 in a sample of the patient's body fluid; A predetermined threshold value, comparing the determined level of DPP3 to a predetermined threshold, wherein the predetermined threshold for DPP3 is in the range of 40 ng / ml to 22 ng / ml; A level of DPP3 in the sample above the predetermined level is indicative for increased DPP3 in the patient, a method for predicting increased DPP3 in a critically ill patient.

[0025] One embodiment of the present application relates to a method for prediction of increased DPP3 in critically ill patients, wherein the patient has a severe infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, organ dysfunction or failure (e.g., liver, kidney, lung dysfunction or failure), undergoing major surgery, trauma (e.g., burn trauma, polytrauma), shock and / or is in shock.

[0026] One embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein the patient has or is in a state of shock, the shock being selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock, in particular cardiogenic shock or septic shock.

[0027] One preferred embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, said patient having shock and / or being in a shock state, In the case of cardiogenic shock, the patient may be suffering from an acute coronary syndrome (e.g., acute myocardial infarction), or the patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, or trauma; In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or • In the case of distributive shock, the patient may have septic shock, neurogenic shock, anaphylactic shock, or shock due to adrenal crisis.

[0028] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein said predetermined threshold value of DPP3 in a sample of body fluid of said subject is in the range of 40 ng / ml to 22 ng / mL.

[0029] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein said predetermined threshold value of DPP3 in a sample of body fluid of said subject is in the range of 30 ng / ml to 22 ng / ml.

[0030] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein said predetermined threshold value of DPP3 in a sample of body fluid of said subject is in the range of 25 ng / ml to 22 ng / ml.

[0031] Another embodiment of the present application relates to a method for the prediction of an increase in DPP3 in a critically ill patient, wherein the predicted increase is an increase to a DPP3 level of 40 ng / ml or more, preferably 50 ng / ml or more.

[0032] Another embodiment of the present application relates to a method for predicting an increase in DPP3 in a critically ill patient, wherein the predicted increase in DPP3 level is 10% or more, more preferably 20% or more, even more preferably 40% or more, even more preferably 50% or more, even more preferably 75% or more, even more preferably 100% or more. Specifically, this relates to an increase in DPP3 level relative to the level of DPP3 determined in a sample.

[0033] Another embodiment of the present application relates to a method for predicting an increase in DPP3 in a critically ill patient, wherein the predicted increase in DPP3 level is 2.5 ng / ml or more, more preferably 5 ng / ml or more, even more preferably 10 ng / ml or more, even more preferably 15 ng / ml or more, even more preferably 20 ng / ml or more, even more preferably 25 ng / ml or more. Specifically, this relates to an increase in DPP3 level relative to the level of DPP3 determined in a sample.

[0034] Another embodiment of the present application relates to a method for prediction of increased DPP3 in critically ill patients, wherein the patient is selected for therapy / treatment if the level of DPP3 in said sample is below said predetermined threshold, said therapy being selected from the group of alkaline phosphatase, immunosuppressants, corticosteroids, vasopressors, fluids, anti-ADM antibodies, or antibody fragments or scaffolds.

[0035] Another embodiment of the present application relates to a method for prediction of increased DPP3 in critically ill patients, wherein the patient is selected for therapy / treatment with a DPP3 inhibitor if the level of DPP3 in said sample is above said predetermined threshold, said DPP3 inhibitor being selected from the group of anti-DPP3 antibodies, or anti-DPP3 antibody fragments or anti-DPP3 scaffolds.

[0036] Another particular embodiment of the present application relates to a method for the prediction of increased DPP3 in critically ill patients, wherein either the level of DPP3 protein and / or the level of active DPP3 is determined and compared against a pre-defined threshold.

[0037] Another preferred embodiment of the present application relates to a method for the prediction of increased DPP3 in a critically ill patient, wherein the level of DPP3 is determined by contacting said sample of body fluid with a capture binding agent that specifically binds DPP3.

[0038] One embodiment of the present application relates to a method for prediction of increased DPP3 in critically ill patients, wherein said determination comprises the use of a capture binding agent that specifically binds to full-length DPP3, said capture binding agent may be selected from the group of antibodies, antibody fragments, or non-IgG scaffolds.

[0039] A further embodiment of the present application relates to a method for predicting increased DPP3 in a critically ill patient, wherein the amount of DPP3 protein and / or DPP3 activity is determined in a body fluid sample of the subject, said determining comprising the use of a capture binding agent that specifically binds to full-length DPP3, wherein the capture binding agent is an antibody.

[0040] One embodiment of the present application relates to a method for predicting increased DPP3 in a critically ill patient, wherein the amount of DPP3 protein and / or DPP3 activity is determined in a body fluid sample of the subject, said determining comprising the use of a capture binding agent that specifically binds to full-length DPP3, said capture binding agent being immobilized on a surface.

[0041] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein the level of DPP3 is DPP3 activity, and a method for determining DPP3 activity in a body fluid sample of said subject comprises: contacting the sample with a capture binding agent that specifically binds full-length DPP3; - separating the DPP3 bound to the capture binding agent; adding a DPP3 substrate to the isolated DPP3; - Quantifying the DPP3 activity by measuring and quantifying the conversion of a substrate of DPP3.

[0042] Another embodiment of the present application relates to a method for therapy guidance and / or therapy monitoring and / or therapy stratification in critically ill patients, wherein the amount of DPP3 protein and / or DPP3 activity is determined in a body fluid sample of the subject, and the separation step is a washing step that removes components of the sample that are not bound to the capture binding agent from the captured DPP3.

[0043] Another particular embodiment of the present application relates to a method for predicting increased DPP3 in critically ill patients, wherein DPP3 activity is determined in a body fluid sample of the subject, and DPP3 substrate conversion is detected by a method selected from the group comprising fluorescence of a fluorogenic substrate (e.g., Arg-Arg-βNA, Arg-Arg-AMC), color change of a chromogenic substrate, luminescence of a substrate coupled to aminoluciferin (Promega Protease-Glo™ assay), mass spectrometry, HPLC / FPLC (reverse-phase chromatography, size-exclusion chromatography), thin-layer chromatography, capillary zone electrophoresis, gel electrophoresis followed by activity staining (immobilized active DPP3), or Western blot (cleavage products).

[0044] Another preferred embodiment of the present application relates to a method for prediction of increased DPP3 in critically ill patients, wherein DPP3 activity is determined in a body fluid sample of the subject, and wherein the substrate may be selected from the group comprising angiotensin II, III, and IV, Leu-enkephalin, Met-enkephalin, endomorphins 1 and 2, valorphin, β-casomorphin, dynorphin, proctolin, ACTH and MSH, or a dipeptide coupled to a fluorophore, a chromophore or an aminoluciferin, wherein the dipeptide is Arg-Arg.

[0045] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein DPP3 activity is determined in a body fluid sample of the subject, and wherein the substrate can be selected from the group comprising a dipeptide coupled to a fluorophore, a chromophore or aminoluciferin, wherein the dipeptide is Arg-Arg.

[0046] Another embodiment of the present application relates to a method for prediction of increased DPP3 in a critically ill patient, wherein the sample of body fluid of said patient is selected from the group of whole blood, serum, and plasma.

[0047] The level of DPP3 as the amount of DPP3 protein and / or DPP3 activity in a sample of the subject's body fluid can be determined by different methods, such as immunoassays, activity assays, mass spectrometry methods, etc.

[0048] DPP3 activity can be measured by detecting the cleavage products of DPP3-specific substrates. Known peptide hormone substrates include Leu-enkephalin, Met-enkephalin, endomorphins 1 and 2, valorphin, β-casomorphin, dynorphin, proctolin, ACTH (adrenocorticotropic hormone), and MSH (melanocyte-stimulating hormone; Abramic et al. 2000, Barsun et al. 2007, Dhanda et al. 2008). Cleavage of the mentioned peptide hormones and other untagged oligopeptides (e.g., Ala-Ala-Ala-Ala; Dhanda et al. 2008) can be monitored by detecting the respective cleavage products. Detection methods include, but are not limited to, HPLC analysis (e.g., Lee & Snyder 1982), mass spectrometry (e.g., Abramic et al. 2000), H1-NMR analysis (e.g., Vandenberg et al. 1985), capillary zone electrophoresis (CE; e.g., Barsun et al. 2007), thin-layer chromatography (e.g., Dhanda et al. 2008), or reverse-phase chromatography (e.g., Mazocco et al. 2006).

[0049] Detection of fluorescence resulting from hydrolysis of fluorogenic substrates by DPP3 is a standard procedure for monitoring DPP3 activity. These substrates are specific di- or tripeptides (Arg-Arg, Ala-Ala, Ala-Arg, Ala-Phe, Asp-Arg, Gly-Ala, Gly-Arg, Gly-Phe, Leu-Ala, Leu-Gly, Lys-Ala, Phe-Arg, Suc-Ala-Ala-Phe) coupled to fluorophores. Fluorophores include, but are not limited to, β-naphthylamide (2-naphthylamide, βNA, 2NA), 4-methoxy-β-naphthylamide (4-methoxy-2-naphthylamide), and 7-amido-4-methylcoumarin (AMC, MCA; Abramic et al. 2000, Ohkubo et al. 1999). Cleavage of these fluorogenic substrates yields fluorescent β-naphthylamine or 7-amino-4-methylcoumarin, respectively. In a liquid-phase assay (ECA), the substrate and DPP3 are incubated, for example, in a 96-well plate format, and fluorescence is measured using a fluorescence detector (Ellis & Nuenke 1967). Additionally, DPP3-bearing samples can be fixed and resolved on a gel by electrophoresis. The gel is stained with a fluorogenic substrate (e.g., Arg-Arg-βNA) and fast garnet GBC, and the fluorescent protein bands are detected by a fluorescence reader (Ohkubo et al. 1999). The same peptides (Arg-Arg, Ala-Ala, Ala-Arg, Ala-Phe, Asp-Arg, Gly-Ala, Gly-Arg, Gly-Phe, Leu-Ala, Leu-Gly, Lys-Ala, Phe-Arg, Suc-Ala-Ala-Phe) can be coupled to a chromophore such as Asp-nitroanilide diacetate. Detection of the color change resulting from hydrolysis of the chromogenic substrate can be used to monitor DPP3 activity.

[0050] Another option for detecting DPP3 activity is the Protease-Glo™ assay (commercially available from Promega). In this embodiment of the method, DPP3-specific di- or tripeptides (Arg-Arg, Ala-Ala, Ala-Arg, Ala-Phe, Asp-Arg, Gly-Ala, Gly-Arg, Gly-Phe, Leu-Ala, Leu-Gly, Lys-Ala, Phe-Arg, Suc-Ala-Ala-Phe) are coupled to aminoluciferin. Upon cleavage by DPP3, the aminoluciferin is released and serves as a substrate for the coupled luciferase reaction, which emits detectable luminescence.

[0051] In a preferred embodiment, DPP3 activity is measured by addition of the fluorogenic substrate Arg-Arg-βNA and monitoring fluorescence in real time.

[0052] In certain embodiments of the present methods for determining active DPP3 in a body fluid sample of a subject, the capture binding agent reactive with DPP3 is immobilized on a solid phase.

[0053] A test sample is passed over the immobilized binding agent, and if present, DPP3 binds to the binding agent and becomes immobilized for detection. A substrate may then be added, and the reaction product may be detected to indicate the presence or amount of DPP3 in the test sample. For purposes of this specification, the term "solid phase" may be used to include any material or container in or on which an assay can be performed, including, but not limited to, porous materials, non-porous materials, test tubes, wells, slides, agarose resins (e.g., Sepharose from GE Healthcare Life Sciences), magnetic particles (e.g., Dynabeads™ or Pierce™ magnetic beads from Thermo Fisher Scientific), and the like.

[0054] In another embodiment of the invention, the level of DPP3 is determined by contacting the sample of bodily fluid with a capture binding agent that specifically binds DPP3.

[0055] In another preferred embodiment of the present invention, the capture binding agent for determining the level of DPP3 may be selected from the group of antibodies, antibody fragments, or non-IgG scaffolds.

[0056] In certain embodiments of the invention, the capture binding agent is an antibody.

[0057] The level of DPP3 may be the amount of DPP3 protein and / or DPP3 activity in a sample of the subject's body fluid and may be determined, for example, by one of the following methods: 1. Luminescence immunoassay (LIA) for quantification of DPP3 protein concentration (Rehfeld et al., 2019 JALM 3(6):943-953).

[0058] The LIA is a one-step chemiluminescent sandwich immunoassay using white high-binding polystyrene microtiter plates as the solid phase. These plates are coated with the monoclonal anti-DPP3 antibody AK2555 (capture antibody). The tracer anti-DPP3 antibody AK2553 is labeled with MA70-acridinium-NHS-ester and used at a concentration of 20 ng per well. 20 microliters of sample (e.g., serum, heparin-plasma, citrate-plasma, or EDTA-plasma from patient blood) and calibrators are pipetted into the coated white microtiter plate. After adding the tracer antibody AK2553, the microtiter plate is incubated at room temperature and 600 rpm for 3 hours. Unbound tracer is then removed by four washing steps (350 μL per well). The remaining chemiluminescence is measured for 1 second per well using a microtiter plate luminometer. The concentration of DPP3 is determined using a six-point calibration curve. Calibrators and samples are preferably run in duplicate.

[0059] 2. Enzyme capture activity assay (ECA) for quantification of DPP3 activity (Rehfeld et al., 2019 JALM 3(6):943-953).

[0060] ECA is a DPP3 specific activity assay that uses black high-binding polystyrene microtiter plates as the solid phase. These plates are coated with the monoclonal anti-DPP3 antibody AK2555 (capture antibody). 20 microliters of sample (e.g., serum, heparin-plasma, citrate-plasma, EDTA-plasma) and calibrators are pipetted onto the coated black microtiter plate. After adding assay buffer (200 μL), the microtiter plate is incubated at 22°C and 600 rpm for 2 hours. DPP3 present in the sample is immobilized by binding to the capture antibody. Unbound sample components are removed by four washing steps (350 μL per well). The specific activity of the immobilized DPP3 is measured by adding the fluorogenic substrate, Arg-Arg-β-naphthylamide (Arg2-βNA), in reaction buffer, followed by incubation at 37°C for 1 hour. DPP3 specifically cleaves Arg2-βNA into Arg-Arg dipeptide and fluorescent β-naphthylamine. Fluorescence is measured in a fluorometer using an excitation wavelength of 340 nm and emission is detected at 410 nm. DPP3 activity is determined using a six-point calibration curve. Calibrators and samples are preferably run in duplicate.

[0061] 3. Liquid-phase assay (LAA) for quantification of DPP3 activity (modified from Jones et al., Analytical Biochemistry, 1982).

[0062] The LAA is a liquid-phase assay using a black non-binding polystyrene microtiter plate to measure DPP3 activity. Twenty microliters of sample (e.g., serum, heparin-plasma, citrate-plasma) and calibrators are pipetted into the black non-binding microtiter plate. After adding the fluorogenic substrate, Arg2-βNA, in assay buffer (200 μL), the initial βNA fluorescence (T=0) is measured in a fluorometer using an excitation wavelength of 340 nm, and emission is detected at 410 nm. The plate is then incubated at 37°C for 1 hour. The final fluorescence (T=60) is measured. The difference between the final and initial fluorescence is calculated. DPP3 activity is determined using a six-point calibration curve. Calibrators and samples are preferably run in duplicate.

[0063] In certain embodiments, an assay is used to determine the level of DPP3, and the assay sensitivity of the assay is capable of quantifying DPP3 in healthy subjects is <20 ng / ml, preferably <30 ng / ml, and more preferably <40 ng / ml.

[0064] In certain embodiments, the binding agent has an affinity of at least 10 for DPP3. 7 M -1 , preferably 10 8 M -1 and more preferably the affinity is 10 9 M -1 greater than 10, most preferably 10 M -1 Those skilled in the art know that it may be considered to compensate for lower affinity by applying higher doses of the compound, and this measure would not go beyond the scope of the present invention.

[0065] In one specific embodiment, the body fluid according to the present invention is a blood sample. The blood sample may be selected from the group consisting of whole blood, serum, and plasma. In a specific embodiment of the method, the sample is selected from the group consisting of human citrated plasma, heparinized plasma, and EDTA plasma.

[0066] In one embodiment, such an assay for determining the level of DPP3 is a sandwich immunoassay using any type of detection technology, including but not limited to enzyme-labeled, chemiluminescent-labeled, or electrochemiluminescent-labeled, preferably a fully automated assay. In one embodiment of the diagnostic method, such an assay is an enzyme-labeled sandwich assay. Examples of automated or fully automated assays include assays that can be used in one of the following systems: Roche Elecsys®, Abbott Architect®, Siemens Centauer®, Brahms Kryptor®, BiomerieuxVidas®, and Alere Triage®.

[0067] A variety of immunoassays are known and can be used in the assays and methods of the present invention, including mass spectrometry (MS), luminescence immunoassays (LIA), radioimmunoassays ("RIA"), homogeneous enzyme-multiplied immunoassays ("EMIT"), enzyme-linked immunoadsorbent assays ("ELISA"), apoenzyme reactivation immunoassays ("ARIS"), luminescence-based bead arrays, magnetic bead-based arrays, protein microarray assays, rapid test formats such as dipstick immunoassays, immunochromatography strip tests, rare cryptate assays, and automated systems / analyzers.

[0068] In one embodiment of the present invention, it may be a so-called POC (point-of-care) test, which is a testing technology that allows testing to be performed near the patient in less than an hour without the need for a fully automated assay system. An example of this technology is an immunochromatographic testing technology, e.g., a microfluidic device.

[0069] In a preferred embodiment, the label is selected from the group comprising a chemiluminescent label, an enzyme label, a fluorescent label, a radioactive iodine label.

[0070] The assays can be homogeneous or heterogeneous, competitive and non-competitive. In one embodiment, the assay is in the form of a sandwich assay, which is a non-competitive immunoassay, in which the molecule to be detected and / or quantified is bound to a first antibody and a second antibody. The first antibody can be bound to a solid phase, such as a bead, the surface of a well or other container, a chip, or a strip, and the second antibody is an antibody labeled with, for example, a dye, a radioisotope, or a reactive or catalytically active moiety. The amount of labeled antibody bound to the analyte is then measured by an appropriate method. The general compositions and procedures involved in "sandwich assays" are well established and known to those skilled in the art (The Immunoassay Handbook, Ed. David Wild, Elsevier LTD, Oxford; 3rd ed. (May 2005), ISBN-13:978-0080445267; Hultschig C et al., Curr Opin Chem Biol. 2006 Feb;10(1):4-10. PMID:16376134).

[0071] In another embodiment, the assay comprises two capture molecules, preferably antibodies, both present as dispersion in a liquid reaction mixture, a first labeling component attached to the first capture molecule, said first labeling component being part of a labeling system based on fluorescence or chemiluminescence quenching or amplification, and a second labeling component of said marking system attached to the second capture molecule, such that upon binding of both capture molecules to the analyte a measurable signal is generated that allows detection of the formed sandwich complex in the solution containing the sample.

[0072] In another embodiment, the labeling system comprises a rare earth cryptate or rare earth chelate in combination with a fluorescent or chemiluminescent dye, particularly a cyanine-type dye.

[0073] In the context of the present invention, fluorescence-based assays involve the use of dyes, such as, for example, FAM (5- or 6-carboxyfluorescein), VIC, NED, fluorescein, fluorescein isothiocyanate (FITC), IRD-700 / 800, cyanine dyes such as CY3, CY5, CY3.5, CY5.5, Cy7, xanthene, 6-carboxy-2',4',7',4,7-hexafluorophosphate, and the like. Chlorofluorescein (HEX), TET, 6-carboxy-4',5'-dichloro-2',7'-dimethodifluorescein (JOE), N,N,N',N'-tetramethyl-6-carboxyrhodamine (TAMRA), 6-carboxy-X-rhodamine (ROX), 5-carboxyrhodamine-6G (R6G5), 6-carboxyrhodamine-6G (RG6), rhodamine, rhodamine green, rhodamine red, rhodamine 110, BODIPY The dye may be selected from the group including BODIPY dyes such as TMR, coumarins such as Oregon Green, umbelliferone, benzimides such as Hoechst 33258; phenanthridines such as Texas Red, Yakima Yellow, Alexa Fluor, PET, ethidium bromide, acridinium dyes, carbazole dyes, phenoxazine dyes, porphyrin dyes, polymethine dyes, and the like.

[0074] In the context of the present invention, chemiluminescence-based assays involve the use of dyes based on the physical principles described for chemiluminescent materials in Kirk-Othmer, Encyclopedia of Chemical Technology, 4th ed., executive editor, J.I. Kroschwitz; editor, M. Howe-Grant, John Wiley & Sons, 1993, vol. 15, pp. 518-562, which is incorporated herein by reference, including the citations on pages 551-562. Preferred chemiluminescent dyes are acridinium esters.

[0075] As referred to herein, an "assay" or "diagnostic assay" can be of any type applied in the field of diagnostics. Such an assay can be based on the binding of the analyte to be detected to one or more capture probes with a certain affinity. Considering the interaction between the capture molecule and the target molecule or molecule of interest, the affinity constant is preferably greater than 10. 8 M -1 Greater than.

[0076] In certain embodiments, at least one of the two binding agents is labeled for detection.

[0077] The ADM-NH2 levels of the present invention were determined using the described ADM-NH2 assay (Weber et al. 2017. JALM 2(2):1-4). The DPP3 levels of the present invention were determined using the described DPP3 assay, as outlined in the example (Rehfeld et al. 2019. JALM 3(6):943-953). The thresholds mentioned above may be different in other assays if they are calibrated differently from the assay system used in the present invention. Therefore, the cutoff values mentioned above should be applied accordingly to such differently calibrated assays, taking into account the calibration difference. One possibility for quantifying the calibration difference is a method comparison analysis (correlation) of the assay in question with the respective biomarker assay used in the present invention by measuring the respective biomarker (e.g., bioADM, DPP3) in the sample using both methods. Another possibility is to use the assay in question to determine the median biomarker level of a representative normal population, assuming the test has sufficient analytical sensitivity, and then compare the results with the median biomarker levels reported in the literature and recalculate the calibration based on the difference obtained by this comparison. Using the calibration method used in the present invention, samples from normal (healthy) subjects were measured: the median plasma bioADM (mature ADM-NH2) was 24.7 pg / ml, the lowest was 11 pg / ml, and the 99th percentile was 43 pg / ml (Marino et al. 2014. Critical Care 18:R34). Using the calibration method used in the present invention, samples from 5,400 normal (healthy) subjects (Swedish single-center prospective population-based study (MPP-RES)) were measured: the median (interquartile range) plasma DPP3 was 14.5 ng / ml (11.3 ng / ml to 19 ng / ml). DPP3 concentrations have been shown to strongly correlate with DPP3 activity in the blood (Rehfeld et al. 2019. J Appl Lab Med 3:943-953; Deniau et al. 2019. Eur J Heart Fail 22:290-299).As a result, the level of active DPP3 can be determined using respective thresholds and threshold ranges that correspond to the thresholds and threshold ranges used by determining the level of DPP3 protein.

[0078] In preferred embodiments, treatment is initiated or altered immediately upon provision of the results of the sample analysis indicating the level of DPP3 in the sample, hi further embodiments, treatment may be initiated within 12 hours, preferably 6, 4, 2, 1, 0.5, 0.25 hours, or immediately after receiving the results of the sample analysis.

[0079] In certain embodiments of the invention, the increase in DPP3 in the patient is during the follow-up period.

[0080] In certain embodiments of the invention, the follow-up time is up to 12 hours, preferably up to 24, 48, 72, 96 hours, more preferably up to 5 days, even more preferably up to 6 days, and most preferably up to 7 days.

[0081] In certain embodiments of the invention, the increase in DPP3 in the patient is within 12 hours, preferably up to 24, 48, 72, or 96 hours, more preferably up to 5 days, even more preferably up to 6 days, and most preferably up to 7 days. In other embodiments of the invention, the follow-up time is 2 days, or 3 days, or 7 days.

