Optimized genetic tools for engineering bacteria

Abstract

The present invention relates to the transformation and genetic modification of bacteria belonging to the phylum Firmicutes. In particular, it relates to methods, tools, and kits that enable such genetic modification, comprising nucleic acid sequences used to facilitate bacterial transformation, the nucleic acid sequences comprising i) all or part of SEQ ID NO: 126, and ii) sequences that enable genetic modification of the bacteria and / or expression in the bacteria of DNA sequences that are partially or completely absent from the genetic material present in the wild-type bacteria. The present invention also relates to the resulting genetically modified bacteria and their uses, particularly for the production of solvents, preferably on an industrial scale.

Description

[Technical field]

[0001] The present invention relates to the transformation and genetic modification of bacteria, in particular of bacteria belonging to the phylum Firmicutes, generally solventogenic bacteria, for example of the genus Clostridium, preferably bacteria that in the wild state have both the bacterial chromosome and at least one DNA molecule (or natural plasmid) different from the chromosomal DNA. The present invention therefore relates to methods, tools and kits that allow such genetic modification, in particular to nucleic acid sequences used to facilitate bacterial transformation, said sequences comprising i) all or part of SEQ ID NO: 126, and ii) a sequence that allows modification of the genes of the bacteria and / or expression in said bacteria of DNA sequences that are partially or completely absent from the genetic material present in the wild type of said bacteria. The present invention also relates to the resulting genetically modified bacteria and their uses, in particular the production of solvents, preferably on an industrial scale. [Background technology]

[0002] Technical background Clostridia are Gram-positive, strictly anaerobic, spore-forming bacteria belonging to the phylum Firmicutes. They are an important group of bacteria for the scientific community for several reasons. Firstly, the cause of several serious diseases (e.g. tetanus, botulism infection) is infection with pathogenic members of this family (John & Wood, 1986; Gonzales et al., 2014). Secondly, the potential for biotechnological use of so-called acidogenic or solventogenic strains (Moon et al., 2016). These non-pathogenic Clostridia naturally have the ability to convert a wide variety of sugars to produce compounds of interest, more specifically acetone, butanol, and ethanol, in a process called ABE fermentation (John & Wood, 1986). Similarly, IBE fermentation is also possible in certain species, and acetone is reduced proportionally to isopropanol production due to the presence of a gene encoding a secondary alcohol dehydrogenase (s-ADH; Ismael et al., 1993, Hiu et al., 1987) in the genome of these strains (Chen et al., 1986, George et al., 1983).

[0003] Solvent-producing species of the Clostridia class share important phenotypic similarities, which made them difficult to classify until the advent of modern sequencing techniques (Rogers et al. 2006). Now, with the ability to sequence the complete genomes of these bacteria, the bacterial genus can be divided into four major species: C. acetobutylicum, C. saccharoperbutylacetonicum, C. saccharobutylicum, and C. beijerinckii. A recent paper, based on a comparative analysis of the complete genomes of 30 strains, proposes a classification of these solvent-producing Clostridia into four major clades (Figure 1).

[0004] In particular, these groups separate the two species C. acetobutylicum and C. beijerinckii into the control strains C. acetobutylicum ATCC 824 (also called DSM 792 or LMG 5710) and C. beijerinckii NCIMB 8052, respectively, the latter being a model strain for studying ABE fermentation.

[0005] Naturally occurring Clostridium strains that can result in IBE fermentation are few in number and mainly belong to the species Clostridium beijerinckii (Zhang et al., 2018, Table 1). These strains are generally selected from C. butylicum LMD 27.6, C. aurantibutylicum NCIB 10659, C. beijerinckii LMD 27.6, C. beijerinckii VPI2968, C. beijerinckii NRRL B-593, C. beijerinckii ATCC 6014, C. beijerinckii McClung 3081, C. isopropylicum IAM 19239, C. beijerinckii DSM 6423, C. sp. A1424, C. beijerinckii optinoii, and C. beijerinckii BGS1.

[0006] Although bacteria have been used in industry for over a century, knowledge about bacteria belonging to the genus Clostridium has been limited for a long time due to the difficulty of genetically modifying them. In recent years, various genetic tools have been developed to optimize Clostridium strains, the most recent being the use of CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) / Cas (CRISPR-associated proteins) technology. This method is based on the use of enzymes called nucleases (generally Cas-type nucleases in the case of CRISPR / Cas genetic tools, e.g. the protein Cas9 of Streptococcus pyogenes), which, guided by an RNA molecule, can make a double-stranded break in a DNA molecule (the target sequence of interest). The sequence of the guide RNA (gRNA) determines the cleavage site of the nuclease, conferring a remarkably high specificity (Figure 1).

[0007] Double-strand breaks in essential DNA molecules are lethal for an organism, so survival after a double-strand break depends on its ability to repair it (e.g., Cui & Bikard, 2016). In bacteria of the genus Clostridium, the repair of double-strand breaks relies on a homologous recombination mechanism that requires an intact copy of the broken sequence. By supplying the bacteria with DNA fragments that allow this repair and modifying the original sequence, the desired changes in the microorganism can be inserted into its genome. The modifications made render the genomic DNA subsequently incapable of being targeted by the Cas9-gRNA ribonucleoprotein complex, either through modification of the target sequence or the PAM site (Figure 2).

[0008] Various approaches have already been reported to make this genetic tool work in Clostridium bacteria. Indeed, these microorganisms are known to be difficult to genetically modify due to the low frequency of transformation and homologous recombination. Some approaches are based on the use of Cas9, either constitutively expressed in C. beijerinckii and C. ljungdahlii (Wang et al., 2015; Huang et al., 2016) or under the control of an inducible promoter in C. beijerinckii, C. saccharoperbutylacetonicum and C. authoethanogenum (Wang et al., 2016; Nagaraju et al., 2016; Wang et al., 2017). Other publications describe the use of Cas9n, a modified version of nuclease that makes single-strand breaks instead of double-strand breaks in the genome (Xu et al., 2015; Li et al., 2016Xu et al., 2015; Li et al., 2016). This choice is due to the observation that Cas9 is too toxic to be used in Clostridium bacteria under the experimental conditions tested. Most of the above tools are based on the use of a single plasmid. Finally, it has been shown that it is also possible to use endogenous CRISPR / Cas systems when they have been identified in the genome of the microorganism, for example in C. pasteurianum (Pyne et al., 2016).

[0009] Except when using the endogenous mechanisms of the strain to be modified (as in the last case above), tools based on CRISPR technology have the major drawback that the size of the nucleic acid of interest (and therefore the number of coding sequences or genes) that can be inserted into the bacterial genome is severely limited (at most about 1.8 kb according to Xu et al., 2015).

[0010] The inventors have developed and published a more powerful genetic tool for bacterial modification, suitable for bacteria of the genus Clostridium, based on the use of two different nucleic acids, generally two plasmids (WO2017064439, Wasels et al., 2017, Figure 3), which solves this problem in particular. In a particular embodiment, the first nucleic acid of this tool allows the expression of cas9, and the second nucleic acid, specific for the modification to be achieved, contains one or more gRNA expression cassettes as well as a repair matrix that allows replacing the part of the bacterial DNA targeted by Cas9 with the sequence of interest. The toxicity of this system is limited by placing Cas9 and / or the gRNA expression cassette under the control of an inducible promoter. The inventors have recently improved this tool, significantly increasing the transformation efficiency, so that useful numbers and quantities of the desired genetically modified bacteria can be obtained (especially for the selection of robust strains for industrial-scale production) (see FR18 / 548356). In this improved tool, at least one nucleic acid comprises a sequence encoding an anti-CRISPR protein ("acr") placed under the control of an inducible promoter. This anti-CRISPR protein makes it possible to inhibit the activity of the DNA endonuclease / guide RNA complex. The expression of this protein is regulated so that it is only expressed during the bacterial transformation step.

[0011] The inventors have also very recently succeeded in genetically modifying bacteria that contain genes resistant to one or more antibiotics in the wild to render them susceptible to said antibiotics, facilitating the use of genetic tools with at least two nucleic acids. As a result, they have succeeded in genetically modifying the C. beijerinckii DSM6423 strain, which naturally produces isopropanol. In particular, they have succeeded in curing this strain of a naturally occurring plasmid, referred to herein as "pNF2", which is nonessential for this strain (see FR18 / 73492).