[0082] In certain embodiments of the invention, the increase in DPP3 in the patient is within up to 12 hours, preferably up to 24, 48, 72, 96 hours, more preferably up to 5 days, even more preferably up to 6 days, and most preferably up to 7 days.

[0083] In other embodiments of the invention, the increase in DPP3 in the patient is within 2 days, or 3 days, or 7 days.

[0084] The present invention further relates to a kit for carrying out the method of the present invention, comprising a detection reagent for measuring DPP3 in a sample from a patient and reference data, such as a reference and / or threshold level corresponding to a level of DPP3 in said sample of 22 to 40 ng / mL, said reference data preferably stored on a computer readable medium and / or in the form of computer executable code configured to compare the determined DPP3 against said reference data.

[0085] In one embodiment of the methods described herein, the method additionally comprises comparing the determined level of DPP3 in the patient having shock or in a state of shock to a reference and / or threshold level, wherein the comparison is performed in a computer processor using computer executable code.

[0086] The method of the present invention can be partially computer-implemented. For example, the step of comparing the detected DPP3 level with a reference and / or threshold level can be performed in a computer system. For example, the determined value can be input into the computer system (either manually by a medical professional or automatically from a device where the respective marker level is determined). The computer system can be directly at the point of care (e.g., a primary care unit or ED) or can be located in a remote location connected via a computer network (e.g., via the Internet or a dedicated medical cloud system, which can optionally be combined with other IT systems or platforms, such as a hospital information system (HIS)). Alternatively or additionally, the associated therapy guidance and / or therapy stratification can be displayed and / or printed for the user (typically a medical professional, such as a doctor).

[0087] The term "critically ill patient" refers to a patient suffering from an acute disease or condition, e.g., an intensive care unit (ICU) patient, who requires constant and / or intensive monitoring of the patient's health status. The patient may be suffering from a serious infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, organ dysfunction or failure (e.g., liver, kidney, or lung dysfunction or failure), major surgery, trauma (e.g., burns, multiple trauma), shock, and / or shock state. In other embodiments, the patient may be suffering from a serious infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, organ dysfunction or failure (e.g., liver, kidney, or lung dysfunction or failure), major surgery, trauma (e.g., burns, multiple trauma), shock, and / or shock state, or ARDS.

[0088] Patients with chronic heart failure (HF) can include patients with worsening signs and symptoms of chronic heart failure as well as acute decompensation of chronic heart failure.

[0089] Chronic HF with worsening signs and symptoms specifically includes: (i) The presence of a structural or functional insufficiency of the heart that impairs its ability to provide sufficient blood flow to meet the body's needs; (ii) Characterized by volume overload (manifested by pulmonary and / or systemic congestion) and / or severely reduced cardiac output (manifested by hypotension, renal insufficiency, and / or shock syndrome), while the patient is not in need of emergency therapy and does not require hospitalization, but is in need of therapy adjustment.

[0090] Chronic heart failure can also become decompensated (called acutely decompensated heart failure or acutely decompensated chronic heart failure), most commonly as a result of intercurrent illness (e.g., pneumonia), myocardial infarction, arrhythmia, uncontrolled hypertension, or the patient's inability to maintain fluid restriction, diet, or medications.

[0091] New-onset acute HF and acutely decompensated chronic HF are (i) The presence of a structural or functional insufficiency of the heart that impairs its ability to provide sufficient blood flow to meet the body's needs; (ii) Characterized by volume overload (manifested by pulmonary and / or systemic congestion) and / or severe reduction in cardiac output (manifested by hypotension, renal insufficiency, and / or shock syndrome), while the patient is in need of emergency therapy or therapy adjustment and requires hospitalization.

[0092] [Table 1]

[0093] The above definitions of acute heart failure as either new-onset AHF or acute decompensated HF or acute decompensated chronic HF or worsening signs / symptoms of chronic heart failure are in line with Voors et al., European Journal of Heart Failure (2016), 18, 716-726.

[0094] The patients described herein may be in an emergency department (ED) or intensive care unit (ICU), or may be in other point-of-care settings, for example, in an emergency transport vehicle such as an ambulance, or in a general practitioner encountering a patient with one of the diseases detailed herein.

[0095] The term "ICU patient" refers to, but is not limited to, a patient admitted to an intensive care unit. An intensive care unit, which may also be referred to as an intensive therapy unit or intensive treatment unit (ITU) or critical care unit (CCU), is a special department of a hospital or healthcare facility that provides critical care medications. ICU patients typically suffer from serious, life-threatening illnesses and injuries that require constant, close monitoring and support from specialized equipment and / or medications to ensure normal bodily function. Common conditions treated in an ICU include, but are not limited to, acute respiratory distress syndrome (ARDS), trauma, organ dysfunction or failure, sepsis, and shock.

[0096] In another particular embodiment of the invention, the shock is selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock, in particular cardiogenic or septic shock.

[0097] In another particular embodiment of the invention, the shock is selected from the group comprising: In the case of cardiogenic shock, the patient has an acute coronary syndrome (e.g., acute myocardial infarction) or heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, or trauma; In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or In the case of distributive shock, the patient has septic shock, neurogenic shock, anaphylactic shock, or shock resulting from an adrenal crisis.

[0098] Shock is characterized by decreased oxygen delivery and / or increased oxygen consumption or inadequate oxygen utilization, resulting in cellular and tissue hypoxia. It is a life-threatening condition of circulatory failure, most commonly manifested as hypotension (systolic blood pressure less than 90 mmHg or MAP less than 65 mmHg). Shock is classified into four major types based on the underlying cause: hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock (Vincent and De Backer 2014. N. Engl. J. Med. 370(6):583).

[0099] Hypovolemic shock is characterized by a decrease in intravascular volume and can be classified into two broad subtypes: hemorrhagic and nonhemorrhagic. Common causes of hemorrhagic hypovolemic shock include gastrointestinal bleeding, trauma, vascular etiologies (e.g., ruptured abdominal aortic aneurysm, tumors encroaching into major blood vessels), and spontaneous bleeding in the setting of anticoagulant use. Common causes of nonhemorrhagic hypovolemic shock include vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, intestinal obstruction, or trauma. For a review, see Koya and Paul 2018. Shock. StatPearls [Internet]. Treasure Island, FL: StatPearls Publishing; 2019-2018 Oct 27.

[0100] Cardiogenic shock (CS) is defined as a state of severe end-organ hypoperfusion resulting from reduced cardiac output. Notably, CS manifests as a spectrum ranging from mild hypoperfusion to severe shock. Established criteria for the diagnosis of CS are (i) systolic blood pressure ≤90 mmHg for >30 minutes or vasopressors required to achieve blood pressure ≥90 mmHg, (ii) pulmonary congestion or elevated left ventricular filling pressure, and (iii) signs of impaired organ perfusion with at least one of the following criteria: (a) altered mental status, (b) chills or clammy skin, (c) oliguria (<0.5 mL / kg / h or <30 mL / h), and (d) elevated serum lactate (Reynolds and Hochman 2008. Circulation 117:686-697). Acute myocardial infarction (AMI) with subsequent ventricular dysfunction is the most frequent cause of CS, accounting for approximately 80% of cases. Mechanical complications such as ventricular septum (4%) or free wall rupture (2%) and acute severe mitral regurgitation (7%) are less frequent causes of CS after AMI (Hochman et al. 2000. J Am Coll Cardiol 36:1063-1070). Non-AMI-related CS involves heterogeneous treatment options and can be caused by decompensated valvular heart disease, acute myocarditis, arrhythmias, etc. This translates to 40,000-50,000 patients per year in the United States and 60,000-70,000 patients in Europe. Despite advances in treatment, primarily through early revascularization, with subsequent mortality reductions, CS remains the leading cause of death in AMI, with recent registry and randomized trials showing mortality rates still approaching 40-50% (Goldberg et al. 2009. Circulation 119:1211-1219).

[0101] Obstructive shock results from a physical blockage of the great vessels or the heart itself. Several conditions can lead to this form of shock (e.g., cardiac tamponade, tension pneumothorax, pulmonary embolism, aortic stenosis). For a review, see Koya and Paul 2018. Shock. StatPearls [Internet]. Treasure Island (FL): StatPearls Publishing; 2019-2018 Oct 27.

[0102] Based on the cause, there are four types of distributed shock: neurogenic shock (reduced sympathetic stimulation leading to reduced vagal tone), anaphylactic shock, septic shock, and shock due to adrenal crisis. In addition to sepsis, distributed shock can be caused by systemic inflammatory response syndrome (SIRS) due to conditions other than infection, such as pancreatitis, burns, or trauma. Other causes include toxic shock syndrome (TSS), anaphylaxis (a sudden, severe allergic reaction), adrenal insufficiency (acute worsening of chronic adrenal insufficiency, destruction or removal of the adrenal glands, suppression of adrenal function due to exogenous steroids, hypopituitarism, and metabolic failure of hormone production), reaction to drugs or toxins, heavy metal poisoning, hepatic (liver) failure, and damage to the central nervous system. For a review, see Koya and Paul 2018. Shock. StatPearls [Internet]. Treasure Island, FL: StatPearls Publishing; 2019-2018 Oct 27.

[0103] Refractory shock is defined as the requirement for a norepinephrine infusion of >0.5 μg / kg / min despite adequate volume resuscitation. Mortality in these patients can be as high as 94%, and the evaluation and management of these patients requires a much more aggressive approach to survival. The term "refractory shock" is used when tissue perfusion cannot be restored with initial corrective measures (e.g., vasopressors) employed; therefore, it may be referred to as "highly vasopressor-dependent" or "vasopressor-resistant" shock (Udupa and Shetty 2018. Indian J Respir Care 7:67-72). Patients with refractory shock may have features of inadequate perfusion, such as hypotension (mean arterial pressure <65 mmHg), tachycardia, cold peripheries, prolonged capillary refill time, and tachypnea resulting from hypoxia and acidosis. Fever may be present in septic shock. Other signs of hypoperfusion, such as altered sensorium, hyperlactemia, and oliguria, may also be present. These well-known signs of shock do not help identify whether the problem is with the pump (heart) or the circulation (blood vessels and tissues). Different types of shock can coexist, and all forms of shock can become refractory, as evidenced by unresponsiveness to high doses of vasopressors (Udupa and Shetty 2018. Indian J Respir Care 7:67-72).

[0104] Septic shock is a potentially fatal medical condition that occurs when sepsis, an organ injury or damage in response to infection, leads to dangerously low blood pressure and abnormalities in cellular metabolism. The Third International Consensus Definition of Sepsis and Septic Shock (Sepsis-3) defines septic shock as a subset of sepsis, in which particularly significant circulatory, cellular, and metabolic abnormalities are associated with a greater risk of mortality than sepsis alone. Patients with septic shock can be clinically identified by the need for vasopressors to maintain a mean arterial pressure of 65 mmHg or higher and a serum lactate level of more than 2 mmol / L (>18 mg / dL) in the absence of hypovolemia. This combination is associated with a hospital mortality rate of over 40% (Singer et al. 2016. JAMA. 315(8):801-10). The primary infection is most commonly caused by bacteria, but can also be fungal, viral, or parasitic. It can be located in any part of the body, but most commonly in the lungs, brain, urinary tract, skin, or abdominal organs. It can cause multiple organ dysfunction syndrome (formerly known as multiple organ failure) and death. People with septic shock are often cared for in intensive care units. It most commonly affects children, immunocompromised individuals, and the elderly, because their immune systems cannot fight infection as effectively as those of healthy adults. The mortality rate from septic shock is approximately 25-50%.

[0105] In one embodiment of the invention, the patient is a critically ill patient who has or is in shock at the time the sample of the patient's body fluid is taken.

[0106] A "patient in shock" is defined as a critically ill patient who is not in shock at the time fluid is withdrawn from the patient, but who is at increased risk of developing shock.

[0107] In certain embodiments, the shock is septic shock or cardiogenic shock.

[0108] The term "therapy" or "treatment" refers to a critical care medication selected from the group including alkaline phosphatase, immunosuppressants, corticosteroids, vasopressors, fluids, anti-ADM antibodies, anti-ADM antibody fragments, anti-ADM scaffolds, and anti-DPP3 inhibitors (e.g., anti-DPP3 antibodies, anti-DPP3 antibody fragments, and anti-DPP3 scaffolds).

[0109] Another preferred embodiment of the present application is further a method for prediction of increased DPP3 in critically ill patients, wherein the patient is selected for therapy / treatment if the level of DPP3 in said sample is below said predetermined threshold, said therapy being selected from the group of alkaline phosphatase, immunosuppressants, corticosteroids, vasopressors, fluids, anti-ADM antibodies, or antibody fragments.

[0110] Another preferred embodiment of the present application is further a method for predicting increased DPP3 in critically ill patients, wherein the anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM scaffold is directed against the N-terminal portion (amino acids 1 to 21) of ADM:YRQSMNNFQGLRSFGCRFGTC (SEQ ID NO: 14).

[0111] Another embodiment of the present application relates to a method for predicting increased DPP3 in critically ill patients, wherein the anti-ADM antibody or anti-ADM antibody fragment recognizes and binds to the N-terminus (amino acid 1) of ADM.

[0112] A further embodiment of the present application relates to a method for predicting increased DPP3 in critically ill patients, wherein the antibody, antibody fragment, or non-Ig scaffold does not bind to the C-terminal portion of ADM having the sequence amino acids 43-52 of ADM:PRSKISPQGY-NH2 (SEQ ID NO: 24).

[0113] Another embodiment of the present application relates to a method for the prediction of increased DPP3 in critically ill patients, wherein the antibody or fragment is a monoclonal antibody or fragment that binds to ADM or an antibody fragment thereof, and the heavy chain comprises the following sequence: CDR1: SEQ ID NO: 1 GYTFSRYW CDR2: SEQ ID NO: 2 ILPGSGST CDR3: SEQ ID NO: 3 TEGYEYDGFDY The light chain comprises the following sequence: CDR1: SEQ ID NO: 4 QSIVYSNGNTY CDR2: RVS CDR3: SEQ ID NO: 5 FQGSHIPYT.

[0114] Another embodiment of the present application relates to a method for the prediction of increased DPP3 in critically ill patients, wherein the antibody or fragment comprises as VH region a sequence selected from the group comprising: Sequence number 6 (AM-VH-C) SEQ ID NO: 7 (AM-VH1) SEQ ID NO: 8 (AM-VH2-E40) SEQ ID NO: 9 (AM-VH3-T26-E55) SEQ ID NO: 10 (AM-VH4-T26-E40-E55) The VL region comprises a sequence selected from the group comprising the following sequences: SEQ ID NO: 11 (AM-VL-C) SEQ ID NO: 12 (AM-VL1) SEQ ID NO: 13 (AM-VL2-E40) Another embodiment of the present application relates to a method for the prediction of increased DPP3 in critically ill patients, wherein the antibody or fragment comprises as a heavy chain the following sequence: SEQ ID NO: 32 or a sequence >95% identical thereto, The light chain has the following sequence: SEQ ID NO: 33 or a sequence that is >95% identical thereto.

[0115] Certain embodiments of the present invention relate to methods for predicting increased DPP3 in critically ill patients, in which the anti-ADM antibody or anti-ADM antibody fragment may be administered at a dose of at least 0.5 mg / kg body weight, particularly at least 1.0 mg / kg body weight, more particularly 1.0 to 20.0 mg / kg body weight, for example, 2.0 to 10 mg / kg body weight, 2.0 to 8.0 mg / kg body weight, or 2.0 to 5.0 mg / kg body weight.

[0116] The efficacy of non-neutralizing antibodies targeted to the N-terminus of ADM was investigated in survival studies of CLP-induced sepsis in mice. Pretreatment with non-neutralizing antibodies resulted in reduced catecholamine infusion rates, renal dysfunction, and ultimately improved survival (Struck et al. 2013. Intensive Care Med Exp 1(1):22; Wagner et al. 2013. Intensive Care Med Exp 1(1):21).

[0117] Due to these positive results, a humanized version of the N-terminal anti-ADM antibody, named adrecizumab, is being developed for further clinical development. The beneficial effects of adrecizumab on vascular barrier function and survival were recently demonstrated in preclinical models of systemic inflammation and sepsis (Geven et al. 2018. Shock 50(6):648-654). In this study, pretreatment with adrecizumab attenuated renal vascular leakage in endotoxemic rats and mice with CLP-induced sepsis, consistent with increased renal expression of the protective peptide Ang-1 and reduced expression of the deleterious peptide vascular endothelial growth factor (VEGF). Pretreatment with adrecizumab also improved 7-day survival in CLP-induced sepsis by 10-50% after single-dose administration and by 0-40% after multiple-dose administration. Furthermore, a Phase I study demonstrated excellent safety and tolerability (see Example 6): no serious adverse events were observed, no indications of more frequent adverse events were detected in adrecizumab-treated subjects, and no relevant changes in other safety parameters were found (Geven et al. 2017. Intensive Care Med Exp 5(Suppl 2):0427). Of particular interest is the proposed mechanism of action of adrecizumab. Both animal and human data reveal a strong dose-dependent increase in circulating ADM after administration of this antibody. Based on the pharmacokinetic data and the lack of increase in MR-proADM (an inactive peptide fragment derived from the same prohormone as ADM), higher circulating ADM levels cannot be explained by increased production.

[0118] A mechanistic explanation for this increase could be that ADM is small enough to cross the endothelial barrier, but antibodies are not, and therefore excess antibodies in the circulation could expel ADM from the interstitium into the circulation (Geven et al. 2018. Shock. 50(2):132-140). Additionally, antibody binding to ADM results in an extended half-life of ADM. Even though NT-ADM antibodies partially inhibit ADM-mediated signaling, the large increase in circulating ADM results in an overall "net" increase in ADM activity in the blood compartment, where it exerts beneficial effects on endothelial cells (ECs; primarily barrier stabilization) while reducing ADM's deleterious effects on vascular smooth muscle cells (VSMCs; vasodilation) in the interstitium.

[0119] Throughout this specification, an "antibody" or "antibody fragment" or "non-Ig scaffold" according to the present invention is capable of binding to ADM and is therefore directed against ADM, and can therefore be referred to as an "anti-ADM antibody," an "anti-ADM antibody fragment," or an "anti-ADM non-Ig scaffold."

[0120] The term "antibody" generally includes monoclonal and polyclonal antibodies and their binding fragments, particularly Fc fragments, as well as so-called "single-chain antibodies" (Bird et al. 1988), chimeric, humanized, particularly CDR-grafted antibodies, and diabodies or tetrabodies (Holliger et al. 1993). Also included are immunoglobulin-like proteins selected through techniques including phage display that specifically bind to a molecule of interest contained in a sample. In this context, the term "specific binding" refers to an antibody generated against a molecule of interest or a fragment thereof. An antibody is considered specific if its affinity for the molecule of interest or a fragment thereof is preferably at least 50-fold higher, more preferably 100-fold higher, and most preferably at least 1000-fold higher than for other molecules contained in a sample containing the molecule of interest. Methods for generating antibodies and selecting antibodies with a given specificity are well known in the art.

[0121] In one embodiment of the present invention, the anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non-Ig scaffold is monospecific.

[0122] A monospecific anti-ADM antibody, or a monospecific anti-adrenomedullin antibody fragment, or a monospecific anti-ADM non-Ig scaffold means that the antibody, antibody fragment, or non-Ig scaffold binds to one specific region encompassing at least five amino acids within the target ADM. A monospecific anti-ADM antibody, or a monospecific anti-adrenomedullin antibody fragment, or a monospecific anti-ADM non-Ig scaffold is an anti-ADM antibody, or an anti-ADM antibody fragment, or an anti-ADM non-Ig scaffold that all have affinity for the same antigen. While monoclonal antibodies are monospecific, monospecific antibodies can also be produced by means other than producing them from a common germline.

[0123] The anti-ADM antibody, or antibody fragment that binds to ADM, or non-Ig scaffold that binds to ADM can be a non-neutralizing anti-ADM antibody, or antibody fragment that binds to ADM, or non-Ig scaffold that binds to ADM.

[0124] In certain embodiments, the anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold is a non-neutralizing antibody, fragment, or non-Ig scaffold. A neutralizing anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold will block the biological activity of ADM by nearly 100%, by at least greater than 90%, and preferably by at least greater than 95%.

[0125] In contrast, a non-neutralizing anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold blocks the biological activity of ADM by less than 100%, preferably less than 95%, preferably less than 90%, more preferably less than 80%, and even more preferably less than 50%. This means that the biological activity of ADM is reduced by less than 100%, by 95% or less, by 90% or less, by 80% or less, or by 50% or less. This means that the residual biological activity of ADM bound to a non-neutralizing anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold will be greater than 0%, preferably greater than 5%, preferably greater than 10%, more preferably greater than 20%, and more preferably greater than 50%.

[0126] In this context, (a) a molecule that is an antibody, or antibody fragment, or non-Ig scaffold, that has "non-neutralizing anti-ADM activity" will be collectively referred to herein for simplicity as a "non-neutralizing" anti-ADM antibody, antibody fragment, or non-Ig scaffold that blocks, e.g., the biological activity of ADM by less than 80%, ADM-binding molecule or molecules that, when added to a culture of a eukaryotic cell line expressing a functional human recombinant ADM receptor composed of calcitonin receptor-like receptor (CRLR) and receptor-activity modifying protein 3 (RAMP3), reduce the amount of cAMP produced by the cell line through the action of a human synthetic ADM peptide added in parallel, where the added human synthetic ADM is added in an amount that results in half-maximal stimulation of cAMP synthesis in the absence of the non-neutralizing antibody being analyzed, and where the reduction of cAMP by the ADM-binding molecule occurs to an extent of 80% or less even when the non-neutralizing molecule that binds to the ADM being analyzed is added in an amount 10-fold greater than the amount required to achieve the maximal reduction of cAMP synthesis obtainable with the non-neutralizing antibody being analyzed.

[0127] The same definition applies to other ranges, such as 95%, 90%, 50%, etc.

[0128] An antibody or fragment thereof according to the present invention is a protein comprising one or more polypeptides substantially encoded by immunoglobulin genes that specifically bind to an antigen. Recognized immunoglobulin genes include the kappa, lambda, alpha (IgA), gamma (IgG1, IgG2, IgG3, IgG4), delta (IgD), epsilon (IgE), and mu (IgM) constant region genes, as well as the myriad immunoglobulin variable region genes. Full-length immunoglobulin light chains are generally about 25 Kd or 214 amino acids in length.

[0129] A full-length immunoglobulin heavy chain is generally about 50 Kd or 446 amino acids in length. Light chains are encoded by a variable region gene (about 110 amino acids in length) at the NH2-terminus and a kappa or lambda constant region gene at the COOH-terminus. Heavy chains are similarly encoded by a variable region gene (about 116 amino acids in length) and one of the other constant region genes.

[0130] The basic structural unit of an antibody is generally a tetramer of two identical pairs of immunoglobulin chains, each pair having one light and one heavy chain, in which the light and heavy chain variable regions bind to an antigen and the constant regions mediate effector functions. Immunoglobulins also exist in a variety of other forms, including, for example, Fv, Fab, and (Fab')2, as well as bifunctional hybrid antibodies and single chains (e.g., Lanzavecchia et al. 1987. Eur. J. Immunol. 17:105; Huston et al. 1988. Proc. Natl. Acad. Sci. USA, 85:5879-5883; Bird et al. 1988. Science 242:423-426; Hood et al. 1984, Immunology, Benjamin, NY, 2nd ed.; Hunkapiller and Hood 1986. Nature 323:15-16). An immunoglobulin light or heavy chain variable region contains a framework region interrupted by three hypervariable regions, also called complementarity determining regions (CDRs) (see Sequences of Proteins of Immunological Interest, E. Kabat et al. 1983, USDapartment of Health and Human Services). As noted above, the CDRs are primarily responsible for binding to an epitope of an antigen. The immune complex is an antibody, such as a monoclonal, chimeric, humanized, or human antibody, or a functional antibody fragment, that specifically binds to the antigen.