[0012] Thereafter, the present inventors found that by removing the plasmid pNF2, the gene transfer efficiency (i.e., transformation efficiency) was increased to about 101 From 5×10 3 It has been discovered, and is disclosed herein for the first time, that it is possible to obtain a bacterium C. beijerinckii DSM6423 with a 2-fold improved efficiency. As will be explained below, the inventors have also succeeded in again significantly improving genetic tools based on the use of at least two nucleic acids by designing, with parts of the plasmid pNF2, specific nucleic acids with sequences that allow the modification of the genes of the bacterium and / or the expression in the bacterium of DNA sequences that are not present in the genetic material present in the wild type of the bacterium. These nucleic acids and new tools beneficially improve the transformation efficiency of bacteria, in particular of bacteria that have previously contained natural plasmids or plasmids that have been depleted in the wild state.

[0013] The invention thus offers significant advantages in transformation efficiency and therefore facilitates the utilization of the bacteria, particularly on an industrial scale. Summary of the Invention

[0014] Summary of the Invention The inventors herein describe, for the first time, a nucleic acid (also referred to herein as nucleic acid "OPT") that facilitates bacterial transformation (improves the maintenance of all introduced genes in said bacterium). Nucleic acid OPT comprises i) all or part of SEQ ID NO: 126 and ii) a sequence that allows modification of a bacterium's genes and / or expression in said bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild type of said bacterium. The sequence of SEQ ID NO: 126 is herein also referred to as nucleic acid "OREP".

[0015] The inventors have succeeded in increasing the frequency of transformation of nucleic acids in the C. beijerinckii DSM 6423 bacterium, in particular by suppressing the sequence OREP in said bacterium, and this sequence OREP can be advantageously used in whole or in part for the construction of nucleic acids and / or genetic tools allowing the genetic modification of the bacterium and / or the expression in said bacterium of DNA sequences which are partially or completely deleted from genes present in the wild-type version of said bacterium.

[0016] The sequence OREP comprises a nucleotide sequence (SEQ ID NO: 127) that codes for a protein involved in the replication of the nucleic acid of interest OPT. This protein involved in replication is also referred to herein as the protein "REP" (SEQ ID NO: 128 is "MNNNNTESEELKEQSQLLLDKCTKKKKKNPKFSSYIEPLVSKKLSERIKECGDFLQMLSDLNLENSKLHRASFCGNRFCPMCSWRIACKDSLEISILMEHLRKEESKEFIFLTLTTPNVKGADLDNSIKAYNKAFKKLMERKEVKSIVKGYIRKLEVTYNLDKSSKSYNTYHPHFHVVLAVNRSYFKKQNLYINHHRWLSLWQESTGDYSITQVDVRKAKINDYKEVYELAKYSAKDSDYLINREVFTVFYKSLKGKQVLVFSGLFKDAHKMYKNGELDLYKKLDTIEYAYMVSYNWLKKKYDTSNIRELTEEEKQKFNKNLIEDVDIE"). The protein REP has a conserved domain in the Firmicutes phylum called "COG 5655" (Plasmid rolling circle replication initiator protein REP) of SEQ ID NO: 129.

[0017] Genetic tools have also been described that allow the genetic material of bacteria to be optimized and transformed and subsequently modified by homologous recombination, and / or that allow the expression in said bacteria of DNA sequences that are partially or completely absent in the material of bacteria belonging to the phylum Firmicutes, such as bacteria of the genera Clostridium, Bacillus or Lactobacillus (Hidalgo-Cantabrana, C. et al.; Yadav, R. et al.).

[0018] In certain embodiments, tools for modification by homologous recombination generally include: i) at least - a "first" nucleic acid encoding at least one DNA endonuclease, such as the enzyme Cas9, wherein the sequence encoding said DNA endonuclease is under the control of a promoter, and - at least one "second" nucleic acid containing a repair matrix that allows the endonuclease to replace the part of the bacterial DNA targeted by the desired sequence by the mechanism of homologous recombination; wherein: ii) at least one of said nucleic acids further encodes one or more guide RNAs (gRNAs) or the genetic tool further comprises one or more guide RNAs, each guide RNA comprising an RNA structure for anchoring to a DNA endonuclease and a complementary sequence of a targeting portion of bacterial DNA, preferably iii) at least one of the nucleic acids further comprises a sequence encoding an anti-CRISPR protein under the control of an inducible promoter, or the genetic tool further comprises a third nucleic acid encoding an anti-CRISPR protein under the control of an inducible promoter.

[0019] In particular, such genetic tools include at least those described below: - a "first" nucleic acid encoding at least one DNA endonuclease, wherein the sequence encoding said DNA endonuclease is under the control of a promoter, and - a "nucleic acid OREP" sequence, i.e. i) all or part of SEQ ID NO: 126, and ii) an "another" nucleic acid comprising or consisting of a sequence allowing the genetic modification of a bacterium and / or allowing the expression in said bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild type of said bacterium.

[0020] In certain embodiments, the above-mentioned "second nucleic acid comprising the repair matrix" includes this "another nucleic acid."

[0021] The inventors also describe a method for transforming and genetically modifying, preferably by homologous recombination, bacteria belonging to the phylum Firmicutes, such as bacteria of the genus Clostridium, bacteria of the genus Bacillus or bacteria of the genus Lactobacillus, generally solventogenic bacteria, as well as bacteria or bacteria obtained (transformed and generally genetically modified) using said method. This method advantageously comprises a step of transforming said bacteria by introducing into said bacteria all or part of the genetic tools described herein, in particular i) all or part of SEQ ID NO: 126, and ii) a nucleic acid ("nucleic acid OREP") that comprises or consists of a sequence that allows the genetic modification of the bacteria and / or allows the expression of a DNA sequence that is partially or completely missing from the genetic material present in the wild type of said bacteria.

[0022] In a particular embodiment, the method advantageously comprises: a) introducing into the bacterium a genetic tool as described herein, preferably in the presence of an agent for inducing expression of an anti-CRISPR protein; and b) culturing the transformed bacteria obtained at the end of step a) on a medium that does not contain an agent for inducing the expression of an anti-CRISPR protein and that generally allows the expression of a DNA endonuclease / gRNA ribonucleoprotein complex, such as Cas9 / gRNA; Includes.

[0023] The present inventors also describe a kit for transforming and preferably genetically modifying bacteria belonging to the Firmicutes phylum, such as bacteria of the genus Clostridium, bacteria of the genus Bacillus, bacteria of the genus Lactobacillus, or a kit for producing at least one solvent, such as a mixture of solvents, using such bacteria.The kit preferably comprises the nucleic acid described herein and an inducer suitable for the inducible promoter of the expression of the selected anti-CRISPR protein used in the genetic tool described herein.In certain embodiments, the kit comprises all or part of the elements of the genetic tool described herein.

[0024] Also described is the use of the nucleic acids or genetic tools disclosed herein for the first time for transforming and, optionally, genetically modifying bacteria belonging to the phylum Firmicutes, such as bacteria of the genera Clostridium, Bacillus and Lactobacillus, preferably bacteria which in their wild state possess both a bacterial chromosome and at least one DNA molecule different from the chromosomal DNA (generally a naturally occurring plasmid).