[0131] Chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from immunoglobulin variable and constant region genes belonging to different species. For example, variable segments from genes from a mouse monoclonal antibody can be linked to human constant segments, such as kappa and gamma 1 or gamma 3. Thus, in one example, a therapeutic chimeric antibody is a hybrid protein composed of variable or antigen-binding domains from a mouse antibody and constant or effector domains from a human antibody, although other mammalian species can be used or the variable regions can be produced by molecular techniques. Methods for producing chimeric antibodies are well known in the art; see, for example, U.S. Pat. No. 5,807,715. A "humanized" immunoglobulin is an immunoglobulin containing a human framework region and one or more CDRs from a non-human (e.g., mouse, rat, or synthetic) immunoglobulin. The non-human immunoglobulin providing the CDRs is referred to as the "donor," and the human immunoglobulin providing the framework is referred to as the "acceptor." In one embodiment, all CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if present, they should be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, e.g., about 95% or more identical. Thus, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of a natural human immunoglobulin sequence. A "humanized antibody" is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. A humanized antibody binds to the same antigen as the donor antibody that provides the CDRs. The acceptor framework of a humanized immunoglobulin or antibody may have a limited number of substitutions with amino acids taken from the donor framework. Humanized or other monoclonal antibodies may have additional conservative amino acid substitutions that have substantially no effect on antigen binding or other immunoglobulin functions. Exemplary conservative substitutions are substitutions such as gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; and phe, tyr.Humanized immunoglobulins can be constructed using genetic engineering (see, e.g., U.S. Pat. No. 5,585,089). Human antibodies are antibodies whose light and heavy chain genes are of human origin. Human antibodies can be generated using methods known in the art. Human antibodies can be produced by immortalizing human B cells secreting the antibody of interest. Immortalization can be achieved, for example, by EBV infection or by fusing human B cells with myeloma or hybridoma cells to produce trioma cells. Human antibodies can also be produced by phage display methods (see, e.g., WO 91 / 17271, WO 92 / 001047, WO 92 / 20791) and can be selected from human combinatorial monoclonal antibody libraries (see the Morphosys website). Human antibodies can also be prepared by using transgenic animals carrying human immunoglobulin genes (see, eg, WO 93 / 12227, WO 91 / 10741).

[0132] Thus, the anti-ADM antibody may have any format known in the art, such as a human antibody, a monoclonal antibody, a humanized antibody, a chimeric antibody, or a CDR-grafted antibody. In a preferred embodiment, the antibody according to the invention is an antibody fragment containing at least the F variable domain of the heavy and / or light chain, such as, for example, a recombinantly produced antibody such as an IgG, a typical full-length immunoglobulin, or, for example, but not limited to, a Fab minibody, a single-chain Fab antibody, a monovalent Fab antibody with an epitope tag, e.g., Fab-V5Sx2; a bivalent Fab (miniantibody) dimerized with a CH3 domain; a bivalent Fab or multivalent Fab formed, for example, via multimerization utilizing heterologous domains, e.g., via dimerization of dHLX domains, e.g., Fab-dHLX-FSx2; F(ab')2 fragments, scFv fragments, multimerized multivalent and / or multispecific scFv fragments, bivalent and / or bispecific diabodies, BITE® (bispecific T cell engager), trifunctional antibodies, e.g., multivalent antibodies from different classes other than G; single domain antibodies, e.g., chemically coupled antibodies (fragment antigen binding) comprising Fab fragments, including nanobodies derived from camelid or fish immunoglobulins and many others.

[0133] In addition to anti-ADM antibodies, other biopolymer scaffolds are known in the art to conjugate target molecules and have been used to generate highly target-specific biopolymers. Examples include aptamers, spiegelmers, anticalins, and conotoxins. See Figures 1a, 1b, and 1c for illustrations of antibody formats.

[0134] In a preferred embodiment, the anti-ADM antibody format is selected from the group comprising Fv fragments, scFv fragments, Fab fragments, scFab fragments, F(ab)2 fragments, and scFv-Fc fusion proteins. In another preferred embodiment, the antibody format is selected from the group comprising scFab fragments, Fab fragments, scFv fragments, and bioavailability-optimized conjugates thereof, such as PEGylated fragments. One of the most preferred formats is the scFab format.

[0135] Non-Ig scaffolds can be protein scaffolds that can bind to ligands or antigens and thus can be used as antibody mimics. Non-Ig scaffolds include tetranectin-based non-Ig scaffolds (e.g., as described in U.S. Patent Application Publication No. 2010 / 0028995), fibronectin scaffolds (e.g., as described in European Patent Application Publication No. 1266025), lipocalin-based scaffolds (e.g., as described in WO 2011 / 154420), ubiquitin scaffolds (e.g., as described in WO 2011 / 073214), transferrin scaffolds (e.g., as described in U.S. Patent Application Publication No. 2004 / 0023334), protein A scaffolds (e.g., as described in European Patent Application Publication No. 2231860), ankyrin repeat-based scaffolds (e.g., as described in WO 2010 / 060748), microprotein (preferably cysteine knot-forming microprotein) scaffolds (e.g., as described in European Patent Application Publication No. 2314308), Fyn They may be selected from the group including SH3 domain-based scaffolds (e.g., as described in WO 2011 / 023685), EGFR-A domain-based scaffolds (e.g., as described in WO 2005 / 040229), and Kunitz domain-based scaffolds (e.g., as described in EP 1941867).

[0136] In one embodiment of the present invention, anti-ADM antibodies according to the invention can be produced by synthesizing a fragment of ADM as an antigen, as outlined in Example 1. Binders to the fragment are then identified using the methods described below or other methods known in the art.

[0137] Humanization of a murine antibody can be performed according to the following procedure: For humanization of antibodies of murine origin, the antibody sequence is analyzed for the structural interactions of the complementarity-determining regions (CDRs) and framework regions (FRs) with the antigen. Based on structural modeling, appropriate FRs of human origin are selected, and the murine CDR sequences are grafted onto the human FRs. Mutations in the amino acid sequences of the CDRs or FRs can be introduced to restore structural interactions lost due to species conversion to the FR sequences. This restoration of structural interactions can be achieved by a random approach using a phage display library or through a directed approach guided by molecular modeling (Almagro and Fransson 2008. Humanization of antibodies. Front Biosci. 2008 Jan 1;13:1619-33).

[0138] In a preferred embodiment, the ADM antibody format is selected from the group comprising Fv fragments, scFv fragments, Fab fragments, scFab fragments, F(ab)2 fragments, and scFv-Fc fusion proteins. In another preferred embodiment, the antibody format is selected from the group comprising scFab fragments, Fab fragments, scFv fragments, and bioavailability-optimized conjugates thereof, such as PEGylated fragments. One of the most preferred formats is the scFab format.

[0139] In another preferred embodiment, the anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold is a full-length antibody, antibody fragment, or non-Ig scaffold.

[0140] In a preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non-Ig scaffold is directed against and capable of binding to an epitope of at least 5 amino acids in length contained in ADM.

[0141] In a more preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non-Ig scaffold is directed against and capable of binding to an epitope of at least 4 amino acids in length contained in ADM.

[0142] In one particular embodiment of the invention, the anti-ADM antibody or anti-ADM antibody fragment that binds to adrenomedullin, or the anti-ADM non-Ig scaffold that binds to adrenomedullin, is not ADM binding protein 1 (complement factor H).

[0143] In one specific embodiment of the invention, the anti-ADM antibody or anti-ADM antibody fragment that binds to adrenomedullin, or the anti-ADM non-Ig scaffold that binds to adrenomedullin, binds to a region of preferably at least four, or at least five, amino acids within the sequence of mature human ADM: YRQSMNNFQGLRSFGCRFGTC, amino acids 1 to 21 of SEQ ID NO: 14.

[0144] In a preferred embodiment of the invention, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold binds to a region or epitope of ADM located in the N-terminal portion (amino acids 1-21) of adrenomedullin.

[0145] In another preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1 to 14 of adrenomedullin:YRQSMNNFQGLRSF (SEQ ID NO: 25), which refers to the N-terminal portion (amino acids 1 to 14) of adrenomedullin.

[0146] In another preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1 to 10 of adrenomedullin:YRQSMNNFQG (SEQ ID NO: 26), which refers to the N-terminal portion (amino acids 1 to 10) of adrenomedullin.

[0147] In another preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold recognizes and binds to a region or epitope within amino acids 1-6 of adrenomedullin:YRQSMN (SEQ ID NO:27), which refers to the N-terminal portion (amino acids 1-6) of adrenomedullin. As specified above, the region or epitope preferably comprises at least 4 or at least 5 amino acids in length.

[0148] In another preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold recognizes and binds to the N-terminus (amino acid 1) of adrenomedullin. N-terminus means that amino acid 1, which is "Y" in SEQ ID NO: 20, 14, or 23, respectively, is essential for binding. The antibody, or fragment, or scaffold will not bind to either N-terminally extended or N-terminally modified adrenomedullin or N-terminally degraded adrenomedullin. This means that, in another preferred embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold will only bind to a region within the sequence of mature ADM when the N-terminus of ADM is free. In this embodiment, the anti-ADM antibody, or anti-ADM antibody fragment, or non-Ig scaffold will not bind to a region within the sequence of mature ADM when that sequence is contained, for example, in pro-ADM.

[0149] For clarity, numbers in parentheses for specific regions of ADM, such as "N-terminal portion (amino acids 1-21)," will be understood by those skilled in the art to mean that the N-terminal portion of ADM consists of amino acids 1-21 of the mature ADM sequence.

[0150] In another specific embodiment according to the invention, the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold provided herein does not bind to the C-terminal portion of ADM, i.e., amino acids 43-52 of ADM:PRSKISPQGY-NH2 (SEQ ID NO: 24).

[0151] In one particular embodiment, it is preferred to use an anti-ADM antibody, or an anti-ADM antibody fragment, or an anti-ADM non-Ig scaffold according to the present invention, which results in an increase of at least 10%, preferably at least 50%, more preferably >50%, and most preferably >100% in ADM levels or ADM immunoreactivity in serum, blood, or plasma.

[0152] In one particular embodiment, it is preferable to use an anti-ADM antibody, or an anti-ADM antibody fragment, or an anti-ADM non-Ig scaffold according to the present invention, and the anti-ADM antibody, or the anti-ADM antibody fragment, or the anti-ADM non-Ig scaffold has a half-life (t 1 / 2 ; half-retention time) by at least 10%, preferably at least 50%, more preferably >50%, and most preferably >100%.

[0153] The half-life (half-retention time) of ADM can be determined in human serum, blood, or plasma in the absence and presence of an ADM-stabilized antibody, or an ADM-stabilized antibody fragment, or an ADM-stabilized non-Ig scaffold, respectively, using an immunoassay for quantification of ADM.

[0154] The following steps may be performed: -ADM may be diluted in human citrated plasma in the absence and presence of an ADM-stabilizing antibody, or an ADM-stabilizing antibody fragment, or an ADM-stabilizing non-Ig scaffold, respectively, and incubated at 24°C. - Aliquots may be taken at selected time points (eg, within 24 hours) and degradation of ADM may be arrested in the aliquots by freezing at -20°C. If the selected assay is not affected by the stabilizing antibody, the amount of ADM can be determined directly by hADM immunoassay. Alternatively, an aliquot can be treated with a denaturing agent (such as HCl), and after the sample is clarified (e.g., by centrifugation), the pH can be neutralized and ADM can be quantified by ADM immunoassay. Alternatively, non-immunoassay techniques (e.g., RP-HPLC) can be used for ADM quantification. - The half-life of ADM is calculated for ADM incubated in the absence and presence of an ADM-stabilized antibody, or an ADM-stabilized antibody fragment or an ADM-stabilized non-Ig scaffold, respectively. - The half-life enhancement is calculated for the stabilized ADM compared to ADM that has been incubated in the absence of the ADM-stabilized antibody, or ADM-stabilized antibody fragment, or ADM-stabilized non-Ig scaffold.

[0155] A two-fold increase in the half-life of ADM is a 100% half-life enhancement. Half-life (half retention time) is defined as the period of time it takes for the concentration of a particular chemical or drug to fall to half of its baseline concentration in a particular fluid or blood. An assay that can be used to determine the half-life (half retention time) of adrenomedullin in serum, blood, or plasma is described in Example 3.

[0156] In preferred embodiments, the anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold is a non-neutralizing antibody, fragment, or scaffold. A neutralizing anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold will block the biological activity of ADM by nearly 100%, at least by more than 90%, and preferably by at least more than 95%. In other words, this means that the non-neutralizing anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold blocks the biological activity of ADM by less than 100%, preferably less than 95%, and preferably less than 90%. In embodiments in which the non-neutralizing anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold blocks the biological activity of ADM by less than 95%, anti-ADM antibodies, anti-ADM antibody fragments, or anti-ADM non-Ig scaffolds that would block the biological activity of ADM by more than 95% would be outside the scope of the embodiment. This means that in one embodiment the biological activity is reduced by 95% or less, preferably by 90% or less, more preferably by 80% or less, more preferably by 50% or less.

[0157] In one embodiment of the present invention, the non-neutralizing antibody is an antibody that binds to a region of at least five amino acids within the sequence of amino acids 1 to 21 of mature human ADM (SEQ ID NO: 14), or an antibody that binds to a region of at least five amino acids within the sequence of amino acids 1 to 19 of mature mouse ADM (SEQ ID NO: 17).

[0158] In another preferred embodiment of the present invention, the non-neutralizing antibody is an antibody that binds to a region of at least four amino acids within the sequence of amino acids 1 to 21 of mature human ADM (SEQ ID NO: 14), or an antibody that binds to a region of at least five amino acids within the sequence of amino acids 1 to 19 of mature mouse ADM (SEQ ID NO: 17).

[0159] In certain embodiments according to the present invention, a non-neutralizing anti-ADM antibody, or an anti-ADM antibody fragment, or an ADM non-Ig scaffold is used, which blocks ADM biological activity to less than 80% (of baseline values), preferably less than 50%. It should be understood that such limited blocking (meaning reduced biological activity) of ADM biological activity occurs even at excessive antibody, fragment, or scaffold concentrations, i.e., even when the antibody, fragment, or scaffold is in excess relative to ADM. Such limited blocking is an inherent property of the ADM-binding agent itself in certain embodiments. This means that the antibody, fragment, or scaffold has a maximum inhibition of 80% or 50%, respectively. In preferred embodiments, the anti-ADM antibody, anti-ADM antibody fragment, or anti-ADM non-Ig scaffold will block / reduce anti-ADM biological activity by at least 5%. This means that approximately 20%, 50%, or even 95% residual ADM biological activity remains, respectively.

[0160] Thus, in accordance with the present invention, the anti-ADM antibodies, anti-ADM antibody fragments, and anti-ADM non-Ig scaffolds provided do not neutralize the respective ADM biological activity.

[0161] Biological activity is defined as the effect that a substance has on a living organism, tissue, organ, or functional unit in vivo or in vitro (e.g., in an assay) after its interaction. In the case of ADM biological activity, this can be the effect of ADM in a human recombinant ADM receptor cAMP functional assay. Thus, according to the present invention, biological activity is defined by an ADM receptor cAMP functional assay. The following steps can be performed to determine the biological activity of ADM in such an assay: - A dose response curve is performed with ADM in the human recombinant ADM receptor cAMP functional assay. -The ADM concentration for half-maximal cAMP stimulation may be calculated. At a constant half-maximal cAMP-stimulating ADM concentration, dose-response curves (up to 100 μg / ml final concentration) are performed with ADM-stabilized antibodies, or ADM-stabilized antibody fragments or ADM-stabilized non-Ig scaffolds, respectively.

[0162] A 50% maximal inhibition in the ADM bioassay means that the anti-ADM antibody, or the anti-ADM antibody fragment, or the anti-ADM non-Ig scaffold, respectively, blocks ADM biological activity to 50% of the baseline value. A 80% maximal inhibition in the ADM bioassay means that the anti-ADM antibody, or the anti-ADM antibody fragment, or the anti-ADM non-Ig scaffold, respectively, blocks ADM biological activity by 80%. This means that ADM biological activity is blocked by 80% or less. This means that approximately 20% residual ADM biological activity remains.

[0163] However, as used herein and in connection with the above, the phrase "blocking the biological activity of ADM" with respect to the anti-ADM antibodies, anti-ADM antibody fragments, and anti-ADM non-Ig scaffolds disclosed herein should be understood as simply reducing the biological activity of ADM from 100% to a maximum of 20% of the remaining ADM biological activity, preferably reducing the ADM biological activity from 100% to 50% of the remaining ADM biological activity. However, in either case, there will be residual ADM biological activity, which can be determined as detailed above. The biological activity of ADM can be determined in a human recombinant ADM receptor cAMP functional assay (adrenomedullin bioassay) according to Example 2.

[0164] In a preferred embodiment, the regulatory anti-ADM antibody, or regulatory anti-ADM antibody fragment or regulatory anti-ADM non-Ig scaffold is used in the therapy or prevention of shock in a patient.

[0165] The "modulating" anti-ADM antibody, or modulating anti-ADM antibody fragment or modulating anti-ADM non-Ig scaffold, has a half-life (t 1 / 2The anti-ADM antibody, antibody fragment, or non-Ig scaffold will block ADM biological activity by at least 5%. These values relating to half-life and blocking biological activity must be understood in relation to the assays described above to determine these values. This means blocking ADM biological activity by 80% or less or 50% or less, respectively.

[0166] Such regulatory anti-ADM antibodies, or regulatory anti-ADM antibody fragments, or regulatory anti-ADM non-Ig scaffolds offer the advantage of easier administration. The combination of partial blocking or partial reduction of ADM biological activity and increased in vivo half-life (increased ADM biological activity) provides a beneficial simplification of anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold dosing. In situations of excessive endogenous ADM (maximum stimulation, late sepsis, shock, low vitality phase), the activity-reducing effect is the primary influence of the antibody, fragment, or scaffold, limiting the (negative) effects of ADM. In the case of low or normal endogenous ADM concentrations, the biological effect of the anti-ADM antibody, or anti-ADM antibody fragment, or anti-ADM non-Ig scaffold is a combination of reducing (by partial blocking) and increasing ADM half-life. Thus, non-neutralizing and regulatory anti-ADM antibodies, or anti-ADM antibody fragments or anti-ADM non-Ig scaffolds, act like ADM bioactivity buffers to maintain the bioactivity of ADM within a certain physiological range.

[0167] In certain embodiments of the invention, the antibody is a monoclonal antibody or a fragment thereof. In one embodiment of the invention, the anti-ADM antibody or anti-ADM antibody fragment is or is derived from a human or humanized antibody. In one particular embodiment, one or more (murine) CDRs are grafted onto a human antibody or antibody fragment.

[0168] The subject of the present invention is in one aspect a human or humanized CDR-grafted antibody or antibody fragment thereof that binds to ADM, the human or humanized CDR-grafted antibody or antibody fragment thereof comprising an antibody heavy chain (H chain) comprising: GYTFSRYW (SEQ ID NO: 1), ILPGSGST (SEQ ID NO: 2), and / or TEGYEYDGFDY (SEQ ID NO: 3) and / or an antibody light chain (L chain) comprising: QSIVYSNGNTY (SEQ ID NO: 4), RVS (not part of the sequence listing), and / or FQGSHIPYT (SEQ ID NO: 5).

[0169] In one particular embodiment of the present invention, the subject of the present invention is a human or humanized monoclonal antibody that binds to ADM, or an antibody fragment thereof that binds to ADM, wherein the heavy chain comprises at least one CDR selected from the group comprising: GYTFSRYW (SEQ ID NO: 1), ILPGSGST (SEQ ID NO: 2), TEGYEYDGFDY (SEQ ID NO: 3) The light chain comprises at least one CDR selected from the group comprising: QSIVYSNGNTY (SEQ ID NO: 4), RVS (not part of the sequence listing), FQGSHIPYT (SEQ ID NO: 5).

[0170] In a more particular embodiment of the present invention, the subject of the present invention is a human monoclonal antibody that binds to ADM or an antibody fragment thereof that binds to ADM, the heavy chain comprising the following sequence: GYTFSRYW (SEQ ID NO: 1), ILPGSGST (SEQ ID NO: 2), TEGYEYDGFDY (SEQ ID NO: 3) The light chain comprises the following sequence: QSIVYSNGNTY (SEQ ID NO: 4), RVS (not part of the sequence listing), FQGSHIPYT (SEQ ID NO: 5).

[0171] In very particular embodiments, the anti-ADM antibody has a sequence selected from the group comprising SEQ ID NOs: 6, 7, 8, 9, 10, 11, 12, 13, 32, and 33.

[0172] The anti-ADM antibody, or anti-ADM antibody fragment or anti-ADM non-Ig scaffold according to the present invention has an affinity constant of 10 -7 Greater than M, preferably 10 -8 M, with a preferred affinity of 10 -9 greater than M, most preferably 10 -10 The affinity for human ADM is greater than M. Those skilled in the art will know that the lower affinity can be compensated for by applying a higher dose of the compound, and this approach would not fall outside the scope of the present invention. The affinity constant can be determined according to the method described in Example 1.

[0173] A subject of the present invention is a human or humanized monoclonal antibody or fragment thereof that binds to ADM, for use in the therapy or prevention of shock in a patient according to the invention, said antibody or fragment comprising a sequence selected from the group comprising: Sequence number 6 (AM-VH-C) SEQ ID NO: 7 (AM-VH1) SEQ ID NO: 8 (AM-VH2-E40) SEQ ID NO: 9 (AM-VH3-T26-E55) SEQ ID NO: 10 (AM-VH4-T26-E40-E55) SEQ ID NO: 11 (AM-VL-C) SEQ ID NO: 12 (AM-VL1) SEQ ID NO: 13 (AM-VL2-E40)

[0174] Another embodiment of the present invention relates to a human or humanized monoclonal antibody or fragment or antibody fragment thereof that binds to ADM for use in the therapy or prevention of shock in a patient, wherein the antibody or fragment comprises as its heavy chain the following sequence: SEQ ID NO: 32 The light chain contains the following sequence: SEQ ID NO: 33 .

[0175] In a particular embodiment of the invention, the antibody has the following sequence as the heavy chain: SEQ ID NO: 32 or a sequence that is >95% identical thereto, preferably >98%, preferably >99%, and which comprises as the light chain the following sequence: SEQ ID NO: 33 or a sequence >95% identical thereto, preferably >98%, preferably >99%, wherein the heavy chain comprises the sequence: CDR1: SEQ ID NO: 1 GYTFSRYW CDR2: SEQ ID NO: 2 ILPGSGST CDR3: SEQ ID NO: 3 TEGYEYDGFDY The light chain comprises the following sequence: CDR1: SEQ ID NO: 4 QSIVYSNGNTY CDR2: RVS CDR3: SEQ ID NO: 5 FQGSHIPYT.

[0176] This means that in one embodiment of the present invention, the CDRs do not exhibit any variation in sequence. Any variation in the above sequences is outside the CDRs in that embodiment.

[0177] To assess identity between two amino acid sequences, a pairwise alignment is performed, with identity defined as the percentage of amino acids in the alignment that have direct matches.

[0178] An epitope, also known as an antigenic determinant, is the part of an antigen that is recognized by the immune system, especially by antibodies. For example, an epitope is the specific piece of an antigen that an antibody binds to. The part of an antibody that binds to an epitope is called a paratope. Epitopes of protein antigens are classified into two categories based on their structure and interaction with the paratope: conformational epitopes and linear epitopes.

[0179] Conformational and linear epitopes interact with the paratope based on the 3-D conformation adopted by the epitope, determined by the surface characteristics of the involved epitope residues and the shape or tertiary structure of other segments of the antigen. Conformational epitopes are formed by the 3-D conformation adopted by the interaction of non-contiguous amino acid residues. A linear or continuous epitope is an epitope recognized by an antibody by its linear sequence or primary structure of amino acids and formed by the 3-D conformation adopted by the interaction of adjacent amino acid residues.

[0180] One embodiment of the present invention relates to a method for prediction of increased DPP3 in critically ill patients, wherein the patient is selected for therapy / treatment with a DPP3 inhibitor if the level of DPP3 in said sample is above said predetermined threshold.

[0181] One embodiment of the present invention relates to a method for the prevention of DPP3 elevation in a critically ill patient, wherein a DPP3 inhibitor is administered when the level of DPP3 in said sample is above a predetermined threshold.

[0182] One embodiment of the present invention relates to a DPP3 inhibitor for use in preventing DPP3 increase in critically ill patients, the patients having levels of DPP3 above a threshold.

[0183] In another particular embodiment of the invention, the DPP3 inhibitor is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment or an anti-DPP3 scaffold.

[0184] In another specific embodiment of the invention, the inhibitor is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment, or an anti-DPP3 scaffold that binds to a region or epitope of DPP3 that is at least 4-5 amino acids in length contained within SEQ ID NO:36.

[0185] In another specific embodiment of the invention, the inhibitor is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment, or an anti-DPP3 scaffold that binds to a region or epitope of DPP3 that is at least 4-5 amino acids in length contained within SEQ ID NO:37.

[0186] In another preferred embodiment of the invention, the inhibitor is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment or an anti-DPP3 scaffold, that binds to a region or epitope of DPP3 located in SEQ ID NO:38.

[0187] In another preferred embodiment of the invention, the anti-DPP3 antibody, or anti-DPP3 antibody fragment, or anti-DPP3 scaffold, binds to a region or epitope of DPP3 located in SEQ ID NO:39.

[0188] In another particular embodiment of the invention, the inhibitor is -7 an anti-DPP3 antibody, or an anti-DPP3 antibody fragment or an anti-DPP3 scaffold, that exhibits a minimal binding affinity to DPP3 of M or less.

[0189] In another specific embodiment of the invention, the inhibitor is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment or an anti-DPP3 scaffold, which inhibits at least 10%, or at least 50%, more preferably at least 60%, even more preferably more than 70%, even more preferably more than 80%, even more preferably more than 90%, and even more preferably more than 95% of the activity of DPP3.

[0190] In another particular embodiment of the invention, the antibody is a monoclonal antibody or a monoclonal antibody fragment.

[0191] In another particular embodiment of the invention, the inhibitor is a monoclonal anti-DPP3 antibody or anti-DPP3 antibody fragment, wherein the complementarity determining regions (CDRs) in the heavy chain comprise the following sequence: SEQ ID NO: 42, SEQ ID NO: 43, and / or SEQ ID NO: 44 The complementarity determining regions (CDRs) in the light chain comprise the following sequences: SEQ ID NO:45, KVS, and / or SEQ ID NO:46.

[0192] In another particular embodiment of the invention, the inhibitor is a monoclonal anti-DPP3 antibody or anti-DPP3 antibody fragment, and the monoclonal antibody or antibody fragment is a humanized monoclonal antibody or humanized monoclonal antibody fragment.

[0193] In another particular embodiment of the invention, the inhibitor is a humanized monoclonal anti-DPP3 antibody or anti-DPP3 antibody fragment, wherein the heavy chain comprises the following sequence: SEQ ID NO: 40 The light chain comprises the following sequence: Sequence number 41.

[0194] In another particular embodiment of the invention, the inhibitor is a humanized monoclonal anti-DPP3 antibody or anti-DPP3 antibody fragment, wherein the heavy chain consists of the following sequence: SEQ ID NO: 47 The light chain consists of the following sequence: Sequence number 48.

[0195] Procizumab, a humanized monoclonal IgG1 antibody with a heavy chain consisting of the sequence of SEQ ID NO: 47 and a light chain consisting of the sequence of SEQ ID NO: 48, specifically binds to circulating DPP3 and targets and regulates DPP3 activity, an essential regulator of cardiovascular function. Its mode of action is relevant to acute diseases associated with massive cell death and uncontrolled release of intracellular DPP3 into the bloodstream. Translocated DPP3 remains active in the circulation, where DPP3 cleaves bioactive peptides in an uncontrolled manner. Procizumab can block circulating DPP3 and inhibit the degradation of bioactive peptides in the bloodstream. This blockade results in stabilization of cardiovascular and renal function and reduced short-term mortality. As shown in the Examples section, preclinical studies of procizumab in animal models of cardiovascular failure have demonstrated impressive and immediate efficacy. For example, injection of procizumab in rats with shock-induced cardiovascular failure resulted in immediate normalization of shortening. In several preclinical models of cardiovascular failure, prolactin has been shown to improve all clinically relevant endpoints in vivo: it normalizes ejection fraction and renal function and reduces mortality.

[0196] Throughout this specification, an "antibody", or "antibody fragment" or "scaffold" according to the present invention is capable of binding to DPP3 and is therefore directed against DPP3, and may therefore be referred to as an "anti-DPP3 antibody", an "anti-DPP3 antibody fragment", or an "anti-DPP3 scaffold".

[0197] The term "antibody" generally includes monoclonal and polyclonal antibodies and their binding fragments, particularly Fc fragments, as well as so-called "single-chain antibodies" (Bird et al. 1988), chimeric, humanized, particularly CDR-grafted antibodies, and diabodies or tetrabodies (Holliger et al. 1993). Also included are immunoglobulin-like proteins selected through techniques including phage display that specifically bind to a molecule of interest contained in a sample. In this context, the term "specific binding" refers to an antibody generated against a molecule of interest or a fragment thereof. An antibody is considered specific if its affinity for the molecule of interest or a fragment thereof is preferably at least 50-fold higher, more preferably 100-fold higher, and most preferably at least 1000-fold higher than for other molecules contained in a sample containing the molecule of interest. Methods for generating antibodies and selecting antibodies with a given specificity are well known in the art.

[0198] In one embodiment of the present invention, the anti-DPP3 antibody, or anti-DPP3 antibody fragment or anti-DPP3 non-Ig scaffold is monospecific.

[0199] A monospecific anti-DPP3 antibody, or a monospecific anti-DPP3 antibody fragment, or a monospecific anti-DPP3 non-Ig scaffold means that the antibody, or antibody fragment, or non-Ig scaffold binds to one specific region encompassing at least 5 amino acids within the target DPP3 (SEQ ID NO: 36). A monospecific anti-DPP3 antibody, or a monospecific anti-DPP3 antibody fragment, or a monospecific anti-DPP3 non-Ig scaffold is an anti-DPP3 antibody, or an anti-DPP3 antibody fragment, or an anti-DPP3 non-Ig scaffold that all have affinity for the same antigen. While monoclonal antibodies are monospecific, monospecific antibodies can also be produced by means other than producing them from a common germline.

[0200] An antibody or fragment thereof according to the present invention is a protein comprising one or more polypeptides substantially encoded by immunoglobulin genes that specifically bind to an antigen. Recognized immunoglobulin genes include the kappa, lambda, alpha (IgA), gamma (IgG1, IgG2, IgG3, IgG4), delta (IgD), epsilon (IgE), and mu (IgM) constant region genes, as well as the myriad immunoglobulin variable region genes. Full-length immunoglobulin light chains are generally about 25 Kd or 214 amino acids in length.

[0201] A full-length immunoglobulin heavy chain is generally about 50 Kd or 446 amino acids in length. Light chains are encoded by a variable region gene (about 110 amino acids in length) at the NH2-terminus and a kappa or lambda constant region gene at the COOH-terminus. Heavy chains are similarly encoded by a variable region gene (about 116 amino acids in length) and one of the other constant region genes.

[0202] The basic structural unit of an antibody is generally a tetramer of two identical pairs of immunoglobulin chains, each pair having one light and one heavy chain, in which the light and heavy chain variable regions bind to an antigen and the constant regions mediate effector functions. Immunoglobulins also exist in a variety of other forms, including, for example, Fv, Fab, and (Fab')2, as well as bifunctional hybrid antibodies and single chains (e.g., Lanzavecchia et al. 1987. Eur. J. Immunol. 17:105; Huston et al. 1988. Proc. Natl. Acad. Sci. USA, 85:5879-5883; Bird et al. 1988. Science 242:423-426; Hood et al. 1984, Immunology, Benjamin, NY, 2nd ed.; Hunkapiller and Hood 1986. Nature 323:15-16). An immunoglobulin light or heavy chain variable region contains a framework region interrupted by three hypervariable regions, also called complementarity-determining regions (CDRs) (see Sequences of Proteins of Immunological Interest, E. Kabat et al. 1983, USDapartment of Health and Human Services). As noted above, the CDRs are primarily responsible for binding to an epitope of an antigen. The immune complex is an antibody, such as a monoclonal, chimeric, humanized, or human antibody, or a functional antibody fragment, that specifically binds to the antigen.

[0203] Chimeric antibodies are antibodies whose light and heavy chain genes have been constructed, typically by genetic engineering, from immunoglobulin variable and constant region genes belonging to different species. For example, variable segments from genes from a mouse monoclonal antibody can be linked to human constant segments, such as kappa and gamma 1 or gamma 3. Thus, in one example, a therapeutic chimeric antibody is a hybrid protein composed of variable or antigen-binding domains from a mouse antibody and constant or effector domains from a human antibody, although other mammalian species can be used or the variable regions can be produced by molecular techniques. Methods for producing chimeric antibodies are well known in the art; see, for example, U.S. Pat. No. 5,807,715. A "humanized" immunoglobulin is an immunoglobulin containing a human framework region and one or more CDRs from a non-human (e.g., mouse, rat, or synthetic) immunoglobulin. The non-human immunoglobulin providing the CDRs is referred to as the "donor," and the human immunoglobulin providing the framework is referred to as the "acceptor." In one embodiment, all CDRs are from the donor immunoglobulin in a humanized immunoglobulin. Constant regions need not be present, but if present, they should be substantially identical to human immunoglobulin constant regions, i.e., at least about 85-90%, e.g., about 95% or more identical. Thus, all parts of a humanized immunoglobulin, except possibly the CDRs, are substantially identical to corresponding parts of a natural human immunoglobulin sequence. A "humanized antibody" is an antibody comprising a humanized light chain and a humanized heavy chain immunoglobulin. A humanized antibody binds to the same antigen as the donor antibody that provides the CDRs. The acceptor framework of a humanized immunoglobulin or antibody may have a limited number of substitutions with amino acids taken from the donor framework. Humanized or other monoclonal antibodies may have additional conservative amino acid substitutions that have substantially no effect on antigen binding or other immunoglobulin functions. Exemplary conservative substitutions are substitutions such as gly, ala; val, ile, leu; asp, glu; asn, gln; ser, thr; lys, arg; and phe, tyr.Humanized immunoglobulins can be constructed using genetic engineering (see, e.g., U.S. Pat. No. 5,585,089). Human antibodies are antibodies whose light and heavy chain genes are of human origin. Human antibodies can be generated using methods known in the art. Human antibodies can be produced by immortalizing human B cells secreting the antibody of interest. Immortalization can be achieved, for example, by EBV infection or by fusing human B cells with myeloma or hybridoma cells to produce trioma cells. Human antibodies can also be produced by phage display methods (see, e.g., WO 91 / 17271, WO 92 / 001047, WO 92 / 20791) and can be selected from human combinatorial monoclonal antibody libraries (see the Morphosys website). Human antibodies can also be prepared by using transgenic animals carrying human immunoglobulin genes (see, eg, WO 93 / 12227, WO 91 / 10741).

[0204] Thus, the anti-DPP3 antibody may have any format known in the art, such as a human antibody, a monoclonal antibody, a humanized antibody, a chimeric antibody, or a CDR-grafted antibody. In a preferred embodiment, the antibody according to the invention is an antibody fragment containing at least the F variable domain of the heavy and / or light chain, such as, for example, a recombinantly produced antibody such as an IgG, a typical full-length immunoglobulin, or, for example, but not limited to, a Fab minibody, a single-chain Fab antibody, a monovalent Fab antibody with an epitope tag, e.g., Fab-V5Sx2; a bivalent Fab (miniantibody) dimerized with a CH3 domain; a bivalent Fab or multivalent Fab formed, for example, via multimerization utilizing heterologous domains, e.g., via dimerization of dHLX domains, e.g., Fab-dHLX-FSx2; F(ab')2 fragments, scFv fragments, multimerized multivalent and / or multispecific scFv fragments, bivalent and / or bispecific diabodies, BITE® (bispecific T cell engager), trifunctional antibodies, e.g., multivalent antibodies from different classes other than G; single domain antibodies, e.g., chemically coupled antibodies (fragment antigen binding) comprising Fab fragments, including nanobodies derived from camelid or fish immunoglobulins and many others.

[0205] In a preferred embodiment, the anti-DPP3 antibody format is selected from the group comprising Fv fragments, scFv fragments, Fab fragments, scFab fragments, F(ab)2 fragments, and scFv-Fc fusion proteins. In another preferred embodiment, the antibody format is selected from the group comprising scFab fragments, Fab fragments, scFv fragments, and bioavailability-optimized conjugates thereof, such as PEGylated fragments. One of the most preferred formats is the scFab format.

[0206] In one embodiment of the present invention, anti-DPP3 antibodies according to the present invention may be produced by synthesizing a fragment of DPP3 or full-length DPP3 as an antigen, as outlined in Example 1. Binders to the fragment are then identified using the methods described below or other methods known in the art.

[0207] Humanization of a murine antibody can be performed according to the following procedure: For humanization of antibodies of murine origin, the antibody sequence is analyzed for the structural interactions of the complementarity-determining regions (CDRs) and framework regions (FRs) with the antigen. Based on structural modeling, appropriate FRs of human origin are selected, and the murine CDR sequences are grafted onto the human FRs. Mutations in the amino acid sequences of the CDRs or FRs can be introduced to restore structural interactions lost due to species conversion to the FR sequences. This restoration of structural interactions can be achieved by a random approach using a phage display library or through a direct approach guided by molecular modeling (Almagro and Fransson 2008. Humanization of antibodies. Front Biosci. 13:1619-33).

[0208] Methods for Obtaining Monoclonal Antibodies In all of the following embodiments, the term monoclonal antibody is meant to include monoclonal antibodies, as well as fragments of monoclonal antibodies, more particularly monoclonal antibodies, such as those detailed herein.

[0209] Hybridoma In a further aspect, the antibody according to the invention comprises: i) fusing antibody-secreting cells from an animal previously immunized with an antigen with myeloma cells to obtain a large number of hybridomas; ii) Monoclonal antibodies obtainable by a method comprising isolating from a large number of hybridomas those hybridomas which produce the desired monoclonal antibody.

[0210] In certain embodiments, antibodies according to the invention are monoclonal antibodies obtainable by isolating hybridomas producing the desired monoclonal antibody from a large number of hybridomas that have been produced by fusing antibody-secreting cells from an animal previously immunized with an antigen with myeloma cells to obtain a large number of hybridomas.

[0211] Specifically, the desired monoclonal antibody is at least 10 7 M -1 , preferably 10 8 M -1 and more preferably, the affinity is 10 9 M -1 greater than 10, most preferably 10 M -1 Greater than.

[0212] In certain embodiments of the method for obtaining an antibody, in step i), the animal is a mammal, in particular a rabbit, a mouse or a rat, more in particular a mouse, more in particular a Balb / c mouse.

[0213] In certain embodiments of the method for obtaining antibodies, in step i), the antibody-secreting cells are splenocytes, more particularly activated B cells.

[0214] In certain embodiments of the method for obtaining an antibody, in step i), the fusing involves the use of polyethylene glycol.

[0215] In certain embodiments of the method for obtaining an antibody, in step i), the myeloma is derived from a mammal, in certain embodiments, from the same species of mammal from which the large number of antibody-secreting cells is obtained. In certain particular embodiments of the method for obtaining an antibody, in step i), the myeloma cells are of the cell line SP2 / 0.

[0216] In certain embodiments of the method for obtaining an antibody, said fusing in step i) comprises PEG-assisted fusion, Sendai virus-assisted fusion, or electric current-assisted fusion.

[0217] In certain embodiments of the method for obtaining an antibody, said isolating in step ii) comprises performing an antibody capture assay, an antigen capture assay, and / or a functional screen.

[0218] In certain embodiments of the method for obtaining antibodies, in step ii), isolating hybridomas producing the desired monoclonal antibodies may involve cloning and recloning the hybridomas using limiting dilution techniques.

[0219] In one embodiment, the antibody capture assay comprises: a) binding the antigen to a substrate, particularly a solid substrate; b) binding the produced antibodies to antigens; c) removing unbound antibody by washing; d) detecting the bound antibody.

[0220] In one embodiment, the antigen capture assay comprises: a) binding the produced antibodies to a substrate, particularly a solid substrate; b) binding of an antigen to the antibody; c) removing unbound antigen by washing; d) detecting the bound antigen; or Alternatively, the antigen capture assay may comprise: a) binding the antigen to the produced antibody to form an antibody-antigen complex; b) binding the antibody-antigen complex to a substrate, particularly a solid substrate; c) removing unbound antigen by washing; d) detecting the bound antigen.

[0221] In one embodiment, said isolating in step ii) comprises performing an enzyme-linked immunosorbent assay, fluorescence-activated cell sorting, cell staining, immunoprecipitation, and / or Western blot.

[0222] In one embodiment, said detecting of antibody or antigen is accomplished using an immunoassay.

[0223] In one embodiment, the animal is a transgenic animal, particularly a transgenic mouse (particularly, in which mouse immunoglobulin (Ig) gene loci have been replaced with human loci within the transgenic animal's genome), e.g., a HuMabMouse or a XenoMouse.

[0224] In one embodiment, the antigen comprises a peptide as set forth herein in Table 1 or Table 6, respectively, which in certain embodiments (particularly for immunization) may be conjugated to a protein, particularly a serum protein, more particularly serum albumin, more particularly BSA.

[0225] In a preferred embodiment, the antibody according to the invention i) fusing cells of splenocytes from Balb / c mice previously immunized with a peptide described in Table 1 or 6 herein with SP2 / 0 myeloma cells using polyethylene glycol to obtain a large number of hybridomas; ii) a monoclonal antibody obtainable by a method comprising isolating from said plurality of hybridomas a hybridoma producing the desired monoclonal antibody; More preferably, the method comprises: Growing the hybridomas in HAT medium (RPMI 1640 culture medium supplemented with 20% fetal bovine serum and HAT supplement) for a first period (specifically, 2 weeks). The HAT medium is then replaced with HT medium for multiple passages (specifically, three times). followed by a return to normal cell culture medium until the end of a second period, specifically three weeks post-fusion. Primary screening of cell culture supernatants for antigen-specific IgG antibodies • Propagating microcultures of cells that tested positive in 4) Retesting the cell culture supernatants of the microcultures for antigen-specific IgG antibodies Cloning and recloning cultures that tested positive in 6) using limiting dilution techniques. Optionally, determining the isotype of the clones obtained from 7). Optionally, purifying the antibody via Protein A.

[0226] phage display In a further aspect, the antibody according to the invention comprises: i) isolating at least one antibody having affinity for the antigen from an antibody gene library; ii) generating at least one cell line expressing said at least one antibody; iii) a monoclonal antibody obtainable by a method comprising isolating at least one antibody from the culture of at least one cell line obtained in step ii).

[0227] Specifically, an antibody having affinity for an antigen has at least 10 7 M -1 , preferably 10 8 M -1 and more preferably, the affinity is 10 9 M -1 greater than 10, most preferably 10 M -1 Greater than.

[0228] In certain embodiments, the antibodies according to the invention are monoclonal antibodies obtainable by isolating at least one antibody from a culture derived from at least one cell line that expressed at least one antibody having affinity for an antigen from an antibody gene library.

[0229] In one embodiment, the antigen comprises a peptide as set forth herein in Table 1 or Table 6, respectively, which may in certain embodiments be bound to a solid phase.

[0230] In certain embodiments of the method for obtaining antibodies, in step i), the antibody gene library is a naive antibody gene library, particularly a human naive antibody gene library, more particularly a library in which antibodies are displayed via phage display, i.e., on phages comprising nucleotide sequences encoding each such antibody; more particularly a library comprising the library HAL7, HAL8, or HAL9, more particularly the human naive antibody gene library HAL7 / 8.

[0231] In certain embodiments of the method for obtaining antibodies, in step i), screening involves the use of an antigen, specifically an antigen containing a tag linked to it via two different spacers, more specifically a biotin tag. In a specific embodiment, such a panning strategy involves a mixture of panning rounds with non-specifically bound antigens and antigens specifically bound via tags, in the case of biotin tags, streptavidin-bound antigens. In this way, the background of non-specific binders can be minimized.

[0232] In certain embodiments of the method for obtaining an antibody, in step i), in embodiments where the library is a phage display library, the antibody is isolated by isolating phage that display the antibody (and that contain a nucleotide sequence encoding the antibody).

[0233] In certain embodiments of the method for obtaining an antibody, in step ii), the cell line is generated via introduction of a nucleotide sequence encoding the antibody; in embodiments where the library in step i) is a phage display library, the phage isolated from step i) can be used to produce a bacterial strain, e.g., an E. coli strain, that expresses the antibody.

[0234] In certain embodiments of the method for obtaining antibodies, in step iv), in embodiments where the library in step i) is a phage display library and a bacterial strain is produced in step ii), the antibodies can be isolated from the supernatant of the culture.

[0235] When used in describing methods for obtaining antibodies, it is understood that the term "one antibody" in the phrase "at least one antibody" may specifically include two or more antibody molecules of antibodies having the same amino acid sequence. This understanding applies mutatis mutandis to the term "one cell line."

[0236] In certain embodiments of the method for obtaining an antibody, two or more antibodies (referring to multiple antibodies each having a distinct amino acid sequence) are isolated in step i), and therefore two or more cell lines are generated in step ii). Such a method may involve, for example, selecting clones that are positive for binding to the antigen via a binding assay, for example, an ELISA assay involving the antigen, and cells that are positive for binding to the antigen may be isolated to produce a monoclonal cell line.

[0237] In a preferred embodiment, the antibody according to the invention i) isolating at least one antibody having affinity for an antigen from an antibody gene library comprising the human naive antibody gene library HAL7 / 8 by eluting phages carrying the antibody from the library; ii) generating at least one E. coli cell line expressing said at least one antibody; iii) a monoclonal antibody obtainable by a method comprising isolating at least one antibody from the supernatant of a culture of at least one E. coli cell line obtained in step ii).

[0238] In a further aspect, antibody fragments according to the invention are produced by a method involving enzymatic digestion of antibodies. In certain embodiments, the method produces, for example, Fab or F(ab)2 antibody fragments. In certain embodiments, the method involves digestion with pepsin or papain, which is optionally immobilized on a surface.

[0239] In certain embodiments, antibodies may be humanized by CDR grafting, specifically by a process involving the following steps: - extracting RNA from a hybridoma (e.g., obtained by the methods described herein) expressing the antibody of interest; - amplifying the extracted RNA via RT-PCR, specifically using primer sets specific for the heavy and light chains of the antibody of interest, to obtain a DNA product; - further amplifying said DNA product via PCR, specifically using semi-nested primer sets specific for antibody variable regions; - determining the sequence of the DNA product; - aligning the sequences with homologous human framework sequences to determine humanized sequences for the variable heavy and variable light chain sequences (of the desired antibody).

[0240] In certain embodiments, antibodies can be humanized by amplifying RNA extracted from a hybridoma expressing the antibody of interest via RT-PCR, specifically using primer sets specific for the heavy and light chains of the antibody of interest, and further amplifying the DNA obtained therefrom via PCR, specifically using semi-nested primer sets specific for the antibody variable regions, and aligning the sequence of the resulting DNA product with homologous human framework sequences to determine humanized sequences for the variable heavy and variable light chain sequences (of the desired antibody).