[0025] Also described herein for the first time are the use of nucleic acids, genetic tools, methods for transforming and preferably genetically modifying such bacteria, bacteria obtained by such methods and / or kits to enable the production, preferably on an industrial scale, of a solvent or solvent mixture, preferably acetone, butanol, ethanol, isopropanol or a mixture thereof, typically isopropanol / butanol, butanol / ethanol or a mixture of isopropanol / ethanol. Further aspects of the invention are described below: [Section 1] The bacterium Clostridium beijerinckii or its genetic recombinants, deposited in the BCCM-LMG collection under the accession number LMG P-31277 on February 20, 2019. [Section 2] A nucleic acid comprising i) all or part of SEQ ID NO: 126 and ii) a sequence enabling genetic modification of a bacterium and / or expression in said bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild type of said bacterium. [Section 3] Item 3. The nucleic acid according to item 2, wherein the sequence that allows modification of the bacterial gene is a modification matrix that allows replacement of a part of the bacterial gene with a desired sequence by a homologous recombination mechanism. [Section 4] 3) a sequence encoding a DNA endonuclease; and / or 4) one or more guide RNAs (gRNAs), each gRNA comprising an RNA structure for anchoring to the DNA endonuclease and a complementary sequence of a targeting portion of a bacterial gene. [Section 5] Item 5. The nucleic acid according to any one of items 2 to 4, characterized in that the nucleic acid is selected from an expression cassette and a vector, preferably a plasmid, for example a plasmid having a sequence selected from SEQ ID NO: 119, SEQ ID NO: 123, SEQ ID NO: 124 and SEQ ID NO: 125. [Section 6] A genetic tool for transforming and genetically modifying bacteria, comprising at least - a first nucleic acid encoding at least one DNA endonuclease, the sequence encoding said DNA endonuclease being under the control of a promoter, and - The second nucleic acid according to any one of items 2 to 5. wherein at least one of the nucleic acids of the genetic tool further comprises a sequence encoding an anti-CRISPR protein, preferably under the control of an inducible promoter, or the genetic tool further comprises a third nucleic acid encoding an anti-CRISPR protein, preferably under the control of an inducible promoter; Genetic tools. [Section 7] The genetic tool of claim 6, wherein the first nucleic acid further encodes one or more guide RNAs (gRNAs), or the genetic tool further comprises one or more gRNAs. [Section 8] Use of a nucleic acid according to any one of paragraphs 2 to 6, or a genetic tool according to paragraph 6 or 7, for transforming and optionally genetically modifying a bacterium. [Section 9] A method for transforming, preferably genetically modifying, a bacterium using a tool for genetic recombination, comprising the step of transforming the bacterium by introducing a nucleic acid according to any one of items 2 to 5 into the bacterium. [Section 10] The nucleic acid according to any one of claims 2 to 5, the genetic tool according to claim 6 or 7, the use according to claim 8, or the method according to claim 9, characterized in that the bacterium belongs to the phylum Firmicutes, preferably the genus Clostridium, Bacillus or Lactobacillus. [Section 11] 11. The nucleic acid, gene tool, use or method according to claim 10, characterized in that the bacterium is a bacterium of the genus Clostridium, preferably a solventogenic bacterium selected from C. acetobutylicum, C. cellulolyticum, C. phytofermentans, C. beijerinckii, C. saccharobutylicum, C. saccharoperbutylacetonicum, C. sporogenes, C. butyricum, C. aurantibutyricum, C. tyrobutyricum, or an acetate-producing bacterium selected from C. aceticum, C. thermoaceticum, C. ljungdahlii, C. autoethanogenum, C. difficile, C. scatologenes and C. carboxydivorans. [Section 12] 12. The nucleic acid, genetic tool, use or method according to item 10 or 11, characterized in that the bacterium is a C. beijerinckii bacterium lacking the plasmid pNF2, preferably a subclade selected from DSM 6423, LMG 7814, LMG 7815, NRRL B-593, NCCB 27006 and a subclade having at least 95%, preferably 97%, identity with the DSM 6423 strain. [Section 13] A kit for transforming, preferably genetically modifying, bacteria or for producing at least one solvent using bacteria, comprising a nucleic acid according to any one of clauses 2 to 5 and at least one inducer suitable for an inducible promoter of expression of a selected anti-CRISPR protein used in the genetic tool according to clause 6 or 7. [Section 14] Use of the nucleic acid according to any one of paragraphs 2 to 5, use of the genetic tool according to paragraph 6 or 7, use of the method according to paragraph 9 or use of the kit according to paragraph 13 to enable the production of a solvent or mixture of solvents, preferably acetone, butanol, ethanol, isopropanol or a mixture thereof, typically an isopropanol / butanol mixture, on an industrial scale. [Section 15] 13. A bacterium C. beijerinckii obtainable by a method according to one of claims 9 to 12, characterized in that the bacterium lacks the catB gene of SEQ ID NO: 18 and the plasmid pNF2. [Brief description of the drawings]

[0026] [Figure 1] Figure 1 shows the CRISPR / Cas9 system used as a genetic tool for genome editing, which uses the nuclease Cas9 to create one or more double-stranded breaks in genomic DNA guided by gRNA. gRNA stands for guide RNA, and PAM stands for Protospacer Adjacent Motif. Figure adapted from Jinek et al., 2012. [Diagram 2]Figure 2 shows the repair of Cas9-induced double-strand breaks by homologous recombination. PAM stands for Protospacer Adjacent Motif. [Diagram 3] Figure 3 shows the use of CRISPR / Cas9 in Clostridium. ermB is an erythromycin resistance gene, catP (SEQ ID NO: 70) is a thiamphenicol / chloramphenicol resistance gene, tetR is a gene whose expression product represses transcription starting from Pcm-tetO2 / 1, Pcm-2tetO1 and Pcm-tetO2 / 1 are anhydrotetracycline-inducible promoters "aTc" (Dong et al., 2012), and miniPthl is a constitutive promoter (Dong et al., 2012). [Figure 4] Figure 4 shows the pCas9acr plasmid map (SEQ ID NO: 23). ermB, erythromycin resistance gene; rep, origin of replication for E. coli; repH, origin of replication for C. acetobutylicum; Tthl, thiolase terminator; miniPthl, constitutive promoter (Dong et al., 2012); Pcm-tetO2 / 1, promoter "aTc" repressed by the product of tetR and induced by anhydrotetracycline (Dong et al., 2012); Pbgal, promoter repressed by the product of lacR and induced by lactose (Hartman et al., 2011); acrIIA4, gene encoding anti-CRISPR protein AcrII14; bgaR, gene whose expression product represses transcription initiated by Pbgal. [Diagram 5] Figure 5 shows the relative rate of transformation of C. acetobutylicum DSM792 with pCas9ind (SEQ ID NO: 22) or pCas9acr (SEQ ID NO: 23). The frequency is expressed as the number of transformants obtained per μg of DNA used for transformation compared to the frequency of transformation with pEC750C (SEQ ID NO: 106) and represents the average value of at least two independent experiments. [Figure 6]Figure 6 shows induction of the CRISPR / Cas9 system with (SEQ ID NO: 79 and SEQ ID NO: 80) or without (SEQ ID NO: 105) a repair matrix in transformants of strain DSM792 containing pCas9acr and an expression plasmid for a gRNA targeting bdhB. Em, erythromycin; Tm, thiamphenicol; aTc, anhydrotetracycline; ND, undiluted. [Figure 7] Figure 7 shows the modification of the bdh locus of C. acetobutylicum DSM792 using the CRISPR / Cas9 system. Figure 7A shows the genetic organization of the bdh locus. The homology between the repair matrix and the genomic DNA is highlighted with a light grey parallelogram. Also shown are the hybridization sites of primers V1 and V2. Figure 7B shows the amplification of the bdh locus with primers V1 and V2. M, marker of size 2-log (NEB); P, plasmid pGRNA-ΔbdhA ΔbdhB; WT, wild-type strain.

[0027] [Figure 8] Figure 8 shows the classification of 30 solventogenic strains of Clostridium according to Poehlein et al., 2017. Note that the subclade C. beijerinckii NRRL B-593 is also defined in the literature as C. beijerinckii DSM6423. [Figure 9] FIG. 9 shows the pCas9ind-ΔcatB plasmid map. [Figure 10] Figure 10 shows the pCas9acr plasmid map. [Figure 11] FIG. 11 shows the pEC750S-uppHR plasmid map. [Figure 12] Figure 12 shows the pEX-A2-gRNA-upp plasmid map. [Figure 13] FIG. 13 shows the pEC750S-Δupp plasmid map. [Figure 14] FIG. 14 shows the pEC750C-Δupp plasmid map. [Figure 15] FIG. 15 shows the pGRNA-pNF2 map. [Figure 16] Figure 16 shows the PCR amplification of gene catB in clones obtained by bacterial transformation of C. beijerinckii DSM6423 strain, where approximately 1.5 kb is amplified if the strain retains gene catB and approximately 900 bp is amplified if the gene is deleted. [Figure 17] FIG. 17 shows the results of growing wild-type (WT) and ΔcatB C. beijerinckii DSM6423 strains on 2YTG medium and 2YTG thiamphenicol selection medium. [Figure 18] Figure 18 shows induction of the CRISPR / Cas9acr system in transformants of strain C. beijerinckii DSM6423 containing pCas9acr and an expression plasmid for gRNA targeting upp, with or without a repair matrix. Legend: Em, erythromycin; Tm, thiamphenicol; aTc, anhydrotetracycline; ND, no dilution. [Figure 19] Figure 19 shows the modification of the locus upp of C. beijerinckii DSM6423 using the CRISPR / Cas9 system. Figure 19A shows the genetic organization of the locus upp, relating the gene, gRNA target site and repair matrix to the corresponding homology region on the genomic DNA. The hybridization sites of the primers (RH010 and RH011) for PCR confirmation are also shown. Figure 19B shows the amplification of the locus upp using primers RH010 and RH011. For the wild type gene, an amplification of 1680 bp is expected, whereas for the modified gene upp, it is 1090 bp. M, 100 bp-3 kb size marker (Lonza); WT, wild type strain. [Figure 20] FIG. 20 shows PCR amplification confirming the presence of plasmid pCas9ind in C. beijerinckii 6423 ΔcatB strain. [Figure 21]FIG. 21 shows PCR amplification (≈900 bp) confirming the presence or absence of the native plasmid pNF2 before (positive controls 1 and 2) and after induction with medium containing aTc of the CRISPR-Cas9 system. [Figure 22] FIG. 22 shows a genetic tool for bacterial engineering, suitable for bacteria of the genus Clostridium, based on the use of two plasmids (see WO2017 / 064439, Wasels et al., 2017). [Figure 23] Figure 23 shows the plasmid map of pCas9ind-gRNA_catB.

[0028] [Figure 24] Figure 24 shows the transformation efficiency (number of colonies observed per μg of transformed DNA) of 20 μg of plasmid pCas9ind in C. beijerinckii strain DSM6423. Error bars indicate the standard error of the mean of biological triplicates. [Diagram 25] FIG. 25 shows the pNF3 plasmid map. [Figure 26] Figure 26 shows the pEC751S plasmid map. [Figure 27] FIG. 27 shows the pNF3S plasmid map. [Figure 28] FIG. 28 shows the pNF3E plasmid map. [Figure 29] Figure 29 shows the pNF3C plasmid map. [Diagram 30] Figure 30 shows the transformation efficiency (number of colonies observed per μg of transformed DNA) of plasmid pCas9ind in three strains of C. beijerinckii DSM 6423. Error bars correspond to the standard deviation of the mean of biological duplicates. [Diagram 31]Figure 31 shows the transformation efficiency (number of colonies observed per μg of transformed DNA) of plasmid pEC750C in two strains derived from C. beijerinckii DSM 6423. Error bars correspond to the standard deviation of the mean of biological duplicates. [Diagram 32] Figure 32 shows the transformation efficiency (number of colonies observed per μg of transformed DNA) of plasmids pEC750C, pNF3C, pFW01, and pNF3E in C. beijerinckii IFP963 ΔcatB ΔpNF2 strain. Error bars correspond to the standard deviation of the mean of biological triplicates. [Diagram 33] FIG. 33 shows the transformation efficiency (number of colonies observed per μg of transformed DNA) of plasmids pFW01, pNF3E and pNF3S in C. beijerinckii strain NCIMB8052. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0029] Detailed Description of the Invention Solventogenic bacteria, particularly those of the Clostridium genus, have been used in industry for over a century, but knowledge of them is limited due to the difficulty of genetic modification. For example, Clostridium genus bacteria that naturally produce isopropanol generally have the adh gene in their genome, which encodes a primary / secondary alcohol dehydrogenase that can reduce acetone to isopropanol, but they are genetically and functionally different from bacteria capable of ABE fermentation in the natural state.

[0030] Advantageously, the present inventors have succeeded in transforming and genetically modifying a bacterium of the genus Clostridium that naturally produces isopropanol, C. beijerinckii DSM6423, and a control strain, C. acetobutylicum DSM792.

[0031] Part of the work described in the Experimental Section has recently been published by the inventors in the analysis of the genome and transcriptome of C. beijerinckii strain DSM6423, a strain capable of IBE fermentation ( Mate de Gerando et al., 2018 ).

[0032] During the assembly of the genome of this strain, the inventors discovered in particular the presence of two naturally occurring plasmids (pNF1 and pNF2) and a filamentous bacteriophage (Φ6423), which, in addition to the chromosome, are mobile genetic elements (Accession No. PRJEB11626 - https: / / www.ebi.ac.uk / ena / data / view / PRJEB11626).

[0033] The C. beijerinckii DSM6423 strain is naturally sensitive to erythromycin but resistant to thiamphenicol. Patent application number FR18 / 73492 describes a particular strain, C. beijerinckii DSM6423 ΔcatB (also referred to herein as C. beijerinckii IFP962 ΔcatB), which is made sensitive to thiamphenicol. In a particular embodiment of the present invention, the inventors have succeeded in curing the C. beijerinckii DSM6423 strain of its native plasmid pNF2, obtaining the C. beijerinckii DSM6423 ΔcatB ΔpNF2 strain (also referred to herein as C. beijerinckii IFP963 ΔcatB ΔpNF2), which is characterized for the first time herein. This strain was deposited in the BCCM-LMG collection on February 20, 2019 under the accession number LMG P-31277. This strain lacks gene catB of SEQ ID NO: 18 and plasmid pNF2 (wild type). The present specification also relates to any derived bacterium, clone, mutant or genetic variant of the latter, which also generally lacks gene catB of SEQ ID NO: 18 and plasmid pNF2 (wild type). It also relates more generally to any bacterium that, in the wild state, has both a bacterial chromosome and at least one DNA molecule different from the chromosomal DNA (defined herein as "non-chromosomal (bacterial) DNA" or "natural (bacterial) plasmid") and that has been genetically modified using the nucleic acids and / or genetic tools described herein so as to no longer contain at least one of the non-chromosomal DNA molecules, generally some of the non-chromosomal DNA molecules (e.g., 2, 3 or 4 non-chromosomal DNA molecules), preferably all of the non-chromosomal DNA molecules.

[0034] The inventors therefore disclose in the present application a solventogenic bacterium belonging to the phylum Firmicutes, such as a bacterium of the genera Clostridium, Bacillus or Lactobacillus, more particularly a bacterium of the genus Clostridium, which is naturally capable of producing isopropanol and in particular has the capacity to carry out IBE fermentation (i.e. has the capacity in its wild type), which bacterium has been genetically modified such that, as a result of this genetic modification, it has lost in particular at least one native plasmid (i.e. a plasmid naturally present in the wild type of said bacterium), preferably all of said native plasmids, as well as the tools, in particular genetic tools, that made it possible to obtain it.

[0035] These tools have the advantage of significantly facilitating the transformation and genetic modification of bacteria.The experiments carried out by the inventors have shown that it is possible to use the tools described herein, and more generally the techniques, to genetically modify bacteria, particularly bacteria belonging to the Firmicutes phylum, such as bacteria of the genus Clostridium, Bacillus or Lactobacillus.In particular, among the bacteria of the genus Clostridium that can produce isopropanol in wild conditions, particularly IBE fermentation, those that have genes that code for enzymes that are responsible for antibiotic resistance, in particular amphenicol-O-acetyltransferase, such as chloramphenicol-O-acetyltransferase or thianphonicol-O-acetyltransferase.

[0036] In a particular embodiment, the inventors have thus succeeded in generating bacteria sensitive to antibiotics belonging to the amphenicol class, said bacteria naturally carrying (in the wild state) genes encoding enzymes responsible for resistance to these antibiotics.

[0037] Other preferred bacteria, in their wild state, contain both a bacterial chromosome and at least one DNA molecule that differs from the chromosomal DNA.

[0038] Also preferably, the bacterium, in its wild state, comprises both the bacterial chromosome and at least one DNA molecule different from the chromosomal DNA, and further comprises a gene that confers resistance to an antibiotic. In a particular embodiment, the gene encodes an amphenicol-O-acetyltransferase, such as chloramphenicol-O-acetyltransferase or thiamphenicol-O-acetyltransferase.

[0039] A first object described by the inventors relates to a nucleic acid (herein identified as nucleic acid "OPT") that can be advantageously used to promote bacterial transformation by improving the maintenance of all of the genetic material introduced into said bacterium, said nucleic acid OPT comprising i) all or part of SEQ ID NO: 126 (sequence "OREP") or a functional variant of the latter, and ii) a sequence (herein also identified as "sequence of interest") that allows the modification of a bacterium's genes and / or the expression in said bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild type of said bacterium.

[0040] The sequence OREP (SEQ ID NO: 126) comprises the nucleotide sequence of SEQ ID NO: 127. SEQ ID NO: 127 preferably comprises a sequence encoding a protein involved in the replication of the nucleic acid OPT. The protein believed to be involved in the replication is also referred to herein as the protein "REP" (SEQ ID NO: 128). The protein REP has a domain conserved in Firmicutes, designated "COG 5655" of SEQ ID NO: 129.

[0041] In a particular embodiment, the nucleic acid OPT is a protein encoding a part of the sequence OREP (SEQ ID NO: 126), generally one or more fragments of the sequence OREP, preferably at least the sequence REP (SEQ ID NO: 128), or a variant or functional fragment of the latter (i.e., a fragment involved in replication), generally SEQ ID NO: 127 or a variant or fragment of the latter encoding a fragment involved in the replication of the nucleic acid OPT, present in the protein REP. The functional fragment of the sequence OREP encoding a fragment involved in the replication of the nucleic acid OPT, present in the protein REP, comprises the domain of SEQ ID NO: 129. Examples of such fragments of nucleic acids encoding functional fragments of the protein REP, and variants of the latter, can be easily prepared by those skilled in the art. Common examples of variants have 70% to 100%, preferably 85% to 99%, more preferably 95% to 99%, for example 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or 100% sequence homology to SEQ ID NO: 127.