[0241] In certain embodiments, the antibody - determining the complementarity determining regions (CDRs), which can be achieved by analyzing the structural interactions of the CDRs and framework regions (FRs) with the antigen; -Can be humanized by grafting the CDR sequences into human framework regions.

[0242] In certain embodiments, antibodies may be humanized by grafting complementarity-determining region (CDR) sequences, which may be determined by analyzing the structural interactions of the CDRs and framework regions (FRs) with the antigen, into human framework regions.

[0243] In certain embodiments, mutations in the amino acid sequences of the CDRs or FRs can be introduced, for example, by a random approach using a phage display library or via a directed approach guided by molecular modeling, to maintain structural interactions with the antigen (which can otherwise be eliminated by introducing human FR sequences).

[0244] DNA sequences encoding the antibodies, determined as detailed herein, can be transferred into cells by known genetic engineering techniques and used to produce the antibodies.

[0245] antibody production In a further aspect, the antibody according to the invention comprises: - culturing a cell line containing a nucleotide sequence encoding the antibody; - a monoclonal antibody obtainable by the method described herein, produced by a method comprising isolating the antibody from said culture.

[0246] In a further particular embodiment, the antibody according to the invention is a monoclonal antibody obtainable by the methods described herein, produced by isolating the antibody from the culture of a cell line comprising a nucleotide sequence encoding said antibody.

[0247] In certain embodiments of the method, the cell line is produced as described herein above and is selected from the group consisting of bacterial cells, such as Gram-negative bacteria, e.g., E. coli, Proteus mirabilis, or Pseudomonas putidas, Gram-positive bacteria, e.g., Bacillus brevis, Bacillus subtilis, Bacillus megaterium, Lactobacilli, e.g., Lactobacillus zeae / casei or Lactobacillus paracasei, or Streptomyces, e.g., Streptomyces lividans; eucariotic cells, such as yeast, e.g., Pichia pastoris, Saccharomyces cerevisiae, Hansenula polymorpha, Schizosaccharomyces pombe, Schwanniomyces occidentalis, Kluyveromyces lactis, or Yarrowia lipolytica; fungi, for example, filamentous fungi, for example, Aspergillus of the genus Trichoderma, for example, A. niger (e.g., the subgenus A. awamori), and Aspergillus oryzae, Trichoderma reesei, Chrysosporium, for example, C. lucknowense; protozoa, for example, Leishmania, for example, L. tarentolae; insect cells, for example, insect cells transfected with baculoviruses, for example, AcNPV, for example, insect cell lines from Spodoptera frugiperda, for example, Sf-9 or Sf-21, Drosophila melanogaster, for example, DS2, or Trichopulsia ni, for example, High Five cells (BTI-TN-5B1-4); mammalian cells, for example, hamster, for example, Chinese hamster ovary, for example, K1-, DukX B11-, DG44, Lec13, or BHK; murine, e.g., murine myeloma, e.g., NS0; homo sapiens, e.g., Per.C6, AGE1.HN, HEK293.

[0248] In certain embodiments of the method, the cell can be, for example, a hybridoma cell as described herein.

[0249] In certain embodiments of the method, the culturing may be carried out in a static suspension culture, a stirred suspension culture, a membrane-based culture, a matrix-based culture, or a high cell density bioreactor. The vessel for such culturing may be selected from the group including T-flasks, roller cultures, spinner cultures, stirred tank bioreactors, airlift bioreactors, static membrane-based or matrix-based culture systems, suspension bioreactors, fluidized bed bioreactors, ceramic bioreactors, perfusion systems, hollow fiber bioreactors.

[0250] In certain embodiments of the method, the cells may be immobilized on a matrix.

[0251] High cell density bioreactors are specifically culture systems capable of producing cell densities greater than 10^8 cells / ml.

[0252] In a further aspect, the antibody according to the invention comprises: - generating a transgenic plant or animal comprising a nucleotide sequence encoding the antibody; - a monoclonal antibody obtainable by a method as described herein, produced by a method comprising isolating the antibody from said plant or animal, or from a secretion or product of said plant or animal.

[0253] In certain further aspects, the antibody according to the invention is a monoclonal antibody obtainable by the methods described herein, produced by isolating the antibody from a transgenic plant or animal or a secretion or product of a transgenic plant or animal carrying a nucleotide sequence encoding the antibody.

[0254] The animal may be selected from, for example, chicken, mouse, rat, rabbit, cow, goat, sheep, or pig. The secretion or product may be, for example, milk or eggs. The plant may be selected from, for example, tobacco (N. tabacum or N. benthamiana), duckweed (Lemna minor), Chlamydomonas reinhardtii, rice, Arabidopsis thaliana, alfalfa (Medicago sativa), lettuce, or corn.

[0255] Antibodies can, in certain embodiments, be isolated by physicochemical fractionation, e.g., size exclusion chromatography, precipitation using, e.g., ammonium sulfate, ion exchange chromatography, immobilized metal chelate chromatography, gel filtration, zone electrophoresis; their classification, e.g., based on binding to bacterial proteins A, G, or L, jacalin; antigen-specific affinity purification via immobilized ligands / antigens; and, if necessary, low molecular weight components can be removed by methods such as dialysis, desalting, and diafiltration.

[0256] In some embodiments, the antibody is encoded by a nucleotide sequence, where the nucleotide sequence is a reverse transcription of an amino acid sequence from an antibody produced by one of the processes described herein. [Brief explanation of the drawings]

[0257] [Figure 1a] Illustration of antibody formats—Fv and scFv—variants. [Figure 1b] Antibody Formats—Illustration of Heterofusions and Bifunctional Antibodies. [Figure 1c] Antibody Formats—Illustration of Bivalent and Bispecific Antibodies [Figure 2a] Dose-response curve for human ADM. Maximal cAMP stimulation was adjusted to 100% activation. [Figure 2b]Dose / inhibition curve of human ADM 22-52 (ADM receptor antagonist) in the presence of 5.63 nM hADM. [Figure 2c] Dose / inhibition curve of CT-H in the presence of 5.63 nM hADM. [Figure 2d] Dose / inhibition curve of MR-H in the presence of 5.63 nM hADM. [Figure 2e] Dose / inhibition curve of NT-H in the presence of 5.63 nM hADM. [Figure 2f] Dose-response curve of mouse ADM. Maximal cAMP stimulation was adjusted to 100% activation. [Figure 2g] Dose / inhibition curve of human ADM 22-52 (ADM receptor antagonist) in the presence of 0.67 nM mADM. [Figure 2h] Dose / inhibition curve of CT-M in the presence of 0.67 nM mADM. [Figure 2i] Dose / inhibition curve of MR-M in the presence of 0.67 nM mADM. [Figure 2j] Dose / inhibition curve of NT-M in the presence of 0.67 nM mADM. [Figure 2k] 1 shows the inhibition of ADM by F(ab)2 NT-M and Fab NT-M. [Figure 2l] 1 shows the inhibition of ADM by F(ab)2 NT-M and Fab NT-M. [Figure 3] This figure shows a typical hADM dose / signal curve and the hADM dose-signal curve in the presence of 100 μg / mL of antibody NT-H. [Figure 4] This figure shows the stability of hADM in human plasma (citrate) in the absence and presence of NT-H antibodies. [Figure 5] Alignment of Fab with homologous human framework sequences. [Figure 6] ADM concentrations in healthy human subjects after application of NT-H at different doses for up to 60 days. [Figure 7]Inhibition curve of native DPP3 from blood cells by the inhibitory antibody AK1967. The inhibition of DPP3 by the specific antibody is concentration-dependent, and when assayed against 15 ng / ml of DPP3, the IC50 is approximately 15 ng / ml. [Figure 8] Association and dissociation curves of AK1967-DPP3 binding analysis using Octet. AK1967-loaded biosensors were immersed in a dilution series of recombinant GST-tagged human DPP3 (100, 33.3, 11.1, 3.7 nM), and association and dissociation were monitored. [Figure 9] Western blot of dilutions of blood cell lysates and detection of DPP3 using AK1967 as the primary antibody. [Figure 10] Procizumab dramatically improves fractional shortening (A) and mortality (B) in rats with sepsis-induced heart failure. [Figure 11] Experimental design—Isoproterenol-induced cardiac stress in mice followed by procizumab treatment (B) and control (A). [Figure 12] Procizumab improved fractional shortening (A) and reduced renal resistive index (B) within 1 and 6 hours after administration, respectively, in mice with isoproterenol-induced heart failure. [Figure 13] High DPP3 levels 24 hours after admission in septic patients were associated with the worst SOFA scores. [Figure 14] High DPP3 plasma levels correlate with organ dysfunction in sepsis patients. Bar plot of AdrenOSS-1 SOFA score according to DPP3 levels over time during ICU stay. HH: DPP3 above the median on admission and at 24 hours; HL: above the median on admission but below the median at 24 hours; LL: below the median on admission and at 24 hours; LH: below the median on admission but above the median at 24 hours. [Figure 15a]High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 15b] High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 15c] High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 15d] High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 15e] High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 15f]High DPP3 levels 24 hours after admission in sepsis patients were associated with the worst organ-specific SOFA scores. The SOFA score values for (A) cardiac system, (B) renal system, (C) respiratory system, (D) hepatic system, (E) coagulation system, and (F) central nervous system (HH: high / high, HL: high / low, LH: low / high, LL: low / low) are shown by the dynamic DPP3 levels between admission and 24 hours. [Figure 16] Kaplan-Meier survival plots for low (<40.5 ng / mL) and high (≥40.5 ng / mL) DPP3 concentrations. (A) 7-day survival of patients with sepsis in relation to DPP3 plasma concentration; (B) 7-day survival of patients with cardiogenic shock in relation to DPP3 plasma concentration; (C) 7-day survival of patients with septic shock in relation to DPP3 plasma concentration. [Figure 17] Kaplan-Meier survival plots for all patients (14-day mortality for patients treated with placebo (Plac) or the N-terminal ADM antibody Adrecizumab (Adz)). [Figure 18] Kaplan-Meier survival plots for patients with DPP3 <50 ng / mL (14-day mortality in patients treated with placebo (Plac) or N-terminal ADM antibody adrecizumab (Adz)) [Figure 19] Kaplan-Meier survival plots for patients with DPP3 >50 ng / mL (14-day mortality in patients treated with placebo (Plac) or N-terminal ADM antibody adrecizumab (Adz)) [Figure 20a] Efficacy of adrecizumab treatment using different DPP3 thresholds: Kaplan-Meier survival plots (28-day mortality) for patients treated with placebo or the N-terminal ADM antibody adrecizumab, including patients with (A) DPP3 < 50 ng / mL, (B) DPP3 < 40 ng / ml, (C) DPP3 < 30 ng / ml, and (D) DPP3 < 22 ng / ml, respectively. [Figure 20b]Efficacy of adrecizumab treatment using different DPP3 thresholds: Kaplan-Meier survival plots (28-day mortality) for patients treated with placebo or the N-terminal ADM antibody adrecizumab, including patients with (A) DPP3 < 50 ng / mL, (B) DPP3 < 40 ng / ml, (C) DPP3 < 30 ng / ml, and (D) DPP3 < 22 ng / ml, respectively. [Figure 20C] Efficacy of adrecizumab treatment using different DPP3 thresholds: Kaplan-Meier survival plots (28-day mortality) for patients treated with placebo or the N-terminal ADM antibody adrecizumab, including patients with (A) DPP3 < 50 ng / mL, (B) DPP3 < 40 ng / ml, (C) DPP3 < 30 ng / ml, and (D) DPP3 < 22 ng / ml, respectively. [Figure 20D] Efficacy of adrecizumab treatment using different DPP3 thresholds: Kaplan-Meier survival plots (28-day mortality) for patients treated with placebo or the N-terminal ADM antibody adrecizumab, including patients with (A) DPP3 < 50 ng / mL, (B) DPP3 < 40 ng / ml, (C) DPP3 < 30 ng / ml, and (D) DPP3 < 22 ng / ml, respectively. [Figure 21] Efficacy of adrecizumab treatment using different DPP3 thresholds: Kaplan-Meier survival plots (28-day mortality) for patients treated with placebo or the N-terminal ADM antibody adrecizumab, including patients with baseline DPP3 values below 50 ng / ml and DPP3 < 50 ng / mL on subsequent days.

[0258] array SEQ ID NO: 1 (anti-ADM CDR1 heavy chain) GYTFSRYW SEQ ID NO: 2 (anti-ADM CDR2 heavy chain) ILPGSGST SEQ ID NO: 3 (anti-ADM CDR3 heavy chain) TEGYEYDGFDY SEQ ID NO: 4 (anti-ADM CDR1 light chain) QSIVYSNGNTY Sequence "RVS" (anti-ADM CDR2 light chain, not part of the sequence listing): RVS SEQ ID NO: 5 (anti-ADM CDR3 light chain) FQGSHIPYT Sequence number 6 (AM-VH-C) QVQLQQSGAELMKPGASVKISKATGYTFSRYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATITADTSSNTAYMQLSSLTSEDSAVYYCTEGYEYDGFDYWG QGTTLTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SEQ ID NO: 7 (AM-VH1) QVQLVQSGAEVKKPGSSVKVSCKASGYTFSRYWISWVRQAPGQGLEWMGRILPGSGSTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCTEGYEYDGFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SEQ ID NO: 8 (AM-VH2-E40) QVQLVQSGAEVKKPGSSVKVSCKASGYTFSRYWIEWVRQAPGQGLEWMGRILPGSGSTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCTEGYEYDGFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SEQ ID NO: 9 (AM-VH3-T26-E55) QVQLVQSGAEVKKPGSSVKVSCKATGYTFSRYWISWVRQAPGQGLEWMGEILPGSGSTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCTEGYEYDGFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SEQ ID NO: 10 (AM-VH4-T26-E40-E55) QVQLVQSGAEVKKPGSSVKVSCKATGYTFSRYWIEWVRQAPGQGLEWMGEILPGSGSTNYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCTEGYEYDGFDYWG QGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEPK SEQ ID NO: 11 (AM-VL-C) DVLLSQTPLSLPVSLGDQATISCRSSQSIVYSNGNTYLEWYLQKPGQSPKLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYYCFQGSHIPYTFGGGTKL EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 12 (AM-VL1) DVVMTQSPLSLPVTLGQPASISCRSSQSIVYSNGNTYLNWFQQRPGQSPRRLIYRVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPYTFGQGTKL EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 13 (AM-VL2-E40) DVVMTQSPLSLPVTLGQPASISCRSSQSIVYSNGNTYLEWFQQRPGQSPRRLIYRVSNRDSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPYTFGQGTKL EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 14 (human ADM 1-21) YRQSMNNFQGLRSFGCRFGTC SEQ ID NO: 15 (human ADM 21-32) CTVQKLAHQIYQ SEQ ID NO: 16 (human ADM C-42-52) CAPRSKISPQGY-CONH2 SEQ ID NO: 17 (mouse ADM 1-19) YRQSMNQGSRSNGCRFGTC SEQ ID NO: 18 (mouse ADM 19-31) CTFQKLAHQIYQ SEQ ID NO: 19 (Mouse ADM C-40-50) CAPRNKISPQGY-CONH2 SEQ ID NO: 20 (mature human adrenomedullin (mature ADM); amidated ADM; bioADM): amino acids 1 to 52 or amino acids 95 to 146 of proADM YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-CONH2 SEQ ID NO: 21 (mouse ADM 1-50) YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMAPRNKISPQGY-CONH2 SEQ ID NO: 22 (1-21 of human ADM): YRQSMNNFQGLRSFGCRFGTC SEQ ID NO: 23 (1-42 of human ADM): YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQFTDKDKDNVA SEQ ID NO: 24 (aa 43-52 of human ADM) PRSKISPQGY-NH2 SEQ ID NO: 25 (aa 1-14 of human ADM) YRQSMNNFQGLRSF SEQ ID NO: 26 (aa 1-10 of human ADM) YRQSMNNFQG SEQ ID NO: 27 (aa 1-6 of human ADM) YRQSMN SEQ ID NO: 28 (aa 1-32 of human ADM) YRQSMNNFQGLRSFGCRFGTCTVQKLAHQIYQ SEQ ID NO: 29 (aa 1-40 mouse ADM) YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQLTDKDKDGMA SEQ ID NO: 30 (aa 1-31 mouse ADM) YRQSMNQGSRSNGCRFGTCTFQKLAHQIYQL SEQ ID NO: 31 (proADM: 164 amino acids (22-185 of preproADM)) ARLDVASEF RKKWNKWALS RGKRELRMSS SYPTGLADVK AGPAQTLIRP QDMKGASRSP EDSSPDAARI RVKRYRQSMN NFQGLRSFGC RFGTCTVQKL AHQIYQFTDK DKDNVAPRSK ISPQGYGRRR RRSLPEAGPG RTLVSSKPQA HGAPAPPSGS APHFL SEQ ID NO: 32 (Addressizumab heavy chain) QVQLVQSGAEVKKPGSSVKVSCKASGYTFSRYWIEWVRQAPGQGLEWIGEILPGSGSTNYNQKFQGRVTITADTSTSTAYMELSSLRSEDTAVYYCTEGY EYDGFDYWGQGTTVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYI CNVNHKPSNTKVDKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNST YRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLD SDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK SEQ ID NO: 33 (Addressizumab light chain) DVVLTQSPLSLPVTLGQPASISCRSSQSIVYSNGNTYLEWYLQRPGQSPRLLIYRVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCFQGSHIPYTFGGGTKL EIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC SEQ ID NO: 34-IGHV1-69*11 QVQLVQSGAEVKKPGSSVKVSCKASGGTFSSYAISWVRQAPGQGLEWMGRIIPILGTANYAQKFQGRVTITADESTSTAYMELSSLRSEDTAVYYCARYYYYYGMDVWGQGTTVTVSS SEQ ID NO: 35-HB3 QVQLQQSGAELMKPGASVKISKATGYTFSRYWIEWVKQRPGHGLEWIGEILPGSGSTNYNEKFKGKATITADTSSNTAYMQLSSLTSEDSAVYYCTEGYEYDGFDYWGQGTTLTVSS SEQ ID NO:36 - Human DPP3 (amino acids 1-737) MADTQYILPNDIGVSSLDCREAFRLLSPTERLYAYHLSRAWYGGLAVLLQTSPEAPYIYALLSRLFRAQDPDQLRQHALAEGLTEEEYQAFLVYAAGVYSNMGNYKSFGDTKFVPNLPKEKLERVILGSEAAQQHPEEVRGLWQTCGELMFSLEPRLRHLGLGKEGITTYFSGNCTMEDAKLA QDFLDSQNLSAYNTRLFKEVDGEGKPYYEVRLASVLGSEPSLDSEVTSKLKSYEFRGSPFQVTRGDYAPILQKVVEQLEKAKAYAANSHQGQMLAQYIESFTQGSIEAHKRGSRFWIQDKGPIVESYIGFIESYRDPFGSRGEFEFGFVAVVNKAMSAKFERLVASAEQLLKELPWPPTFEKDKF LTPDFTSLDVLTFAGSGIPAGINIPNYDDLRQTEGFKNVSLGNVLAVAYATQREKLTFLEEDDKDLYILWKGPSFDVQVGLHELLGHGSGKLFVQDEKGAFNFDQETVINPETGEQIQSWYRSGETWDSKFSTIASSYEECRAESVGLYLCLHPQVLEIFGFEGADAEDVIYVNWLNMVRAGLL ALEFYTPEAFNWRQAHMQARFVILRVLLEAGEGLVTITPTTGSDGRPDARVRLDRSKIRSVGKPALERFLRRLQVLKSTGDVAGGRALYEGYATVTDAPPECFLTLRDTVLLRKESRKLIVQPNTRLEGSDVQLLEYEASAAGLIRSFSERFPEDGPELEEILTQLATADARFWKGPSEAPSGQA SEQ ID NO: 37 - Human DPP3 (amino acids 474-493 (N-Cys)) - immunizing peptide with an additional N-terminal cysteine CETVINPETGEQIQSWYRSGE SEQ ID NO: 38 - epitope of hDPP3 aa 477-482-AK1967 INPETG SEQ ID NO: 39 - hDPP3 aa 480-483 ETGE SEQ ID NO: 40 - Variable region of murine AK1967 in the heavy chain QVTLKESGPGILQPSQTLSLTCSSGFSLSTSGMSVGWIRQPSGKGLEWLAHIWWNDNKSYNPALKSRLTISRDTSNNQVFLKIASVVTADTGTYFCARNYSYDYWGQGTTLTVSS SEQ ID NO: 41 - Variable region of mouse AK1967 in the light chain DVVVTQTPLSLSVSLGDPASISCRSSRSLVHSIGSTYLHWYLQKPGQSPKLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPWTFGGGTKLEIK SEQ ID NO: 42 - CDR1 of mouse AK1967 in the heavy chain GFSLSTSGMS SEQ ID NO: 43 - CDR2 of mouse AK1967 in the heavy chain IWWNDNK SEQ ID NO: 44 - CDR3 of mouse AK1967 in the heavy chain ARNYSYDY SEQ ID NO: 45 - CDR1 of mouse AK1967 in the light chain RSLVHSIGSTY CDR2 of mouse AK1967 in the light chain (no sequence number) KVS SEQ ID NO: 46 - CDR3 of mouse AK1967 in the light chain SQSTHVPWT SEQ ID NO: 47 - Humanized AK1967 - Heavy chain sequence (IgG1κ backbone) MDPKGSLSWRILLFLSLAFELSYGQITLKESGPTLVKPTQTLTLTCTFSGFSLSTSGMSVGWIRQPPGKALEWLAHIWWNDNKSYNPALKSRLTITRDTSKNQVVLTMTNMMDPVDTG TYYCARNYSYDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKV DKKVEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKAL PAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPG SEQ ID NO: 48 - Humanized AK1967 - Light chain sequence (IgG1κ backbone) METDTLLLWVLLLWVPGSTGDIVMTQTPLSLSVTPGQPASISCKSSRSLVHSIGSTYLYWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYYCSQSTHV PWTFGGGTKVEIKRTVAAPSVFIFPPSDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSSTLTLSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

[0259] For the avoidance of doubt, references to the C-terminal groups "NH2" and "CONH2" similarly refer to the C-terminal amide group.

[0260] With the above context in mind, the following consecutively numbered embodiments provide further specific aspects of the present invention.

[0261] 1. A method for predicting an increase in dipeptidyl peptidase 3 (DPP3) in a critically ill patient, the method comprising: determining the level of DPP3 in a sample of the patient's body fluid; comparing the determined level of DPP3 to a predetermined threshold, the threshold being in the range of 40 ng / ml to 22 ng / ml; A method for prediction of increased DPP3 in a critically ill patient, wherein a level of DPP3 in said sample above said predetermined threshold is indicative for increased DPP3 in said patient.

[0262] In certain embodiments, the method is for predicting an increase in dipeptidyl peptidase 3 (DPP3) in a critically ill patient, the method comprising: determining the level of DPP3 in a sample of the patient's body fluid; comparing the determined level of DPP3 to a predetermined threshold, the threshold being in the range of 40 ng / ml to 22 ng / ml; A level of DPP3 in the sample above the predetermined threshold is indicative for an increase in DPP3 in the patient during the follow-up time.

[0263] 2. The method for predicting increased DPP3 in critically ill patients according to embodiment 1, wherein the predetermined threshold is between 30 ng / ml and 22 ng / ml.

[0264] 3. The method for prediction of increased DPP3 in critically ill patients according to embodiment 1 or 2, wherein said predetermined threshold is between 25 ng / ml and 22 ng / ml.

[0265] 4. A method for prediction of an increase in DPP3 in a critically ill patient according to any of embodiments 1 to 3, wherein said predicted increase is an increase to a DPP3 level of 40 or more, preferably 50 ng / ml or more.

[0266] 5. The method for prediction of increased DPP3 in critically ill patients according to embodiments 1 to 3, wherein said predicted increase in DPP3 levels is 10% or more, more preferably 20% or more, even more preferably 40% or more, even more preferably 50% or more, even more preferably 75% or more, even more preferably 100% or more.