[0042] In a preferred embodiment, a fragment or functional variant of the sequence OREP encodes a protein involved in the replication of the nucleic acid OPT.

[0043] In a preferred embodiment of the invention, the fragment or functional variant of the sequence OREP comprises, in addition to a sequence encoding a protein (e.g. the protein REP) involved in the replication of the nucleic acid OPT (e.g. a genetic construct of plasmid type) or a variant or functional fragment of the latter, a portion of 1 to 150 bases, preferably a portion of 1 to 15 bases, such as a sequence rich in A and T (Rajewska et al.), preferably a portion present in the plasmid pNF2 of SEQ ID NO: 118, which allows immobilization of the protein allowing replication of the nucleic acid OPT.

[0044] The sequence of interest that allows the modification of a bacterial gene is generally a modification matrix that allows the replacement of a part of a bacterial gene with a sequence of interest, for example by the mechanism of homologous recombination, for example according to one of the methods described herein.The sequence of interest that allows the modification of a bacterial gene may also be a sequence that recognizes (at least partially binds) and preferably targets, i.e. allows recognition and cleavage, at least one strand of i) a target sequence, ii) a sequence that regulates the transcription of the target sequence, or iii) a sequence adjacent to the target sequence, in the genome of the bacterial gene of interest.

[0045] A sequence of interest allowing the expression in the bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild-type form of the bacterium generally allows the bacterium to express one or more proteins that are not able to be expressed or cannot be expressed in sufficient amounts in the wild-type state.

[0046] According to certain aspects, the "nucleic acid OPT" further comprises iii) a sequence encoding a DNA endonuclease, such as Cas9, and / or iv) one or more guide RNAs (gRNAs), each gRNA comprising an RNA structure for anchoring to the DNA endonuclease and a complementary sequence to a target portion of a bacterial gene.

[0047] According to another particular aspect, the "nucleic acid OPT" does not exhibit methylation at the level of the units recognized by methyltransferases of the type Dam and Dcm.

[0048] Preferably, the "nucleic acid OPT" is selected from an expression cassette and a vector, preferably a plasmid, such as a plasmid having a sequence selected from SEQ ID NO:119, SEQ ID NO:123, SEQ ID NO:124 and SEQ ID NO:125.

[0049] Another object described by the inventors relates to genetic tools that can be used to transform and / or genetically modify bacteria of interest, generally bacteria described herein belonging to the phylum Firmicutes, such as bacteria of the genus Clostridium, Bacillus or Lactobacillus, preferably bacteria of the genus Clostridium, bacteria that can naturally produce isopropanol (i.e. in the wild state), in particular bacteria that can naturally carry out IBE fermentation, preferably bacteria that are naturally resistant to one or more antibiotics, such as bacteria C. beijerinckii. Preferred bacteria, in the wild state, have both a bacterial chromosome and at least one DNA molecule different from the chromosomal DNA.

[0050] By "bacteria belonging to the phylum Firmicutes" herein is meant bacteria belonging to the classes Clostridia, Morcutes, Bacilli or Thogobacteria, preferably bacteria belonging to the classes Clostridia or Bacilli.

[0051] Specific bacteria belonging to the phylum Firmicutes include, for example, bacteria of the genus Clostridium, Bacillus or Lactobacillus.

[0052] "Bacteria of the genus Clostridium" refers in particular to Clostridium species that are said to be industrially useful, generally solventogenic or acetogenic bacteria of the genus Clostridium. The term "bacteria of the genus Clostridium" includes wild-type bacteria as well as strains derived from the latter that have been genetically modified to improve performance (e.g., overexpression of ctfA, ctfB and adc genes) without exposure to the CRISPR system.

[0053] By "industrially useful Clostridium species" is meant species capable of producing, by fermentation, solvents and acids such as butyric acid or acetic acid, starting from sugars or monosaccharides, generally sugars containing 5 carbon atoms such as xylose, arabinose or fructose, sugars containing 6 carbon atoms such as glucose or mannose, polysaccharides such as cellulose or hemicellulose, and / or other carbon sources that can be assimilated and utilized by bacteria of the genus Clostridium (e.g. CO, CO2 and methanol). Examples of solventogenic bacteria of interest are bacteria of the genus Clostridium that produce acetone, butanol, ethanol and / or isopropanol, such as the strains defined in the literature as "ABE strains" [strains resulting in fermentations allowing the production of acetone, butanol and ethanol] and "IBE strains" [strains resulting in fermentations allowing the production of isopropanol, butanol and ethanol (by reduction of acetone)]. Solventogenic bacteria of the genus Clostridium may be selected, for example, from C. acetobutylicum, C. cellulolyticum, C. phytofermentans, C. beijerinckii, C. saccharobutylicum, C. saccharoperbutylacetonicum, C. sporogenes, C. butyricum, C. aurantibutyricum and C. tyrobutyricum, preferably from C. acetobutylicum, C. beijerinckii, C. butyricum, C. tyrobutyricum and C. cellulolyticum, even more preferably from C. acetobutylicum and C. beijerinckii.

[0054] Bacteria capable of producing isopropanol in the wild, particularly bacteria capable of causing IBE fermentation in the wild, are, for example, bacteria selected from C. beijerinckii, C. diolis, C. puniceum, C. butyricum, C. saccharoperbutylacetonicum, C. botulinum, C. drakei, C. scatologenes, C. perfringens, and C. tunisiense, preferably bacteria selected from C. beijerinckii, C. diolis, C. puniceum, and C. saccharoperbutylacetonicum. A particularly preferred bacterium capable of naturally producing isopropanol, particularly bacteria capable of causing IBE fermentation in the wild, is C. beijerinckii.

[0055] Acetogenic bacteria of interest are bacteria that produce acids and / or solvents starting from CO2 and H2. Acetogenic bacteria of the genus Clostridium can be selected, for example, from C. aceticum, C. thermoaceticum, C. ljungdahlii, C. autoethanogenum, C. difficile, C. scatologenes and C. carboxydivorans.

[0056] In a particular embodiment, the bacterium of the genus Clostridium is an "ABE strain", preferably the DSM 792 strain of C. acetobutylicum (also called ATCC 824 or other LMG 5710 strain), or the NCIMB 8052 strain of C. beijerinckii.

[0057] In another particular embodiment, the bacterium of the genus Clostridium is an "IBE strain", preferably a subclade of C. beijerinckii selected from DSM 6423, LMG 7814, LMG 7815, NRRL B-593, NCCB 27006, or the bacterium C. aurantibutyricum DSZM 793 (Georges et al, 1983), and said subclade of C. beijerinckii or C. aurantibutyricum having at least 90%, 95%, 96%, 97%, 98% or 99% identity with the strain DSM 6423. A particularly preferred bacterium C. bijerinckii, or a particularly preferred subclade of C. bijerinckii, lacks the plasmid pNF2.

[0058] The genomes of each of the subclades LMG 7814, LMG 7815, NRRL B-593 and NCCB 27006, as well as DSZM 793, have percent sequence identity of at least 97% with the genome of subclade DSM 6423.

[0059] We performed fermentation studies and confirmed that the bacteria C. beijerinckii of the subclades DSM 6423, LMG 7815 and NCCB 27006 were capable of producing isopropanol in the wild (see Table 1).

[0060] [Table 1]

[0061] Balance of glucose fermentation studies with the naturally isopropanol producing strains C. beijerinckii DSM6423, LMG7815 and NCCB27006. In a particularly preferred embodiment of the invention, the bacterium C. beijerinckii is of the subclade DSM 6423.

[0062] In yet another preferred embodiment of the present invention, the bacterium C. beijerinckii is the strain C. beijerinckii IFP963 ΔcatB ΔpNF2 (deposited in the BCCM-LMG collection on February 20, 2019 under the accession number LMG P-31277 and referred to herein as C. beijerinckii DSM6423 ΔcatB ΔpNF2), or a genetically modified version of the latter. C. beijerinckii IFP963 ΔcatB ΔpNF2, or said genetically modified version of the latter, is deleted for gene catB of SEQ ID NO: 18 and plasmid pNF2.

[0063] "Bacteria of the genus Bacillus" refers in particular to B. amyloliquefaciens, B. thurigiensis, B. coagulans, B. cereus, B. anthracis or other B. subtilis.

[0064] During recent testing, we observed that removal of the native plasmid pNF2 has a significant advantage in the introduction and maintenance of additional genetic elements, either natural or synthetic, such as expression cassette(s) or plasmid expression vector(s). The IFP963 ΔcatB ΔpNF2 strain thus exhibits 10-5x10 fold higher cloning efficiency than its wild-type homolog or the DSM6423 ΔcatB strain (herein also referred to as IFP962 ΔcatB). 3 It can be transformed with twice the efficiency.

[0065] The bacterium intended to be transformed, and preferably genetically modified, is preferably a bacterium that has been subjected to a first step of transformation and a first step of genetic modification with a nucleic acid or genetic tool of the invention that has made it possible to remove at least one molecule of extrachromosomal DNA (generally at least one plasmid) naturally present in said bacterium in the wild state.

[0066] The particular genetic tools described by the inventors are: i) That is, - at least one "first" nucleic acid encoding at least one DNA endonuclease, such as the enzyme Cas9, where the sequence encoding the DNA endonuclease is under the control of a promoter, and - at least one "second" nucleic acid containing a repair matrix that allows replacing the part of the bacterial DNA targeted by the endonuclease with the sequence of interest by a homologous recombination mechanism; wherein: ii) at least one of the nucleic acids further encodes one or more guide RNAs (gRNAs) or the genetic tool further comprises one or more guide RNAs, each guide RNA comprising an RNA structure for anchoring to a DNA endonuclease and a complementary sequence of a target portion of bacterial DNA; It is characterized by:

[0067] An example of a genetic tool described by the inventors includes two different essential elements, similar to the CRISPR / Cas system: i) an endonuclease, in this invention a nuclease associated with the CRISPR system (Cas or "CRISPR-associated protein"), Cas, and ii) a guide RNA. The guide RNA is a form of chimeric RNA that combines bacterial CRISPR RNA (crRNA) and tracrRNA (trans-activating CRISPR RNA) (Jinek et al, Science 2012). The gRNA combines in one transcript the target specificity of the crRNA, which corresponds to a "spacer sequence" that guides the Cas protein, and the conformational properties of the tracrRNA. When the gRNA and Cas proteins are simultaneously expressed in a cell, the target genomic sequence is usually modified, advantageously and permanently, since a repair matrix is ​​provided.

[0068] The genetic tool of the present invention is preferably characterized in that iii) at least one of said ("first" and "second") nucleic acids further comprises a sequence encoding an anti-CRISPR protein placed under the control of an inducible promoter, or the genetic tool further comprises a third nucleic acid encoding an anti-CRISPR protein placed under the control of an inducible promoter.

[0069] In particular, genetic tools are described that include at least the following: - a first nucleic acid encoding at least one DNA endonuclease, wherein the sequence encoding the DNA endonuclease is under the control of a promoter, and - another nucleic acid (or "nth nucleic acid") comprising or consisting of the nucleic acid sequence "OPT", i.e. a sequence comprising i) all or part of SEQ ID NO: 126 ("OREP"), and ii) a sequence allowing genetic modification of the bacterium and / or expression in said bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild type of said bacterium, wherein at least one of said nucleic acids of this particular genetic tool further comprises a sequence encoding an anti-CRISPR protein, preferably placed under the control of an inducible promoter, or said particular genetic tool further comprises a third nucleic acid encoding an anti-CRISPR protein, preferably placed under the control of an inducible promoter.

[0070] In a particular embodiment, said "second" or "nth nucleic acid comprising the repair matrix" comprises or consists of said "other nucleic acid".

[0071] In another specific embodiment, the "first nucleic acid" further encodes one or more guide RNAs (gRNAs).

[0072] In the sense of the present invention, a "nucleic acid" refers to any natural, synthetic, semi-synthetic or recombinant DNA or RNA molecule, optionally chemically modified (i.e., containing non-natural bases, modified nucleotides, e.g., containing modified linkages, modified bases and / or modified sugars) or optimized such that the codons of the transcript synthesized from the coding sequence are the most frequently occurring codons having regard to their usage in bacteria of the genus Clostridium. In the case of Clostridium, optimized codons are generally codons rich in adenine bases ("A") and thymine bases ("T").

[0073] In the peptide sequences described herein, amino acids are designated by single letter code according to the following nomenclature: C: cysteine; D: aspartic acid; E: glutamic acid; F: phenylalanine; G: glycine; H: histidine; I: isoleucine; K: lysine; L: leucine; M: methionine; N: asparagine; P: proline; Q: glutamine; R: arginine; S: serine; T: threonine; V: valine; W: tryptophan; and Y: tyrosine.

[0074] The genetic tools described herein comprise a first nucleic acid encoding at least one DNA endonuclease (also referred to herein as a "nuclease"), typically a Cas-type nuclease, such as Cas9 or MAD7.

[0075] "Cas9" refers to the Cas9 protein (also referred to as CRISPR-associated protein 9, Csn1 or Csx12) or a functional protein, peptide or polypeptide fragment of the latter, i.e. capable of exerting an enzymatic (nuclease) activity capable of interacting with a guide RNA or a guide RNA and making a double-stranded break in DNA of a target genome. Thus, "Cas9" may refer to a protein that has been modified, e.g., truncated, to remove domains of the protein that are not essential for the protein's predefined function, in particular domains not required for interaction with one or more gRNAs.

[0076] The nuclease MAD7 (amino acid sequence corresponding to SEQ ID NO: 72), also referred to as "Cas12" or "Cpf1", may be advantageously used in the present invention in combination with one or more gRNAs known to those skilled in the art to be capable of binding to this type of nuclease (see Garcia-Doval et al., 2017 and Stella S. et al., 2017).

[0077] In a particular embodiment, the sequence encoding the nuclease MAD7 is a sequence optimized for easy expression in a Clostridium strain, preferably the sequence of SEQ ID NO: 71.

[0078] According to another particular aspect, the sequence encoding the nuclease MAD7 is a sequence optimized for easy expression in a Bacillus strain, preferably the sequence of SEQ ID NO: 132.

[0079] The sequence encoding Cas9 (whole protein or fragments thereof) that can be used in one of the possible embodiments of the present invention may be obtained starting from any known Cas9 protein (Makarova et al., 2011). Examples of Cas9 proteins that can be used in the present invention include, but are not limited to, the Cas9 protein of S. pyogenes (see SEQ ID NO: 1 of PCT application WO2017 / 064439 and NCBI accession number: WP_010922251.1), the Cas9 protein of Streptococcus thermophilus, Streptococcus mutans, Campylobacter jejuni, Pasteurella multocida, Francisella novicida, Neisseria meningitidis, Neisseria lactamica and Legionella pneumophila (see Fonfara et al., 2013;Mcarova et al., 2015).

[0080] In a particular embodiment, the Cas9 protein, or a functional protein, peptide or polypeptide fragment thereof, encoded by one of the nucleic acids of the genetic tool of the invention comprises or consists of the amino acid sequence of SEQ ID NO: 75 or any other amino acid sequence having at least 50%, preferably at least 60%, identity with the latter and including as a minimum two aspartic acids ("D") occupying positions 10 ("D10") and 840 ("D840") of the amino acid sequence of SEQ ID NO: 75.

[0081] In a preferred embodiment, Cas9 comprises or consists of the Cas9 protein (NCBI accession number: WP_010922251.1, SEQ ID NO: 75) encoded by the cas9 gene of S. pyogenes M1 GAS strain (NCBI accession number: NC_002737.2 SPy_1046, SEQ ID NO: 76) or a version of the latter (the "optimized version") optimized for the origin of the transcript containing codons preferentially used by bacteria of the genus Clostridium, generally codons rich in adenine ("A") and thymine ("T") bases, allowing smooth expression of the Cas9 protein in this bacterial genus. These optimized codons are often used in a manner that uses codons specific to each bacterial strain, well known by those skilled in the art.

[0082] In certain embodiments, the Cas9 domain consists of the entire Cas9 protein, preferably the S. pyogenes Cas9 protein or an optimized version thereof.

[0083] Each of the nucleic acids of the genetic tools described herein, generally the "first" and "second" or "nth" nucleic acids of said genetic tools, are of different entities and are generally provided in the form of an expression cassette (or "construct"), such as a nucleic acid comprising at least one transcriptional promoter operably (in the sense understood by the skilled artisan) linked to one or more (coding) sequences of interest, such as an operon comprising a plurality of coding sequences of interest whose expression products contribute to the performance of a desired function in the bacterial cell, or a nucleic acid further comprising a transcriptional activation and / or termination sequence, or in the form of a circular or linear, single-stranded or double-stranded vector, such as a plasmid, phage, cosmid, artificial chromosome or synthetic chromosome, comprising one or more expression cassettes as defined above. Preferably, the vector is a plasmid.