[0267] 6. The method for prediction of increased DPP3 in critically ill patients according to embodiments 1 to 5, wherein said increase in DPP3 is within a period of at most 12 hours, preferably at most 24, 48, 72, 96 hours, more preferably at most 5 days, even more preferably at most 6 days, and most preferably at most 7 days.

[0268] 7. The method for prediction of increased DPP3 in critically ill patients according to embodiments 1 to 6, wherein the patient is a patient with a severe infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, a patient with organ dysfunction or failure (e.g., liver, kidney, lung dysfunction or failure), a patient undergoing major surgery, a patient with trauma (e.g., burn trauma, polytrauma), a patient with shock and / or a patient in shock, or alternatively a patient with ARDS.

[0269] 8. The method for prediction of increased DPP3 in a critically ill patient according to embodiment 7, wherein the shock is selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock.

[0270] 9. In the case of cardiogenic shock, the patient may be suffering from an acute coronary syndrome (e.g., acute myocardial infarction), or the patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, or intestinal obstruction; or In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or A method for prediction of increased DPP3 in critically ill patients according to embodiment 8, wherein in the case of distributive shock, the patient may have septic shock, neurogenic shock, anaphylactic shock, or shock due to adrenal crisis.

[0271] 10. A method for prediction of increased DPP3 in critically ill patients according to any of embodiments 7 to 9, wherein said shock is selected from the group comprising cardiogenic shock or septic shock.

[0272] 11. A method for prediction of increased DPP3 in critically ill patients according to any of embodiments 1 to 10, wherein the patient is selected for therapy / treatment if the level of DPP3 in the sample is below said predetermined threshold, and said therapy is selected from the group of alkaline phosphatase, immunosuppressants, corticosteroids, vasopressors, fluids, anti-adrenomedullin antibodies, or antibody fragments or scaffolds.

[0273] 12. The method for predicting increased DPP3 in critically ill patients according to embodiment 11, wherein the anti-adrenomedullin antibody, or anti-adrenomedullin antibody fragment, or anti-adrenomedullin scaffold is directed against the N-terminal portion (amino acids 1-21) of adrenomedullin (ADM): YRQSMNNFQGLRSFGCRFGTC (SEQ ID NO: 14).

[0274] 13. A method for prediction of increased DPP3 in critically ill patients according to any of embodiments 1 to 12, wherein the patient is selected for therapy / treatment with a DPP3 inhibitor if the level of DPP3 in said sample is above said predetermined threshold, said DPP3 inhibitor being selected from the group of anti-DPP3 antibodies, or anti-DPP3 antibody fragments or anti-DPP3 scaffolds.

[0275] 14. A method for predicting increased DPP3 in a critically ill patient according to any of embodiments 1 to 13, wherein said level of DPP3 is either the amount of DPP3 protein and / or the level of active DPP3.

[0276] 15. A method for prediction of increased DPP3 in critically ill patients according to any of embodiments 1 to 14, wherein said level of DPP3 is determined by different methods including immunoassay, activity assay, or mass spectrometry method.

[0277] 16. A method for predicting increased DPP3 in critically ill patients according to any of embodiments 15, wherein the immunoassay is a sandwich immunoassay.

[0278] 17. A method for predicting increased DPP3 in critically ill patients according to any of embodiments 1 to 16, wherein the body fluid is selected from whole blood, serum, or plasma.

[0279] 18. A method for preventing DPP3 elevation in a critically ill patient, the method comprising: determining the level of DPP3 in a sample of the patient's body fluid; comparing the determined level of DPP3 to a predetermined threshold, the predetermined threshold being between 40 ng / ml and 22 ng / ml, wherein a level of DPP3 in the sample above the predetermined is indicative of increased DPP3 in the patient; and - if the determined level of DPP3 is above the predetermined threshold, a DPP3 inhibitor, administering a DPP3 inhibitor, wherein the DPP3 inhibitor is an anti-DPP3 antibody, and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold.

[0280] 19. A method for the prevention of DPP3 increase in critically ill patients according to embodiment 18, wherein the predetermined threshold is between 30 ng / ml and 22 ng / ml.

[0281] 20. A method for the prevention of DPP3 increase in critically ill patients according to embodiment 18 or 19, wherein said predetermined threshold is between 25 ng / ml and 22 ng / ml.

[0282] 21. A method for the prevention of DPP3 increase in critically ill patients according to any of embodiments 18 to 20, wherein said increase is an increase to a DPP3 level of 40 or more, preferably 50 ng / ml or more.

[0283] 22. A method for the prevention of DPP3 increase in critically ill patients according to embodiments 18 to 21, wherein the patient is a patient with a severe infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, a patient with organ dysfunction or failure (e.g., liver, kidney, lung dysfunction or failure), a patient undergoing major surgery, a patient with trauma (e.g., burn trauma, polytrauma), a patient with shock and / or a patient in shock, or alternatively a patient with ARDS.

[0284] 23. A method for the prevention of DPP3 increase in a critically ill patient according to embodiment 22, wherein the shock is selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock.

[0285] twenty four. In the case of cardiogenic shock, the patient may be suffering from an acute coronary syndrome (e.g., acute myocardial infarction), or the patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, or intestinal obstruction; or In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or A method for the prevention of DPP3 increase in critically ill patients according to embodiment 23, wherein in the case of distributive shock, the patient may have septic shock, neurogenic shock, anaphylactic shock, or shock due to adrenal crisis.

[0286] 25. A method for the prevention of DPP3 increase in critically ill patients according to any of embodiments 22 to 24, wherein said shock is selected from the group comprising cardiogenic shock or septic shock.

[0287] 26. A DPP3 inhibitor for use in preventing DPP3 increase in a critically ill patient, wherein the patient has a level of DPP3 above a threshold, the threshold being between 40 ng / ml and 22 ng / ml, and the DPP3 inhibitor is an anti-DPP3 antibody and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold. [Example]

[0288] Example 1 - Generation of anti-ADM antibodies and determination of their affinity constants Several human and murine antibodies were produced and their affinity constants determined (see Tables 1 and 2). It should be emphasized that the antibodies, antibody fragments, and non-Ig scaffolds in the Examples section according to the present invention bind to ADM and should therefore be considered as anti-ADM antibodies / antibody fragments / non-Ig scaffolds.

[0289] Peptides / conjugates for immunization: For conjugation of peptides to bovine serum albumin (BSA), peptides for immunization were synthesized with an additional N-terminal cysteine residue (if no cysteine was present in the selected ADM sequence) (see Table 1) (JPT Technologies, Berlin, Germany). Peptides were covalently linked to BSA using Sulfolink coupling gel (Perbio-science, Bonn, Germany). The coupling procedure was performed according to the Perbio manual.

[0290] Mouse monoclonal antibody production: Balb / c mice were immunized with 100 μg of peptide-BSA conjugate (emulsified in 100 μl of complete Freund's adjuvant) on days 0 and 14 and 50 μg (in 100 μl of incomplete Freund's adjuvant) on days 21 and 28. Three days before the fusion experiment, animals received 50 μg of the conjugate dissolved in 100 μl of saline, given as one intraperitoneal injection and one intravenous injection. Splenocytes from immunized mice and cells of the myeloma cell line SP2 / 0 were fused with 1 ml of 50% polyethylene glycol at 37°C for 30 seconds. After washing, the cells were seeded into 96-well cell culture plates. Hybrid clones were selected by growth in HAT medium (RPMI 1640 culture medium supplemented with 20% fetal bovine serum and HAT supplement). After two weeks, the HAT medium was replaced with HT medium for three passages, followed by a return to normal cell culture medium. Cell culture supernatants were initially screened for antigen-specific IgG antibodies 3 weeks after fusion. Positive microcultures were transferred to 24-well plates for expansion. After retesting, selected cultures were cloned and recloned using limiting dilution techniques, and their isotypes were determined (see also Lane, RD 1985. J. Immunol. Meth. 81:223-228; Ziegler et al. 1996. Horm. Metab. Res. 28:11-15).

[0291] Antibodies were produced by standard antibody production methods (Marx et al, 1997. Monoclonal Antibody Production, ATLA 25, 121) and purified by protein A. Antibody purity was >95% based on SDS gel electrophoresis analysis.

[0292] Human antibodies: Human antibodies were produced using phage display according to the following procedure: the human naive antibody gene library HAL7 / 8 was used to isolate recombinant single-chain F variable domains (scFv) against adrenomedullin peptides. The antibody gene library was screened with a panning strategy involving the use of peptides containing a biotin tag linked to the adrenomedullin peptide sequence via two different spacers. A mixture of panning rounds using nonspecifically binding antigens and streptavidin-binding antigens was used to minimize the background of nonspecific binders. Eluted phage from the third round of panning was used to generate monoclonal scFv expressing E. coli strains. Supernatants from the culture of these clonal strains were used directly for antigen ELISA testing (see also Hust et al. 2011, Journal of Biotechnology 152, 159-170; Schutte et al. 2009, PLoS One 4, e6625). Positive clones were selected based on a positive ELISA signal against the antigen and a negative response on streptavidin-coated microtiter plates. For further characterization, the scFv open reading frame was cloned into the expression plasmid pOPE107 (Hust et al., J. Biotechn. 2011), captured from culture supernatants via immobilized metal ion affinity chromatography, and purified by size-exclusion chromatography.

[0293] Affinity constant: To determine the affinity of the antibody for ADM, the binding kinetics of ADM to immobilized antibody was determined by label-free surface plasmon resonance using a Biacore 2000 system (GE Healthcare Europe GmbH, Freiburg, Germany). Reversible immobilization of the antibody was performed using an anti-mouse Fc antibody covalently bound at high density to the CM5 sensor surface according to the manufacturer's instructions (Mouse Antibody Capture Kit; GE Healthcare). (Lorenz et al. 2011. Antimicrob Agents Chemother. 55(1):165-173).

[0294] Monoclonal antibodies were generated against the ADM regions depicted below for human and mouse ADM, respectively. The table below presents a selection of the resulting antibodies used in further experiments. The selection was based on the target region.

[0295] [Table 2]

[0296] [Table 3]

[0297] Generation of antibody fragments by enzymatic digestion: Fab and F(ab)2 fragments were generated by enzymatic digestion of the mouse full-length antibody NT-M. The antibody NT-M was digested using a) a pepsin-based F(ab)2 preparation kit (Pierce 44988) and b) a papain-based Fab preparation kit (Pierce 44985). The fragmentation procedures were performed according to the instructions provided by the supplier. Digestion was carried out for 8 hours at 37°C for F(ab)2 fragmentation. Fab fragmentation digestions were carried out for 16 hours, respectively.

[0298] Procedure for Fab generation and purification: The immobilized papain was equilibrated by washing the resin with 0.5 ml of digestion buffer and centrifuging the column at 5,000 x g for 1 minute. The buffer was then discarded. A desalting column was prepared by removing the storage solution, washing with digestion buffer, and then centrifuging each time at 1,000 x g for 2 minutes. 0.5 ml of the prepared IgG sample was added to the spin column tube containing the equilibrated immobilized papain. The incubation period for the digestion reaction was 16 hours at 37°C on a tabletop rocker. The column was centrifuged at 5,000 x g for 1 minute to separate the digest from the immobilized papain. The resin was then washed with 0.5 ml of PBS and centrifuged at 5,000 x g for 1 minute. The wash fraction was added to the digested antibody, with a total sample volume of 1.0 ml. The NAb Protein A column was equilibrated with PBS and IgG elution buffer at room temperature. The column was centrifuged for 1 minute to remove the storage solution (containing 0.02% sodium azide), equilibrated by adding 2 ml of PBS, centrifuged again for 1 minute, and the flow-through was discarded. The sample was applied to the column and resuspended by inversion. Incubation was carried out at room temperature with end-over-end mixing for 10 minutes. The column was centrifuged for 1 minute, and the flow-through with the Fab fragments was saved. (References: Coulter and Harris 1983.J.Immunol.Meth.59,199-203.;Lindner et al.2010.Cancer Res.70,277-87;Kaufmann et al.2010.PNAS.107,18950-5.;Chen et al. al.2010.PNAS.107,14727-32;Uysal et al.2009 J.Exp.Med.206,449-62;Thomas et al.2009.J.Exp.Med.206,1913-27;Kong et al.2009 J.Cell Biol.185,1275-840).

[0299] Procedure for generating and purifying F(ab')2 fragments: The immobilized pepsin was equilibrated by washing the resin with 0.5 ml of digestion buffer and centrifuging the column at 5000 x g for 1 minute. The buffer was then discarded. A desalting column was prepared by removing the storage solution, washing with digestion buffer, and then centrifuging each time at 1000 x g for 2 minutes. 0.5 ml of the prepared IgG sample was added to the spin column tube containing the equilibrated immobilized pepsin. The incubation period for the digestion reaction was 16 hours at 37°C on a tabletop rocker. The column was centrifuged at 5000 x g for 1 minute to separate the digest from the immobilized papain. The resin was then washed with 0.5 mL of PBS and centrifuged at 5000 x g for 1 minute. The wash fraction was added to the digested antibody, with a total sample volume of 1.0 ml. The NAb Protein A column was equilibrated with PBS and IgG elution buffer at room temperature. The column was centrifuged for 1 minute to remove the storage solution (containing 0.02% sodium azide), equilibrated by adding 2 mL of PBS, centrifuged again for 1 minute, and the flow-through was discarded. The sample was applied to the column and resuspended by inversion. Incubation was carried out at room temperature with end-over-end mixing for 10 minutes. The column was centrifuged for 1 minute, and the flow-through with the Fab fragments was saved.(References:Mariani et al.1991.Mol.Immunol.28:69-77;Beale 1987.Exp Comp Immunol 11:287-96;Ellerson et al.1972.FEBS Letters 24(3):318-22;Kerbel and Elliot 1983.Meth Enzymol 93:113-147;Kulkarni et al.1985.Cancer Immunol Immunotherapy 19:211-4;Lamoyi 1986.Meth Enzymol 121:652-663;Parham et al.1982.J Immunol Meth 53:133-73;Raychaudhuri et al.1985.Mol Immunol 22(9):1009-19;Rousseaux et al. al.1980.Mol Immunol 17:469-82;Rousseaux et al.1983.J Immunol Meth 64:141-6;Wilson et al.1991.J Immunol Meth 138:111-9).

[0300] NT-H - Antibody fragment humanization: Antibody fragments were humanized by the CDR grafting method (Jones et al. 1986. Nature 321, 522-525).

[0301] The following steps were performed to obtain the humanized sequence: Total RNA extraction: Total RNA was extracted from NT-H hybridomas using a Qiagen kit. First-round RT-PCR: The QIAGEN® OneStep RT-PCR kit (catalog number 210210) was used. RT-PCR was performed using primer sets specific for the heavy and light chains. For each RNA sample, 12 individual heavy and 11 light chain RT-PCR reactions were set up using a degenerate forward primer mix covering the leader sequences of the variable regions. Reverse primers were located in the constant regions of the heavy and light chains. No restriction sites were engineered into the primers.

[0302] Reaction setup: 5.0 μl 5x QIAGEN® OneStep RT-PCR buffer, 0.8 μl dNTP mix (containing 10 mM of each dNTP), 0.5 μl primer set, 0.8 μl QIAGEN® OneStep RT-PCR enzyme mix, 2.0 μl template RNA, RNase-free water up to 20.0 μl, total volume 20.0 μl PCR conditions: reverse transcription: 50°C, 30 min; initial PCR activation: 95°C, 15 min; cycles: 94°C, 25 s; 54°C, 30 s; 72°C, 30 s (20 cycles); final extension: 72°C, 10 min. Second-round semi-nested PCR: RT-PCR products from the first-round reactions were further amplified in a second round. Twelve individual heavy chain and 11 light chain RT-PCR reactions were set up using semi-nested primer sets specific for antibody variable regions.

[0303] Reaction setup: 10 μl of 2x PCR mixture; 2 μl of primer set; 8 μl of first-round PCR product; total volume 20 μl; Hybridoma Antibody Cloning Report PCR conditions: initial denaturation at 95°C for 5 min; 25 cycles of 95°C for 25 s, 57°C for 30 s, and 68°C for 30 s; final extension at 68°C for 10 min.

[0304] After PCR was completed, PCR reaction samples were run on an agarose gel to visualize the amplified DNA fragments. After sequencing more than 15 cloned DNA fragments amplified by nested RT-PCR, several mouse antibody heavy and light chains were cloned and appeared to be correct. Protein sequence alignment and CDR analysis identified one heavy chain and one light chain. After alignment with homologous human framework sequences, the humanized sequence obtained for the variable heavy chain is as follows: see Figure 5. Because the amino acids at positions 26, 40, and 55 in the variable heavy chain and the amino acid at position 40 in the variable light chain are important for binding properties, they may be reverted to their murine origin. The resulting candidates are depicted below. (Padlan 1991. Mol. Immunol. 28, 489-498; Harris and Bajorath 1995. Protein Sci. 4, 306-310)

[0305] Notes for antibody fragment sequences (SEQ ID NOs: 6-13; 32 and 33): Bold and underlined are sequentially arranged CDRs 1, 2, 3; italics are constant regions; hinge region is highlighted in bold; framework point mutations have a grey background.

[0306] [Table 4-1] [Table 4-2] [Table 4-3]

[0307] Example 2 - Effect of selected anti-ADM antibodies on anti-ADM biological activity The effect of selected ADM antibodies on ADM bioactivity was tested in a human recombinant adrenomedullin receptor cAMP functional assay (adrenomedullin bioassay).

[0308] Testing of antibodies targeting human or mouse adrenomedullin in the human recombinant adrenomedullin receptor cAMP functional assay (adrenomedullin bioassay) Materials: Cell line CHO-K1, receptor adrenomedullin (CRLR + RAMP3), receptor accession numbers: Cell line: CRLR: U17473; RAMP3: AJ001016 CHO-K1 cells (FAST-027C) expressing human recombinant adrenomedullin receptors, grown in antibiotic-free medium prior to testing, were detached by gentle flushing with PBS-EDTA (5 mM EDTA), collected by centrifugation, and resuspended in assay buffer (KRH: 5 mM KCl, 1.25 mM MgSO, 124 mM NaCl, 25 mM HEPES, 13.3 mM glucose, 1.25 mM KHPO, 1.45 mM CaCl, 0.5 g / L BSA).

[0309] Dose-response curves were performed in parallel with a reference agonist (hADM or mADM).

[0310] Antagonist test (96 wells): For antagonist test, 6 μl of reference agonist (human (5.63 nM) or mouse (0.67 nM) adrenomedullin) was mixed with 6 μl of test sample at different antagonist dilutions or 6 μl of buffer. After 60 minutes of incubation at room temperature, 12 μl of cells (2,500 cells / well) were added. The plate was incubated at room temperature for 30 minutes. After adding lysis buffer, the percentage of DeltaF was estimated according to the manufacturer's specifications, and hADM22-52 was used as a reference antagonist using an HTRF kit from Cis-Bio International (catalog number 62AM2 PEB).

[0311] Antibody testing cAMP-HTRF assay Anti-hADM antibodies (NT-H, MR-H, CT-H) were tested for antagonist activity in the human recombinant adrenomedullin receptor (FAST-027C) cAMP functional assay in the presence of 5.63 nM human ADM 1-52 at the following final antibody concentrations: 100 μg / ml, 20 μg / ml, 4 μg / ml, 0.8 μg / ml, and 0.16 μg / ml.

[0312] Anti-mADM antibodies (NT-M, MR-M, CT-M) were tested for antagonist activity in the human recombinant ADM receptor (FAST-027C) cAMP functional assay in the presence of 0.67 nM mouse ADM 1-50 at the following final antibody concentrations: 100 μg / ml, 20 μg / ml, 4 μg / ml, 0.8 μg / ml, and 0.16 μg / ml. Data were plotted as relative inhibition versus antagonist concentration (see Figures 2a-l). Maximum inhibition by individual antibodies is shown in Table 3.

[0313] [Table 5]

[0314] Example 3 - Stabilization of hADM by anti-ADM antibodies The stabilization effect of human ADM by human ADM antibodies was tested using a hADM immunoassay.

[0315] Immunoassay for quantification of human adrenomedullin The technology used was a sandwich-coated tube luminescence immunoassay based on acridinium ester labels.

[0316] Labeled compound (tracer): 100 μg (100 μl) of CT-H (1 mg / ml in PBS, pH 7.4, AdrenoMed AG, Germany) was mixed with 10 μl of acridinium NHS-ester (1 mg / ml in acetonitrile, InVent GmbH, Germany) (EP 0353971) and incubated for 20 minutes at room temperature. Labeled CT-H was purified by gel filtration HPLC using Bio-Sil® SEC 400-5 (Bio-Rad Laboratories, Inc., USA). Purified CT-H was diluted in (300 mmol / L potassium phosphate, 100 mmol / L NaCl, 10 mmol / L Na-EDTA, 5 g / L bovine serum albumin, pH 7.0). The final concentration was approximately 800,000 relative light units (RLU) of labeled compound (approximately 20 ng of labeled antibody) per 200 μL. Acridinium ester chemiluminescence was measured using an AutoLumat LB 953 (Berthold Technologies GmbH & Co. KG).

[0317] Solid phase: Polystyrene tubes (Greiner Bio-One International AG, Austria) were coated with MR-H (AdrenoMed AG, Germany) (1.5 μg MR-H / 0.3 mL 100 mmol / L NaCl, 50 mmol / L Tris / HCl, pH 7.8) for 18 h at room temperature. After blocking with 5% bovine serum albumin, the tubes were washed with PBS, pH 7.4, and vacuum dried.

[0318] Calibration: The assay was calibrated using a dilution of hADM (BACHEM AG, Switzerland) in 250 mmol / L NaCl, 2 g / L Triton X-100, 50 g / L bovine serum albumin, 20 tablets / L Protease Inhibitor Cocktail (Roche Diagnostics AG, Switzerland).

[0319] hADM immunoassay: 50 μl of sample (or calibrator) was pipetted into the coated tubes after addition of labeled CT-H (200 μl), and the tubes were incubated for 4 h at 4° C. Unbound tracer was removed by five washes (1 ml each) with washing solution (20 mM PBS, pH 7.4, 0.1% Triton X-100).

[0320] Tube-bound chemiluminescence was measured by using LB 953: Figure 3 shows a typical hADM dose / signal curve and the hADM dose-signal curve in the presence of 100 μg / mL of antibody NT-H. NT-H did not affect the hADM immunoassay described.

[0321] Stability of human adrenomedullin: Human ADM was diluted in human citrated plasma (final concentration 10 nM) and incubated at 24°C. At selected time points, degradation of hADM was stopped by freezing at -20°C. Incubations were performed in the absence and presence of NT-H (100 μg / ml). Remaining hADM was quantified using the hADM immunoassay described above.

[0322] Figure 4 shows the stability of hADM in human plasma (citrate) in the absence and presence of NT-H antibody. The half-life of hADM alone was 7.8 hours, and in the presence of NT-H, the half-life was 18.3 hours (2.3-fold greater stability).

[0323] Example 4 - Sepsis mortality in mice treated with anti-ADM antibodies 4) Early treatment of sepsis Animal Model: Male C57B1 / 6 mice (Charles River Laboratories, Germany) aged 12 to 15 weeks were used for the study. Peritonitis was surgically induced under light 79-isofluorane anesthesia. An incision was made in the left upper quadrant of the peritoneal cavity (normal location of the cecum). The cecum was exposed, and a tight ligature was placed around it, sutured distal to the insertion of the small intestine. A single puncture wound was made in the cecum using a 24-gauge needle, and a small amount of cecal contents was expressed through the wound. The cecum was returned to the peritoneal cavity, and the abdominal incision was closed. Finally, the animals were returned to their cages with free access to food and water. 500 μl of saline was given subcutaneously as fluid replacement.

[0324] Application and dosage of compounds (NT-M, MR-M, CT-M): Mice were treated immediately after CLP (early treatment), where CLP is an abbreviation for cecal ligation and puncture (CLP).

[0325] Study Groups: Three compounds were tested against vehicle and control compound treatment. Each group contained five mice, with blood drawn one day later for BUN (blood urea nitrogen) determination. Ten additional mice per group were followed over a four-day period.

[0326] Group Treatment (10 μl / g body weight) Dose / Follow-up: 1 NT-M, 0.2mg / ml, survived for 4 days 2 MR-M, 0.2mg / ml Survival over 4 days 3 CT-M, 0.2mg / ml Survival over 4 days 4 Nonspecific mouse IgG, 0.2 mg / ml, survival over 4 days 5 Control - PBS 10 μl / g body weight Survival over 4 days

[0327] Clinical Chemistry: Blood urea nitrogen (BUN) concentrations for renal function were measured at baseline and 1 day after CLP. Blood samples were obtained from the cavernous sinus with capillaries under light ether anesthesia. Measurements were performed using an AU 400 Olympus Multianalyser. The 4-day mortality rate and mean BUN concentrations are shown in Table 4.

[0328] [Table 6]

[0329] Table 4 shows that the NT-M antibody significantly reduced mortality. After four days, 70% of the mice treated with the NT-M antibody survived. After four days, 30% of the animals treated with the MR-M antibody survived, and 10% of the animals treated with the CT-M antibody survived. In contrast, after four days, all mice treated with nonspecific mouse IgG died. The same results were obtained in the control group, in which mice were administered phosphate-buffered saline (PBS). Blood urea nitrogen (BUN) tests are used to assess kidney function, aid in the diagnosis of kidney disease, and monitor patients with acute or chronic kidney dysfunction or failure. The S-BUN test results revealed that the NT-M antibody was most effective in protecting the kidneys.

[0330] b) Late-stage treatment of sepsis Animal Model: Male C57Bl / 6 mice (Charles River Laboratories, Germany) aged 12 to 15 weeks were used for the study. Peritonitis was surgically induced under light 80-mL isoflurane anesthesia. An incision was made in the left upper quadrant of the peritoneal cavity (normal location of the cecum). The cecum was exposed, and a tight ligature was placed around it, sutured distal to the insertion of the small intestine. A single puncture wound was made in the cecum using a 24-gauge needle, and a small amount of cecal contents was expressed through the wound. The cecum was returned to the peritoneal cavity, and the abdominal incision was closed. Finally, the animals were returned to their cages with free access to food and water. 500 μl of saline was given subcutaneously as fluid replacement.

[0331] Compound (NT-M FAB2) application and dosage: NT-M FAB2 was tested against vehicle and control compound treatment. Treatment was administered 6 hours after CLP, after the full onset of sepsis (late treatment). Each group contained 4 mice and was followed over a 4-day period.

[0332] Group Treatment (10 μl / g body weight) Dose / Follow-up: 1 NT-M, FAB2 0.2mg / ml survived for 4 days 2 Control non-specific mouse IgG, 0.2 mg / ml, survived for 4 days 3 Vehicle: PBS 10 μl / g body weight Survival over 4 days

[0333] [Table 7]

[0334] It can be seen from Table 5 that the NT-M FAB2 antibody significantly reduced mortality. After 4 days, 75% of the mice treated with the NT-M FAB2 antibody survived. In contrast, when treated with nonspecific mouse IgG, all mice died after 4 days. The same results were obtained in the control group, in which mice were administered PBS (phosphate-buffered saline).

[0335] Example 5 - Administration of NT-H in healthy humans The study was conducted in healthy male subjects as a randomized, double-blind, placebo-controlled study, in which single ascending doses of NT-H antibody were administered as intravenous (iv) infusion in three consecutive groups (0.5 mg / kg in group 1, 2 mg / kg in group 2, and 8 mg / kg in group 3) of eight healthy male subjects (n = 6 active, n = 2 placebo for each group). Key inclusion criteria were written informed consent, age 18-35 years, reliable method of contraception, and a daily intake of 18-30 kg / m. 2It was agreed that the BMI of the subjects would be used. Subjects received a single intravenous dose of NT-H antibody (0.5 mg / kg; 2 mg / kg; 8 mg / kg) or placebo by slow infusion over a 1-hour period in the study unit. Baseline ADM values in the four groups did not differ. Median ADM values were 7.1 pg / mL in the placebo group, 6.8 pg / mL in the first treatment group (0.5 mg / kg), 5.5 pg / mL in the second treatment group (2 mg / kg), and 7.1 pg / mL in the third treatment group (8 mg / mL). Results showed that after administration of NT-H antibody in healthy human individuals, ADM values rapidly increased within the first 1.5 hours, then reached a plateau, and slowly declined (Figure 6).

[0336] Example 6 - Methods for measuring DPP3 protein and DPP3 activity Generation of antibodies and determination of DPP3 binding ability: Several murine antibodies were generated and screened for their ability to bind to human DPP3 in a specific binding assay (see Table 6).

[0337] Peptides / conjugates for immunization: For conjugation of peptides to bovine serum albumin (BSA), DPP3 peptides for immunization were synthesized with an additional N-terminal cysteine residue (if no cysteine was present in the selected DPP3 sequence) (see Table 6) (JPT Technologies, Berlin, Germany). Peptides were covalently linked to BSA using Sulfolink coupling gel (Perbio-science, Bonn, Germany). The coupling procedure was performed according to the Perbio manual. Recombinant GST-hDPP3 was produced by USBio (United States Biological, Salem, MA, USA).

[0338] Mouse immunization, immunocytofusion, and screening: Balb / c mice were intraperitoneally (ip) injected with 84 μg of GST-hDPP3 or 100 μg of DPP3-peptide-BSA conjugate (emulsified in TiterMax Gold Adjuvant) on day 0, 84 μg or 100 μg (emulsified in complete Freund's adjuvant) on day 14, and 42 μg or 50 μg (emulsified in incomplete Freund's adjuvant) on days 21 and 28. On day 49, animals received an intravenous (iv) injection of 42 μg of GST-hDPP3 or 50 μg of DPP3-peptide-BSA conjugate dissolved in saline. Three days later, mice were sacrificed and immunocytofusion was performed.

[0339] Splenocytes from immunized mice and cells of the myeloma cell line SP2 / 0 were fused with 1 ml of 50% polyethylene glycol at 37°C for 30 seconds. After washing, the cells were seeded into 96-well cell culture plates. Hybrid clones were selected by growing them in HAT medium (RPMI 1640 culture medium supplemented with 20% fetal bovine serum and HAT supplement). After one week, the HAT medium was replaced with HT medium for three passages, followed by a return to normal cell culture medium. Cell culture supernatants were primarily screened for recombinant DPP3-binding IgG antibodies two weeks after fusion. Therefore, recombinant GST-tagged hDPP3 (USBiologicals, Salem, USA) was immobilized on a 96-well plate (100 ng / well) and incubated with 50 μl of cell culture supernatant per well at room temperature for 2 hours. After washing the plate, 50 μl / well of POD rabbit anti-mouse IgG was added and incubated at room temperature for 1 hour. After a subsequent washing step, 50 μl of chromogen solution (o-phenylenediamine, 0.012% HO in 3.7 mM citrate / hydrogen phosphate buffer) was added to each well and incubated for 15 minutes at room temperature, and the color reaction was stopped by adding 50 μl of 4 N sulfuric acid. Absorbance was detected at 490 mm. Positive-testing microcultures were transferred to 24-well plates for expansion. After retesting, selected cultures were cloned and recloned using limiting dilution techniques and isotyped.

[0340] Mouse monoclonal antibody production Antibodies raised against GST-tagged human DPP3 or DPP3-peptides were produced by standard antibody production methods (Marx et al. 1997) and purified with protein A. Antibody purity was ≥90% based on SDS gel electrophoresis analysis.

[0341] Characterization of Antibodies—Binding to hDPP3 and / or Immunizing Peptide To analyze the ability of different antibodies and antibody clones to bind DPP3 / immunizing peptide, binding assays were performed: Solid phase: Recombinant GST-tagged hDPP3 (SEQ ID NO: 36) or DPP3 peptide (immunizing peptide, SEQ ID NO: 37) was immobilized on the surface of a high-binding microtiter plate (96-well polystyrene microplate, Greiner Bio-One international AG, Austria, 1 μg / well in coupling buffer [50 mM Tris, 100 mM NaCl, pH 7.8], room temperature for 1 h). After blocking with 5% bovine serum albumin, the microplate was dried under vacuum.

[0342] Labeling procedure (tracer): 100 μg (100 μl) of different anti-DPP3 antibodies (detection antibodies, 1 mg / ml in PBS, pH 7.4) were mixed with 10 μl of acridinium NHS-ester (1 mg / ml in acetonitrile, InVent GmbH, Germany; EP 0353971) and incubated at room temperature for 30 minutes. The labeled anti-DPP3 antibodies were purified by gel filtration HPLC using Shodex Protein 5 μm KW-803 (Showa Denko, Japan). The purified labeled antibodies were diluted in assay buffer (50 mmol / L potassium phosphate, 100 mmol / L NaCl, 10 mmol / L Na2-EDTA, 5 g / L bovine serum albumin, 1 g / L mouse IgG, 1 g / L bovine IgG, 50 μmol / L amastatin, 100 μmol / L leupeptin, pH 7.4). The final concentration is approximately 5-7*10 per 200 μl. 6 Relative light units (RLU) of labeled compound (approximately 20 ng of labeled antibody) Acridinium ester chemiluminescence was measured by using a Centro LB 960 luminometer (Berthold Technologies GmbH & Co. KG).

[0343] hDPP3 binding assay: Plates were filled with 200 μl of labeled and diluted detection antibody (tracer) and incubated for 2-4 hours at 2-8°C. Unbound tracer was removed by washing four times with 350 μl of washing solution (20 mM PBS, pH 7.4, 0.1% Triton X-100). Fully bound chemiluminescence was measured using a Centro LB 960 luminometer (Berthold Technologies GmbH & Co. KG).

[0344] Antibody characterization - hDPP3 inhibition analysis To analyze the DPP3 inhibitory potential of different antibodies and antibody clones, a DPP3 activity assay (Jones et al., 1982) was performed using a known procedure. Recombinant GST-tagged hDPP3 was diluted in assay buffer (25 ng / ml GST-DPP3 in 50 mM Tris-HCl, pH 7.5, and 100 μM ZnCl), and 200 μl of this solution was incubated with 10 μg of each antibody at room temperature. After 1 h of preincubation, the fluorogenic substrate Arg-Arg-βNA (20 μl, 2 mM) was added to the solution, and the generation of free βNA was monitored over time at 37 °C using a Twinkle LB 970 microplate fluorometer (Berthold Technologies GmbH & Co. KG). βNA fluorescence was detected by exciting at 340 nm and measuring emission at 410 nm. The slope of increasing fluorescence (in RFU / min) of different samples was calculated. The slope of GST-hDPP3 in the buffer control was defined as 100% activity. The inhibitory capacity of a potential capture binding agent is defined as the reduction in GST-hDPP3 activity by incubation with that capture binding agent in percent.

[0345] The following table presents a selection of the antibodies obtained and their binding rates in relative light units (RLU) and their relative inhibitory potency (%) (Table 6). Monoclonal antibodies generated against the DPP3 regions depicted below were selected for their ability to bind to recombinant DPP3 and / or the immunizing peptide, as well as for their inhibitory potential.

[0346] All antibodies raised against the GST-tagged full-length form of recombinant hDPP3 show strong binding to immobilized GST-tagged hDPP3. Antibodies raised against the SEQ ID NO: 37 peptide similarly bind to GST-hDPP3. The SEQ ID NO: 37 antibody also binds strongly to the immunizing peptide.

[0347] The development of a luminescent immunoassay (DPP3-LIA) for quantification of DPP3 protein concentration and an enzyme capture activity assay (DPP3-ECA) for quantification of DPP3 activity has recently been described (Rehfeld et al. 2019. JALM 3(6):943-953), which is incorporated herein by reference in its entirety.

[0348] [Table 8]

[0349] Example 7 - Development of Procizumab The antibodies generated against SEQ ID NO: 37 were characterized in more detail (epitope mapping, binding affinity, specificity, inhibitory potential). Here, the results for clone 1967 of SEQ ID NO: 37 (AK1967; "Procizumab") are shown as an example.

[0350] Determination of AK1967 epitope on DPP3: For epitope mapping of AK1967, several N- or C-terminally biotinylated peptides were synthesized (peptides&elephants GmbH, Hennigsdorf, Germany). These peptides comprise the sequence of the complete immunization peptide (SEQ ID NO: 37) or fragments thereof, with stepwise removal of one amino acid from either the C- or N-terminus (see Table 8 for a complete list of peptides).

[0351] High-binding 96-well plates were coated with 2 μg of avidin (Greiner Bio-One International AG, Austria) per well in coupling buffer (500 mM Tris-HCl, pH 7.8, 100 mM NaCl). Plates were then washed and filled with a specific solution of biotinylated peptide (10 ng / well; buffer—1x PBS with 0.5% BSA).

[0352] The anti-DPP3 antibody AK1967 was labeled with a chemiluminescent label according to Example 6.

[0353] The plate was filled with 200 μl of labeled and diluted detection antibody (tracer) and incubated for 4 hours at room temperature. Unbound tracer was removed by washing four times with 350 μl of washing solution (20 mM PBS, pH 7.4, 0.1% Triton X-100). The fully bound chemiluminescence was measured using a Centro LB 960 luminometer (Berthold Technologies GmbH & Co. KG). The binding of AK1967 to each peptide was determined by evaluation of relative light units (RLU). Any peptide showing an RLU signal significantly higher than the nonspecific binding of AK1967 was defined as an AK1967 binder. Combined analysis of bound and non-bound peptides revealed the specific DPP3 epitope of AK1967.

[0354] Determining Binding Affinity Using Octet: Experiments were performed using Octet Red 96 (ForteBio). AK1967 was captured on a kinetic-grade anti-human Fc (AHC) biosensor. The loaded biosensor was then immersed in a dilution series of recombinant GST-tagged human DPP3 (100, 33.3, 11.1, 3.7 nM). Association was observed for 120 seconds, followed by dissociation for 180 seconds. The buffers used in the experiments are depicted in Table 7. Kinetic analysis was performed using a 1:1 binding model and global fitting.

[0355] [Table 9]

[0356] Western blot analysis of the binding specificity of AK1967: Blood cells from human EDTA blood were washed (three times with PBS), diluted in PBS, and lysed by repeated freeze-thaw cycles. The blood cell lysate had a total protein concentration of 250 μg / ml and a DPP3 concentration of 10 μg / ml. Dilutions of blood cell lysate (1:40, 1:80, 1:160, and 1:320) and purified recombinant human His-DPP3 (31.25–500 ng / ml) were subjected to SDS-PAGE and Western blotting. Blots were incubated in 1) blocking buffer (1x PBS-T containing 5% nonfat dry milk), 2) primary antibody solution (AK1967 1:2,000 in blocking buffer), and 3) HRP-conjugated secondary antibody (goat anti-mouse IgG 1:1,000 in blocking buffer). Bound secondary antibodies were detected using Amersham ECL Western Blotting Detection Reagent and an Amersham Imager 600 UV (both from GE Healthcare).

[0357] DPP3 Inhibition Assay: To analyze the ability of AK1967 to inhibit DPP3, a DPP3 activity assay (Jones et al., 1982) was performed using known procedures as described in Example 6. The inhibitory ability of AK1967 was defined as the percent reduction in GST-hDPP3 activity upon incubation with the antibody. The resulting reduced DPP3 activity is shown in the inhibition curve in Figure 7.

[0358] Epitope mapping: Analysis of AK1967-binding and non-binding peptides revealed the DPP3 sequence INPETG (SEQ ID NO: 38) as the epitope required for AK1967 binding (see Table 8).

[0359] Binding affinity: AK1967 is 2.2*10 -9 It binds to recombinant GST-hDPP3 with an affinity of M (see Figure 8 for kinetic curves).

[0360] [Table 10]

[0361] Specificity and inhibitory potential: The only protein detected with AK1967 as the primary antibody in the blood cell lysate was DPP3 at 80 kDa (Figure 9). The total protein concentration of the lysate was 250 μg / ml, but the estimated DPP3 concentration was approximately 10 μg / ml. Even though there were 25 times more nonspecific proteins in the lysate, AK1967 specifically bound to DPP3 and detected DPP3 specifically, without any other nonspecific binding.

[0362] AK1967 inhibits 15 ng / ml of DPP3 in a specific DPP3 activity assay, with an IC50 of approximately 15 ng / ml (Figure 7).

[0363] Chimerization / Humanization: The monoclonal antibody AK1967 ("Procizumab"), which has the ability to inhibit DPP3 activity by 70%, was selected as a potential therapeutic antibody and was also used as a template for chimerization and humanization.

[0364] Humanization of a murine antibody can be performed according to the following procedure: For humanization of antibodies of murine origin, the antibody sequence is analyzed for the structural interactions of the complementarity-determining regions (CDRs) and framework regions (FRs) with the antigen. Based on structural modeling, appropriate FRs of human origin are selected, and the murine CDR sequences are grafted onto the human FRs. Mutations in the amino acid sequences of the CDRs or FRs can be introduced to restore structural interactions lost due to species conversion to the FR sequences. This restoration of structural interactions can be achieved by a random approach using a phage display library or through a directed approach guided by molecular modeling (Almagro and Fransson, 2008. Humanization of antibodies. Front Biosci. 13:1619-33).

[0365] In connection with the above, the variable regions can be attached to any subclass of constant region (IgG, IgM, IgE, IgA) or to a single scaffold, Fab fragment, Fv, Fab, and F(ab)2. Mouse antibody variants contain an IgG2a backbone. For chimerization and humanization, a human IgG1κ backbone was used.

[0366] For epitope binding, only the complementarity determining regions (CDRs) are important. The CDRs for the heavy and light chains of the murine anti-DPP3 antibody (AK1967; "Procizumab") are shown in SEQ ID NO: 42, SEQ ID NO: 43, and SEQ ID NO: 44 for the heavy chain, and SEQ ID NO: 45, SEQ ID NO: KVS, and SEQ ID NO: 46 for the light chain, respectively.

[0367] Sequencing of the anti-DPP3 antibody (AK1967; "Procizumab") revealed an antibody heavy chain variable region (H chain) according to SEQ ID NO: 47 and an antibody light chain variable region (L chain) according to SEQ ID NO: 48.

[0368] Example 8 - Effect of Procizumab on Sepsis-Induced Heart Failure In this experiment, the effect of procizumab injection in rats with sepsis-induced heart failure (Rittirsch et al. 2009) was studied by monitoring fractional shortening.

[0369] CLP model of septic shock: Male Wistar rats (2-3 months, 300-400 g; group sizes see Table 9) from the Centre d'Elevage Janvier (France) were randomly assigned to one of three groups. All animals were anesthetized intraperitoneally (ip) using ketamine hydrochloride (90 mg / kg) and xylazine (9 mg / kg). For induction of polymicrobial sepsis, cecal ligation and puncture (CLP) was performed using the Rittirsch protocol with minor modifications. A ventral midline incision (1.5 cm) was made to exteriorize the cecum. The cecum was then ligated just below the ileocecal valve and punctured once with an 18-gauge needle. The abdominal cavity was then closed in two layers, followed by fluid resuscitation (3 ml / 100 g body weight of saline was injected subcutaneously), and the animals were returned to their cages. Sham animals were subjected to surgery without puncturing their cecum. CLP animals were randomized between placebo and therapeutic antibody.

[0370] Research design: The study flow is depicted in Figure 8. After CLP or sham surgery, animals were allowed to rest for 20 hours with free access to water and food. They were then anesthetized, a tracheotomy was performed, and arterial and venous lines were placed. Twenty-four hours after CLP surgery, either AK1967 or vehicle (saline) was administered as a bolus injection at 5 mg / kg, followed by a 3-hour infusion at 7.5 mg / kg. As a safety measure, hemodynamics was monitored invasively and continuously from t = 0 to 3 hours.

[0371] At t=0 (baseline), all CLP animals were in septic shock and developed reduced cardiac function (hypotension, reduced fractional shortening). At this point, procizumab or vehicle (PBS) was injected (iv) and saline infusion was initiated. There was one control group and two CLP groups, which are summarized in the table below (Table 9). At the end of the experiment, animals were euthanized and organs were harvested for subsequent analysis.

[0372] [Table 11]

[0373] Invasive blood pressure: Hemodynamic changes were obtained using the AcqKnowledge system (BIOPAC Systems, Inc., USA), which provides a fully automated blood pressure analysis system. The catheter was connected to the BIOPAC system via a pressure sensor.

[0374] For this procedure, rats were anesthetized (ketamine and xylazine). The animals were transferred to a heating pad to achieve the desired body temperature of 37-37.5°C. A temperature feedback probe was inserted into the rectum. The rat was placed supine on the operating table. The trachea was opened, and a catheter (16G) for external ventilation was inserted without damaging the carotid artery or vagus nerve. An arterial catheter was inserted into the right carotid artery. The carotid artery was separated from the vagus nerve before ligation. A central venous catheter was inserted through the left jugular vein to allow for the administration of PCZ or PBS. After surgery, the animals were allowed to rest in a stable state before hemodynamic measurements were taken. Baseline blood pressure (BP) was then recorded. During data collection, saline infusion through the arterial line was stopped.

[0375] Echocardiography: Animals were anesthetized using ketamine hydrochloride. The chest was shaved, and the rats were placed in a supine position. A commercially available GE Healthcare Vivid7 ultrasound system equipped with a high-frequency (14 MHz) linear probe and a 10 MHz cardiac probe was used for transthoracic echocardiographic (TTE) examinations. All examinations were digitally recorded and stored for subsequent offline analysis.

[0376] Grayscale images were recorded at a depth of 2 cm. Two-dimensional examinations were performed starting with a parasternal long-axis view to measure the aortic annulus diameter and pulmonary artery diameter. M-mode was also used to measure left ventricular (LV) dimensions and assess fractional shortening (FS%). LVFS was calculated as LV end-diastolic diameter - LV end-systolic diameter / LV end-diastolic diameter and expressed as a percentage. Therefore, the time of end-diastole was defined at the maximum LV diameter. Therefore, end-systole was defined as the minimum diameter during the same cardiac cycle. All parameters were measured manually. Three cardiac cycles were averaged for each measurement.

[0377] Pulse-wave Doppler was used to record pulmonary artery flow from the same parasternal long-axis view. The velocity-time integral of pulmonary artery outflow was measured. Pulse-wave Doppler was used to record mitral flow from the apical five-chamber view at the level of the mitral valve tip.

[0378] result: Sepsis-induced heart failure rats treated with PBS (CLP+PBS) show reduced fractional shortening compared to sham animals (Figure 10A). The CLP+PBS group also shows a high mortality rate (Figure 10B). In contrast, application of procizumab to sepsis-induced heart failure rats improves fractional shortening (Figure 10A) and dramatically reduces mortality (Figure 10B).

[0379] Example 9 - Effect of Procizumab on cardiac and renal function The effect of procizumab on isoproterenol-induced heart failure in mice was studied by monitoring the shortening fraction and renal resistive index.

[0380] Isoproterenol-induced cardiac stress in mice: Acute heart failure was induced in 3-month-old male mice by subcutaneous injection of 300 mg / kg isoproterenol, a nonselective β-adrenergic agonist (DL-isoproterenol hydrochloride, Sigma Chemical Co.) (isoproterenol, ISO), twice daily for 2 days (Vergaro et al., 2016). ISO dilutions were made in 0.9% NaCl. Isoproterenol-treated mice were randomly assigned to two groups (Table 10). PBS or procizumab (10 mg / kg) was intravenously injected after baseline echocardiography (Gao et al., 2011). Renal resistive index measurements (Lubas et al., 2014, Dewitte et al., 2012) were performed on day 3 (Figures 11A and 11B). Cardiac function was assessed by echocardiography (Gao et al., 2011) and renal resistive index (Lubas et al., 2014, Dewitte et al., 2012) at 1, 6, and 24 hours (Figures 11A and 11B). A group of mice injected with vehicle (PBS) instead of isoproterenol received no further pharmacological treatment and served as a control group (Table 10).