[0084] The nucleic acid of interest, generally a cassette or expression vector, can be constructed by conventional techniques well known to those skilled in the art and may contain one or more promoters, a bacterial origin of replication (ORI sequence), termination sequences, selection genes, such as antibiotic resistance genes, and sequences that allow targeted insertion of the cassette or vector ("flanking regions"). Furthermore, these expression cassettes and vectors can be integrated into the bacterial genome by techniques well known to those skilled in the art.

[0085] The ORI sequence of interest may be selected from pIP404, pAMβ1, repH (origin of replication for C. acetobutylicum), ColE1 or rep (origin of replication for E. coli), or any other origin of replication which allows a vector, usually a plasmid, to be maintained in a bacterial cell, e.g., a Clostridium or Bacillus cell.

[0086] A preferred ORI sequence herein is that present within the sequence OREP (SEQ ID NO: 126) of the plasmid pNF2 (SEQ ID NO: 118).

[0087] The terminator sequence of interest may be selected from those of the genes adc, thl, the operon bcs or any other terminator well known to those skilled in the art making it possible to terminate transcription in a bacterial cell, for example a Clostridium or Bacillus cell.

[0088] Selection genes (resistance genes) of interest may be selected from ermB, catP, bla, tetA, tetM and / or resistance genes to ampicillin, erythromycin, chloramphenicol, thiamphenicol, spectinomycin, tetracycline, or any other antibiotic well known to those skilled in the art that can be used to select bacteria, such as Clostridium or Bacillus species.

[0089] The sequence coding for DNA endonuclease, for example Cas9, which may be present in one of the nucleic acids of the genetic tool of the present invention, may be under the control of a promoter.This promoter may be a constitutive promoter or an inducible promoter.In a preferred embodiment, the promoter that controls the expression of the nuclease is an inducible promoter.

[0090] Examples of constitutive promoters that can be used in the present invention may be selected from the promoter of the gene thl, the promoter of the gene ptb, the promoter of the gene adc, the promoter of the operon BCS, or derivatives thereof, preferably functional derivatives but shorter (truncated), such as the "miniPthl" derivative of the promoter of the gene thl of C. acetobutylicum (Dong et al., 2012), or any other promoter well known to the person skilled in the art that allows the expression of a protein in the bacterium of interest, such as a bacterium of the genus Clostridium.

[0091] Examples of inducible promoters that can be used in the present invention are, for example, promoters whose expression is controlled by the transcriptional repressor TetR, such as the promoter of the gene tetA (the tetracycline resistance gene originally present on the transposon Tn10 of E. coli); promoters whose expression is controlled by L-arabinose, such as the promoter of the gene ptk (Zhang et al., 2015), preferably in combination with the araR cassette controlling its expression in C. acetobutylicum so as to construct the system ARAi (Zhang et al., 2015); promoters whose expression is controlled by laminaribiose (a dimer of glucose β-1,3), such as the promoter of the gene celC, preferably followed by the repressor gene glyR3 and the gene of interest (Mearls et al., 2015) or the promoter of the gene celC (Newcomb et al., 2011); promoters whose expression is controlled by lactose, such as the promoter of the gene bgaL (Banerjee et al., 2015). 2014); a promoter whose expression is regulated by xylose, such as the promoter of the gene xylB (Nariya et al., 2011); and a promoter whose expression is regulated by exposure to ultraviolet (UV) light, such as the promoter of the gene bcn (Dupuy et al., 2005).

[0092] Promoters derived from one of the above promoters, preferably shorter (truncated) functional derivatives, may also be used in the present invention.

[0093] Other inducible promoters that can be used in the present invention are also described in, for example, Ransom et al. (2015), Currie et al. (2013) and Hartman et al. (2011).

[0094] A preferred inducible promoter is the anhydrotetracycline (aTc; less toxic than tetracycline and capable of removing the inhibition of the transcriptional repressor TetR at low concentrations)-inducible promoter from tetA, selected from Pcm-2tetO1 and Pcm-2tetO2 / 1 (Dong et al., 2012).

[0095] Another preferred inducible promoter is a promoter inducible by lactose, such as the promoter of the gene bgaL (Banerjee et al., 2014).

[0096] A nucleic acid of particular interest, generally an expression cassette or vector, comprises one or more expression cassettes, each cassette encoding a gRNA.

[0097] As used herein, the term "guide RNA" or "gRNA" refers to an RNA molecule that can interact with a DNA endonuclease to guide it to a target region of a bacterial chromosome. The cleavage specificity is determined by the gRNA. As explained above, each gRNA contains two regions: - a first region (commonly known as the "SDS" region) at the 5' end of the gRNA that is complementary to the target chromosomal region and mimics the crRNA of the endogenous CRISPR system; and - a second region (commonly called the "handle" region) at the 3' end of the gRNA that mimics the base-pairing interactions between the tracrRNA ("trans-activating crRNA") and the crRNA of the endogenous CRISPR system and has a double-stranded stem-loop structure that ends at the 3' with an essentially single-stranded sequence. This second region is essential for the binding of the gRNA to a DNA endonuclease.

[0098] The first region of the gRNA (the "SDS" region) varies depending on the chromosomal sequence to be targeted.

[0099] The "SDS" region of the gRNA that is complementary to the target chromosomal region comprises at least 1 nucleotide, preferably at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35 or 40 nucleotides, typically 1-40 nucleotides. Preferably, this region is 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides in length.

[0100] The second region of the gRNA (the "handle" region) has a stem-loop structure (or a hairpin structure). The "handle" regions of the various gRNAs do not vary depending on the selected chromosomal target.

[0101] According to a particular embodiment, the "handle" region comprises or consists of a sequence of at least 1 nucleotide, preferably at least 1, 50, 100, 200, 500 and 1000 nucleotides, typically between 1 and 1000 nucleotides. Preferably, this region has a length of 40 to 120 nucleotides.

[0102] The total length of the gRNA is generally between 50 and 1000 nucleotides, preferably between 80 and 200 nucleotides, more particularly preferably between 90 and 120 nucleotides. In a particular embodiment, the gRNA used in the present invention has a length between 95 and 110 nucleotides, for example about 100 nucleotides or about 110 nucleotides.

[0103] Those skilled in the art can easily define the sequence and structure of the gRNA depending on the chromosomal region to be targeted using well-known techniques (see, for example, DiCarlo et al., 2013).

[0104] The targeted DNA region / portion / sequence within the bacterial genome, for example of a bacterial chromosome, may correspond to a non-coding portion of the DNA or may correspond to a coding portion of the DNA.

[0105] In a particular embodiment of modifying a predetermined sequence, the target portion of bacterial DNA is essential for the survival of said bacterium.It corresponds, for example, to any region of bacterial chromosome or any region located on non-chromosomal DNA, for example, a region located on a mobile genetic element that is essential for the survival of microorganism under certain growth conditions, such as a plasmid that contains a resistance marker against an antibiotic, when the bacterium needs to be cultivated in the presence of said antibiotic under the assumed growth conditions.

[0106] In another particular embodiment, for the purpose of removing genetic elements that are not essential in the particular growth conditions associated with the cultivation of a microorganism, the targeted portion of the bacterial DNA may correspond to any region of said non-chromosomal bacterial DNA.

[0107] Particular examples of DNA segments targeted in bacteria of the genus Clostridium are the sequences used in Example 1 of the test segments. They are, for example, the sequences encoding the genes bdhA (SEQ ID NO: 77) and bdhB (SEQ ID NO: 78). The targeted DNA region / segment / sequence is followed by a sequence "PAM" ("protospacer adjacent motif") involved in binding to DNA endonucleases.

[0108] The "SDS" region of a given gRNA is one that is identical (up to 100%) or at least 80%, preferably at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to a DNA region / portion / sequence that is targeted in a bacterial genome, e.g., a bacterial chromosome, and is capable of hybridizing to a complementary sequence of all or a portion of said region / portion / sequence, typically to a sequence that contains at least 1 nucleotide, preferably at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35 or 40 nucleotides, typically between 1 and 40 nucleotides, preferably 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides.