[0381] [Table 12]

[0382] result: The application of PCZ to mice with isoproterenol-induced heart failure restored cardiac function within the first hour after administration (Figure 12A). The kidney function of diseased mice showed a significant improvement 6 hours after PCZ injection and was comparable to that of sham animals 24 hours later (Figure 12B).

[0383] Example 10 - DPP3 and organ dysfunction in sepsis The AdrenOSS-1 study is a prospective, multicentric, observational study in patients with severe sepsis and septic shock (ClinicalTrials.gov NCT02393781). Twenty-four centers in five European countries (France, Belgium, the Netherlands, Italy, and Germany) contributed to the study with 583 enrolled patients (recruited between June 2015 and May 2016). Of the 583 enrolled patients, 581 had DPP3 plasma levels measured. The study protocol was approved by the local ethics committee and conducted in accordance with the Declaration of Helsinki. Patients aged 18 years or older who (1) were admitted to an ICU for sepsis or septic shock or (2) were transferred from another ICU with sepsis or septic shock within 24 hours of admission were enrolled. Included patients were stratified by severe sepsis and septic shock based on definitions of sepsis and organ failure from 2001 (Levy et al. 2003. 2001 SCCM / ESICM / ACCP / ATS / SIS International Sepsis Definitions Conference. Crit Care Med. 31(4):1250-6). Patients were treated according to local practice, and treatments and procedures were registered. The primary outcome was 28-day mortality. Secondary outcomes were organ failure (defined by Sequential Organ Failure Assessment (SOFA) score), and use of organ support, vasopressor / inotrope use, fluid balance, and renal replacement therapy (RRT).

[0384] At admission, demographics (age, sex), body mass index, presence of septic shock, type of ICU admission, organ dysfunction score (SOFA, Acute Physiologic Assessment and Chronic Health Evaluation II [APACHE II]), origin of sepsis, pre-existing complications (i.e., treated within the last year), past medical history, laboratory values, and organ support were recorded, and blood was drawn for measurement of bioADM and other markers. After patient enrollment, the following data were collected daily for the first week: SOFA score, antimicrobial therapy, fluid balance, respiratory status, Glasgow Coma Scale score, central venous pressure, need for RRT, invasive procedures for sepsis control, and vasopressor / inotrope therapy. Furthermore, discharge status and mortality were recorded on the 28th day after ICU admission. Blood samples for central laboratory testing were collected within 24 hours of ICU admission and 2 days after the first sample (mean 47 hours, SD 9 hours). Samples were then processed and stored at -80°C.

[0385] DPP3 measurement: To determine DPP3 levels in patient plasma, immunoassays (LIA) or enzyme activity assays (ECA) were used to detect the amount (LIA) or activity (ECA) of human DPP3, respectively. Antibody immobilization, labeling, and incubation were performed as described by Rehfeld et al. (Rehfeld et al. 2019. JALM 3(6):943-953).

[0386] The AdrenoSS-1 study was used to evaluate the association between circulating DPP3 and organ dysfunction (e.g., cardiovascular and renal dysfunction) in patients hospitalized for sepsis and septic shock. The median DPP3 level measured at admission in all AdrenoSS-1 patients was 45.1 ng / mL (interquartile range 27.5-68.6). Higher DPP3 levels measured at admission were associated with worse metabolic parameters, renal and cardiac function, and SOFA scores: patients with DPP3 levels below the median had a median SOFA score (points) of 6 (IQR 4-9) compared with a median SOFA score of 8 (IQR 5-11) for patients with DPP3 levels above the median of 45.1 ng / mL (Figure 13).

[0387] Regardless of DPP3 levels at admission, high DPP3 levels at 24 hours were associated with the worst SOFA scores, whether overall (Figure 14) or by organ (Figures 15A-15F).

[0388] In summary, these data demonstrated that high DPP3 levels are associated with survival and the degree of organ dysfunction in a large international cohort of patients with sepsis or septic shock. This study found a significant association between DPP3 levels <45.1 ng / ml on admission and short-term survival, and a prognostic cutoff value of 45.1 pg / ml in both sepsis and septic shock. Regarding organ dysfunction, there was a positive relationship between DPP3 levels on ICU admission and the SOFA score. More importantly, the relationship between DPP3 levels and the degree of organ dysfunction observed on ICU admission also held true during the recovery phase. Indeed, patients with high DPP3 levels on admission who showed a decline to normal DPP3 levels on day 2 were more likely to recover all organ function, including cardiovascular, renal, pulmonary, and hepatic functions.

[0389] Example 11 - DPP3 in septic and cardiogenic shock DPP3 concentrations were determined in the plasma of patients with sepsis / septic shock and cardiogenic shock and were related to their short-term mortality.

[0390] a) Study Cohort - Sepsis / Septic Shock The same study as in Example 10 was analyzed (AdrenOSS-1), in which 292 of 583 patients were diagnosed with septic shock.

[0391] b) Study cohort - cardiogenic shock Plasma samples from 108 patients diagnosed with cardiogenic shock were screened for DPP3. Blood samples were collected within 6 hours of detection of cardiogenic shock. Mortality was tracked for 7 days.

[0392] Results: Short-term patient survival in sepsis patients was associated with DPP3 plasma concentrations at admission. Patients with DPP3 plasma concentrations above 40.5 ng / mL (third quartile) had an increased risk of death compared with patients with DPP3 plasma concentrations below this threshold (Figure 16A). When this cutoff was applied to a subcohort of patients with septic shock, an even more pronounced risk of short-term mortality was revealed for high DPP3 plasma concentrations (Figure 16B). When the same cutoff was applied to patients with cardiogenic shock, an increased risk of short-term mortality within 7 days was also observed in patients with high DPP3 (Figure 16C).

[0393] Example 12 - Prediction of DPP3 Increase in Sepsis and Septic Shock (AdrenOSS-1) The AdrenOSS-1 study described in Example 10 was used to analyze whether baseline DPP3 levels may be able to predict increases in DPP3 in subsequent days.

[0394] result: DPP3 plasma levels in septic shock patients (n=292) at baseline (day 1, DPP3.d1) were statistically analyzed to determine a threshold for predicting an increase in DPP3 plasma concentrations above 50 ng / ml in subsequent days. A DPP3 concentration of 50 ng / ml reflects the threshold above which patients a) exceed the upper normal DPP3 limit, b) have increased organ dysfunction and mortality (see Example 11; Blet et al. 2021. Crit Care 25(1):61), and c) have been shown to have a lower therapeutic response to the N-terminal ADM antibody adrecizumab (WO 2021 / 170838).

[0395] [Table 13]

[0396] Different DPP3 thresholds at baseline (d1) were analyzed for their ability to predict the percentage of patients with DPP3 plasma concentration increases above 50 ng / ml on subsequent days (days 2 and 3). Table 11 shows that the lower the DPP3 plasma concentration at baseline (DPP3.d1), the lower the percentage of patients with DPP3 increases above 50 ng / ml on subsequent days. In this septic shock population, 223 and 156 patients had DPP3 concentrations below <50 or <30 ng / ml, respectively, at baseline. Of the 156 patients with DPP3 concentrations below 30 ng / ml at baseline, 7 (4%) patients showed increases in DPP3 concentrations above the 50 ng / ml DPP3 threshold on subsequent days. On the other hand, among 67 septic shock patients with baseline DPP3 plasma concentrations of 30-50 ng / ml, 15 (22.4%) patients experienced an increase in their DPP3 plasma levels above 50 ng / ml over the following days. Consequently, a low DPP3 threshold (in the range of 22 ng / ml to 40 ng / ml) is suitable for predicting late increases in DPP3, which can be used for baseline treatment decisions, such as for the use of anti-ADM (adrecizumab) therapy in patients with septic shock. A low DPP3 concentration threshold at baseline (d1) ensures that the DPP3 pathological pathway (associated with high short-term organ dysfunction and mortality) is not the predominant pathway in the selected septic shock population. Therefore, this septic shock population with baseline DPP3 concentrations below the aforementioned threshold range may benefit more from, for example, anti-ADM antibody therapy (adrecizumab).

[0397] In the second step, we analyzed the septic shock population with bioADM plasma concentrations greater than 70 pg / ml. BioADM concentrations greater than 70 pg / ml have been associated with sepsis severity and the development of organ dysfunction, including vasopressor / inotrope dependence (Marino et al. 2014. Critical Care 18:R34; Caironi et al. 2017. Chest 152(2):312-320; Mebazaa et al. 2018. Crit Care 22:354). Different DPP3 thresholds at baseline (d1) were analyzed for their ability to predict the percentage of patients with DPP3 plasma concentration increases greater than 50 ng / ml in subsequent days. Table 12 also shows that the lower the DPP3 plasma concentration at baseline (DPP3.d1), the lower the percentage of septic shock patients with high bioADM who have DPP3 increases greater than 50 ng / ml in subsequent days. In this septic shock and high bioADM population, 154 and 100 patients had baseline DPP3 concentrations below 50 or <30 ng / ml, respectively. Of the 100 patients with baseline DPP3 concentrations below 30 ng / ml, 4 (4%) patients showed increases in DPP3 concentrations above the 50 ng / ml DPP3 threshold over the next 2 days. On the other hand, of the 54 septic shock patients with baseline DPP3 plasma concentrations between 30 and 50 ng / ml, 13 (24.1%) patients had DPP3 plasma levels increase above 50 ng / ml over the next few days.

[0398] [Table 14]

[0399] Example 13 - NT-ADM antibody (AdrenOSS-2) in patients with septic shock AdrenOSS-2 is a double-blind, placebo-controlled, randomized, multicenter, proof-of-concept, dose-ranging phase II clinical trial investigating the safety, tolerability, and efficacy of an N-terminal ADM antibody named adrenoceptor (adrenoceptor 1) in patients with septic shock and elevated adrenomedullin levels (Geven et al. BMJ Open 2019;9:e024475). A total of 301 patients with septic shock and elevated adrenomedullin levels were randomized (2:1:1) to receive either placebo (n=152), adrenoceptor 2 ng / kg (n=72), or adrenoceptor 4 ng / kg (n=77) as a single intravenous infusion over approximately 1 hour. All-cause mortality within 28 (90) days after enrollment was 25.8% (34.8%). The mean age was 68.4 years, and 61% were male. For the per-protocol analysis, n=294 patients remained eligible and the 14-day all-cause mortality rate was 18.5%.

[0400] In patients treated with adrecizumab (both doses combined, per-protocol population), a trend toward lower short-term mortality (14 days after admission) was observed compared with placebo (hazard ratio (HR) 0.701 [0.408-1.21], p=0.100) (Figure 17). Surprisingly, the treatment effect was more pronounced in patients with admission DPP3 concentrations below 50 ng / mL (n=244, HR 0.426, p=0.007) (Figure 18), whereas in patients with elevated DPP3 (>50 ng / mL, n=44), outcomes were comparable between adrecizumab and placebo (HR 1.69, p=0.209) (Figure 19).

[0401] The treatment effects (14-day mortality) for different DPP3 thresholds are summarized in Table 13.

[0402] [Table 15]

[0403] Example 14 - Lower DPP3 threshold and efficacy of NT-ADM antibody therapy in AdrenOSS-2 To verify the findings from Example 9 and for proof-of-concept purposes, different lower thresholds for DPP3 at baseline (day 1) were evaluated for the efficacy of anti-ADM antibody (adrecizumab) therapy in a septic shock population with high bio-ADM from the AdrenOSS-2 study cohort, and patients with DPP3 plasma levels above the different lower thresholds were excluded from the analysis. The efficacy of anti-ADM antibody therapy was specifically evaluated for mortality endpoints in the placebo and treatment arms.

[0404] result: To assess the efficacy of anti-ADM antibody therapy, DPP3 plasma levels were statistically analyzed at baseline and over the following 144 hours in patients (n = 298) with septic shock due to high bioADM (>70 pg / mL) to determine the baseline DPP3 threshold. Patients with DPP3 levels above the respective plasma threshold were excluded from the analysis. Different DPP3 plasma concentration thresholds were applied to assess 28-day all-cause mortality using Kaplan-Meier plots comparing anti-ADM antibody therapy to placebo. The log-rank test was used to demonstrate differences in mortality between treatment groups. Hazard ratios (HRs) were calculated for each DPP3 plasma concentration threshold to estimate the reduction in risk of death imposed by anti-ADM antibody therapy compared with placebo.

[0405] The baseline DPP3 plasma concentration thresholds used were 50 ng / ml, 40 ng / ml, 30 ng / ml, and 22 ng / ml, respectively. For each threshold, the number of patients excluded from the all-cause mortality analysis was determined. For the 50, 40, 30, and 22 ng / ml thresholds, 16%, 24%, 35%, and 51% of patients were excluded from the analysis, respectively.

[0406] The HRs for each baseline DPP3 plasma concentration threshold for estimating mortality reduction with anti-ADM antibody therapy compared with placebo were also determined. For thresholds of 50, 40, 30, and 22 ng / ml, the HRs were 0.606, 0.568, 0.309, and 0.258, respectively. This analysis indicates that the lower the DPP3 plasma concentration threshold, the greater the mortality reduction in the treatment arm. Similarly, all-cause mortality analysis using Kaplan-Meier analysis indicates that the lower the DPP3 plasma concentration threshold, the more pronounced and significant the mortality reduction in the treatment arm (Figures 20A-D).

[0407] The percentage of patients showing an increase in DPP3 plasma concentration above 50 ng / ml in the following 144 hours was also estimated for each DPP3 plasma concentration threshold at baseline. Similar to the results from the AdrenOSS-1 study in Example 12, the lower the baseline DPP3 plasma concentration threshold, the lower the percentage of patients showing an increase in DPP3 plasma levels above the 50 ng / ml threshold in the following days. In this septic shock and high bioADM population, 249 and 195 patients had DPP3 concentrations below 50 or 30 ng / ml at baseline, respectively. Of the 195 patients with DPP3 concentrations below 30 ng / ml at baseline, 16 (8%) patients showed an increase in DPP3 concentration above the 50 ng / ml DPP3 threshold in the following 6 days. On the other hand, of 54 septic shock patients with baseline DPP3 plasma concentrations of 30-50 ng / ml, 11 (20.4%) patients had DPP3 plasma levels that increased above 50 ng / ml over the following days. These results suggest that a lower DPP3 threshold (well below 50 ng / ml) is appropriate for guiding the use of anti-ADM antibody therapy and for selecting patients likely to benefit from anti-ADM antibody therapy.

[0408] Different thresholds for DPP3 levels at baseline (day 1) were further used in subgroup analyses to assess 28-day all-cause mortality using Kaplan-Meier plots in the treatment and placebo arms comparing anti-ADM antibody therapy (adrecizumab) to placebo. The baseline DPP3 plasma concentration thresholds used were 50 ng / ml and 30 ng / ml.

[0409] When evaluating all-cause mortality in a septic shock population (n = 195) with DPP3 levels below the 30 ng / ml threshold, mortality in the anti-ADM antibody (adrecizumab) therapy arm was surprisingly significantly reduced compared to the placebo arm (Figure 21C). The same results were observed when including only patients with DPP3 values below 50 ng / ml, with mortality in the treatment arm being lower than that in the placebo arm. Finally, when evaluating all-cause mortality from admission to day 28 in septic shock patients with DPP3 levels below 50 ng / ml at baseline and continuously low (<50 ng / ml) DPP3 levels over the next 144 hours, mortality in the treatment arm was significantly lower than that in the placebo arm (Figure 21). As a result, a low DPP3 threshold at baseline (well below 50 ng / ml) is optimal for selecting patients who will benefit most from anti-ADM antibody therapy.

[0410] In summary, patients with baseline DPP3 levels above a threshold of 30 ng / ml are more likely to show increases in DPP3 plasma concentrations over subsequent days. Subsequent increases in DPP3 plasma concentrations above 50 ng / ml are associated with lower efficacy of anti-ADM antibody therapy. Therefore, to stratify patients for anti-ADM antibody therapy, a lower threshold well below 50 ng / ml, preferably in the range of 22 to 40 ng / ml, and most preferably 30 ng / ml, should be used.

Claims

1. 1. A method for prediction of increased dipeptidyl peptidase 3 (DPP3) in a critically ill patient, said method comprising: - determining the level of DPP3 in a sample of the patient's body fluid; comparing the determined level of DPP3 to a predetermined threshold, wherein the threshold is in the range of 40 ng / ml to 22 ng / ml; 10. A method for prediction of increased DPP3 in a critically ill patient, wherein a level of DPP3 in said sample above said predetermined threshold is indicative for increased DPP3 in said patient.

2. The method for prediction of increased DPP3 in critically ill patients according to claim 1, wherein said predetermined threshold is between 30 ng / ml and 22 ng / ml.

3. The method for prediction of increased DPP3 in critically ill patients according to claim 1 or 2, wherein said predetermined threshold is between 25 ng / ml and 22 ng / ml.

4. A method for prediction of an increase in DPP3 in a critically ill patient according to any one of claims 1 to 3, wherein said predicted increase is an increase to a DPP3 level of 40 or more, preferably 50 ng / ml or more.

5. 5. A method for prediction of increased DPP3 in a critically ill patient according to any one of claims 1 to 4, wherein the predicted increase in DPP3 levels is 10% or more, more preferably 20% or more, even more preferably 40% or more, even more preferably 50% or more, even more preferably 75% or more, even more preferably 100% or more.

6. 6. A method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 5, wherein said increase in DPP3 is within a maximum of 12 hours, preferably a maximum of 24, 48, 72, 96 hours, more preferably a maximum of 5 days, even more preferably a maximum of 6 days, and most preferably a maximum of 7 days.

7. 7. The method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 6, wherein said patient is a patient with a severe infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, a patient with organ dysfunction or failure (e.g. liver, kidney, lung dysfunction or failure), a patient undergoing major surgery, a patient with trauma (e.g. burn trauma, polytrauma), a patient with shock and / or a patient in shock state or alternatively ARDS.

8. 8. The method for prediction of increased DPP3 in critically ill patients according to claim 7, wherein the shock is selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock.

9. In the case of cardiogenic shock, the patient may be suffering from an acute coronary syndrome (e.g., acute myocardial infarction), or the patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; or In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, or intestinal obstruction; or In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or - A method for predicting increased DPP3 in critically ill patients as described in claim 8, wherein in the case of distributive shock, the patient may have septic shock, neurogenic shock, anaphylactic shock, or shock due to adrenal crisis.

10. A method for prediction of increased DPP3 in critically ill patients according to any one of claims 7 to 9, wherein said shock is selected from the group comprising cardiogenic shock or septic shock.

11. 11. A method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 10, wherein the patient is selected for therapy / treatment if the level of DPP3 in the sample is below the predetermined threshold, and wherein the therapy is selected from the group of alkaline phosphatase, immunosuppressants, corticosteroids, vasopressors, fluids, anti-adrenomedullin antibodies, or antibody fragments or scaffolds.

12. 12. The method for predicting increased DPP3 in critically ill patients according to claim 11, wherein the anti-adrenomedullin antibody, or anti-adrenomedullin antibody fragment, or anti-adrenomedullin scaffold is directed against the N-terminal portion (amino acids 1-21) of adrenomedullin (ADM): YRQSMNNFQGLRSFGCRFGTC (SEQ ID NO: 14).

13. 13. A method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 12, wherein a patient is selected for therapy / treatment with a DPP3 inhibitor if the level of DPP3 in said sample is above said predetermined threshold, said DPP3 inhibitor being selected from the group of anti-DPP3 antibodies, or anti-DPP3 antibody fragments or anti-DPP3 scaffolds.

14. A method for prediction of increased DPP3 in a critically ill patient according to any one of claims 1 to 13, wherein said level of DPP3 is either the amount of DPP3 protein and / or the level of active DPP3.

15. A method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 14, wherein said level of DPP3 is determined by different methods including immunoassay, activity assay or mass spectrometry method.

16. 16. The method for prediction of increased DPP3 in critically ill patients according to claim 15, wherein said immunoassay is a sandwich immunoassay.

17. The method for prediction of increased DPP3 in critically ill patients according to any one of claims 1 to 16, wherein said body fluid is selected from whole blood, serum, or plasma.

18. 1. A method for the prevention of DPP3 elevation in a critically ill patient, said method comprising: determining the level of DPP3 in a sample of the patient's body fluid; comparing the determined level of DPP3 to a predetermined threshold, wherein the predetermined threshold is between 40 ng / ml and 22 ng / ml, wherein a level of DPP3 in the sample above the predetermined is indicative of increased DPP3 in the patient; and if said determined level of DPP3 is above said predetermined threshold, a DPP3 inhibitor, administering a DPP3 inhibitor, wherein the DPP3 inhibitor is an anti-DPP3 antibody, and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold.

19. 19. The method for the prevention of DPP3 increase in critically ill patients according to claim 18, wherein said predetermined threshold is between 30 ng / ml and 22 ng / ml.

20. 20. The method for the prevention of DPP3 increase in critically ill patients according to claim 18 or 19, wherein said predetermined threshold is between 25 ng / ml and 22 ng / ml.

21. Method for the prevention of increased DPP3 in critically ill patients according to any one of claims 18 to 20, wherein said increase is to a DPP3 level of 40 or more, preferably 50 ng / ml or more.

22. 22. The method for prevention of DPP3 increase in critically ill patients according to any one of claims 18 to 21, wherein said patient is a patient with a severe infection, sepsis, heart failure, chronic heart failure, acute heart failure (AHF), myocardial infarction (MI), stroke, a patient with organ dysfunction or failure (e.g. liver, kidney, lung dysfunction or failure), a patient undergoing major surgery, a patient with trauma (e.g. burn trauma, polytrauma), a patient with shock and / or in a state of shock, or alternatively a patient with ARDS.

23. 23. The method for prevention of DPP3 increase in critically ill patients according to claim 22, wherein said shock is selected from the group comprising hypovolemic shock, cardiogenic shock, obstructive shock, and distributive shock.

24. In the case of cardiogenic shock, the patient may be suffering from an acute coronary syndrome (e.g., acute myocardial infarction), or the patient has heart failure (e.g., acute decompensated heart failure), myocarditis, arrhythmia, cardiomyopathy, valvular heart disease, aortic dissection with acute aortic stenosis, traumatic chordae tendineae rupture, or massive pulmonary embolism; or In the case of hypovolemic shock, the patient may have a bleeding disorder, including spontaneous bleeding in the setting of gastrointestinal bleeding, trauma, vascular etiology (e.g., ruptured abdominal aortic aneurysm, tumor encroaching into a major blood vessel), and anticoagulant use, or a non-hemorrhagic disorder, including vomiting, diarrhea, renal loss, skin loss / insensitivity loss (e.g., burns, heat stroke), or third-space loss in the setting of pancreatitis, cirrhosis, or intestinal obstruction; or In the case of obstructive shock, the patient may have cardiac tamponade, tension pneumothorax, pulmonary embolism, or aortic stenosis, or - A method for the prevention of DPP3 increase in critically ill patients according to claim 23, wherein in the case of distributive shock, the patient may have septic shock, neurogenic shock, anaphylactic shock, or shock due to adrenal crisis.

25. A method for the prevention of DPP3 increase in critically ill patients according to any one of claims 22 to 24, wherein said shock is selected from the group comprising cardiogenic shock or septic shock.

26. 1. A DPP3 inhibitor for use in preventing DPP3 increase in a critically ill patient, wherein said patient has a level of DPP3 above a threshold, said threshold being between 40 ng / ml and 22 ng / ml, and wherein said DPP3 inhibitor is an anti-DPP3 antibody and / or an anti-DPP3 antibody fragment and / or an anti-DPP3 scaffold.

Images