[0109] In the present invention, the nucleic acid of interest may comprise one or more guide RNAs (gRNAs) that target a sequence (the "target sequence", "targeting sequence" or "recognized sequence"). These various gRNAs may be identical or different, targeting chromosomal regions or regions belonging to non-chromosomal bacterial DNA that may optionally be present in the microorganism (e.g. regions belonging to mobile genetic elements).

[0110] The gRNA may be introduced into the bacterial cell in the form of a gRNA molecule (mature or precursor), in the form of a precursor, or in the form of one or more nucleic acids encoding said gRNA. The gRNA is preferably introduced into the bacterial cell in the form of one or more nucleic acids encoding said gRNA.

[0111] When one or more gRNAs are directly introduced into a cell in the form of an RNA molecule, these gRNAs (mature or precursor) may contain modified nucleotides or chemical modifications that, for example, increase their resistance to nucleases and thus allow them to have a longer lifespan in the cell. In particular, they may contain at least one modified or non-natural nucleotide, such as, for example, nucleotides containing modified bases such as inosine, methyl-5-deoxycytidine, dimethylamino-5-deoxyuridine, deoxyuridine, diamino-2,6-purine, bromo-5-deoxyuridine, or any other modified base that allows hybridization. The gRNAs used according to the invention may also be modified at the level of the internucleotide bond, such as, for example, phosphorothioates, H-phosphonates or alkylphosphonates, or at the backbone (main chain) level, such as, for example, α-oligonucleotides, 2'-O-alkylribose or PNA (peptide nucleic acid) (Egholm et al., 1992).

[0112] The gRNA may be a natural RNA, a synthetic RNA, or an RNA produced by recombinant technology. These gRNAs may be prepared by any method known to those skilled in the art, such as, for example, chemical synthesis, in vivo transcription or amplification techniques.

[0113] When the gRNAs are introduced into the bacterial cell in the form of one or more nucleic acids, the sequence or sequences encoding the gRNA(s) are placed under the control of an expression promoter, which may be constitutive or inducible.

[0114] When several gRNAs are used, the expression of each gRNA can be controlled by different promoters.Preferably, the promoters used are the same for all gRNAs.In certain embodiments, one and the same promoter can be used to allow the expression of several, for example, several or all, of the gRNAs that are intended to be expressed.

[0115] In a preferred embodiment, the promoter(s) controlling expression of the gRNA / gRNAs is an inducible promoter.

[0116] Examples of constitutive promoters that can be used in the present invention may be selected from the promoter of the gene thl, the promoter of the gene ptb or the promoter of the operon BCS, or derivatives thereof, preferably miniPthl, or any other promoter that allows the synthesis of a (coding or non-coding) RNA in the bacterium of interest, well known to the person skilled in the art.

[0117] Examples of inducible promoters that can be used in the present invention can be selected from the promoter of the gene tetA, the promoter of the gene xylA, the promoter of the gene lacI, or the promoter of the gene bgaL, or derivatives thereof, preferably 2tetO1 or tetO2 / 1. A preferred inducible promoter is 2tetO1.

[0118] The promoters controlling the expression of the DNA endonuclease and the expression of the gRNA / gRNAs can be the same or different, and can be constitutive or inducible. In certain preferred embodiments, the promoters controlling the expression of the DNA endonuclease or one or more gRNAs, respectively, are different promoters but inducible by the same inducer.

[0119] The above-mentioned inducible promoters allow advantageous control of the action of the DNA endonuclease / gRNA ribonucleoprotein complex, e.g., Cas9 / gRNA, and facilitate the selection of transformants with the desired genetic modification.

[0120] The genetic tool of the invention may advantageously further comprise a sequence encoding at least one anti-CRISPR protein, i.e. a protein capable of inhibiting or blocking / neutralizing the action of Cas and / or a CRISPR / Cas system, for example a type II CRISPR / Cas system when the nuclease is a Cas9 type nuclease. This sequence is typically under the control of an inducible promoter different from the promoter controlling the expression of the DNA endonuclease and / or one or more gRNAs, and is inducible by another inducer. In a preferred embodiment, the sequence encoding the anti-CRISPR protein is more typically located on one of at least two nucleic acids present in the genetic tool. In a particular embodiment, the sequence encoding the anti-CRISPR protein is located on a nucleic acid (typically a "third nucleic acid") different from the first two. In yet another particular embodiment, both the sequence encoding the anti-CRISPR protein and the sequence encoding a transcriptional repressor of said anti-CRISPR protein are integrated into the bacterial chromosome.

[0121] In a preferred embodiment, the sequence encoding the anti-CRISPR protein is located within the genetic tool on a nucleic acid encoding a DNA endonuclease (also referred to herein as a "first nucleic acid"). In another embodiment, the sequence encoding the anti-CRISPR protein is located within the genetic tool on a nucleic acid different from that encoding the DNA endonuclease, for example, on a nucleic acid identified herein as a "second nucleic acid" or on an "nth" (generally "third") nucleic acid that may otherwise be included within the genetic tool, if desired.

[0122] Anti-CRISPR proteins are generally "anti-Cas9" or "anti-MAD7" proteins, i.e. proteins that can inhibit or block / neutralize the action of Cas9 or CAS7.

[0123] The anti-CRISPR protein is advantageously an "anti-Cas9" protein, for example selected from AcrIIA1, AcrIIA2, AcrIIA3, AcrIIA4, AcrIIA5, AcrIIC1, AcrIIC2 and AcrIIC3 (Pawluk et al., 2018). Preferably, the "anti-Cas9" protein is AcrIIA2 or AcrIIA4. Even more preferably, the "anti-Cas9" protein is AcrIIA4. Said proteins are generally capable of very significantly limiting, ideally blocking, the action of Cas9, for example by binding to the enzyme Cas9 (Dong et al., 2017; Rauch et al., 2017).

[0124] Advantageously, another anti-CRISPR protein that can be used is an "anti-MAD7" protein, such as the protein AcrVA1 (Marino et al., 2018).

[0125] In a preferred embodiment, the anti-CRISPR protein is preferably capable of inhibiting, preferably neutralizing, the action of a DNA endonuclease during the step of introducing the nucleic acid sequence of the genetic tool into the bacterial strain of interest.

[0126] The promoter that controls the expression of the sequence that codes for anti-CRISPR protein is preferably an inducible promoter.Inducible promoters are associated with constitutively expressed genes and are generally involved in the expression of proteins that allow the transcriptional repression that originates from said inducible promoter.This promoter can be selected, for example, from the promoter of gene tetA, the promoter of gene xylA, the promoter of gene lacI or the promoter of gene bgaL or their derivatives.

[0127] An example of an inducible promoter that can be used in the present invention is the promoter Pbgal (inducible by lactose), which is present in the gene tool and on the same nucleic acid alongside the constitutively expressed gene bgaR, and its expression product allows transcriptional repression starting from Pbgal. In the presence of the inducer lactose, the transcriptional repression of the promoter Pbgal is released, allowing the transcription of the gene placed downstream of the latter. Preferably, the gene placed downstream corresponds to the gene encoding an anti-CRISPR protein, such as acrIIA4, in the present invention.

[0128] A promoter controlling the expression of an anti-CRISPR protein can advantageously control the action of a DNA endonuclease, such as the enzyme Cas9, thereby facilitating the transformation of bacteria, such as bacteria of the genus Clostridium, Bacillus or Lactobacillus, and facilitating the production of transformants with the desired genetic modifications.

[0129] In a particular embodiment, the present invention relates to a genetic tool comprising as a "first" nucleic acid a plasmid vector having the sequence SEQ ID NO:23.

[0130] In yet another particular embodiment, the present invention relates to a genetic tool comprising a plasmid vector whose sequence is selected from any of SEQ ID NO:79, SEQ ID NO:80, SEQ ID NO:119, SEQ ID NO:123, SEQ ID NO:124 and SEQ ID NO:125 as the "second" or "nth" nucleic acid.

[0131] In yet another particular embodiment, the present invention relates to a genetic tool comprising a plasmid vector, the sequence of which is selected as the "nucleic acid OPT" from any of SEQ ID NO: 119, SEQ ID NO: 123, SEQ ID NO: 124 and SEQ ID NO: 125. In another particular embodiment, the genetic tool comprises several (e.g. at least two or three) sequences of SEQ ID NO: 23, 79, 80, 119, 123, 124 and 125, which sequences are different from each other.

[0132] The inventors describe examples of nucleic acids of interest, generally DNA sequences of interest, that allow the expression in a bacterium of a DNA sequence that is partially or completely absent from the genetic material present in the wild-type form of said bacterium.

[0133] In certain embodiments, expression of the DNA sequence of interest enables the bacterium, e.g. a bacterium of the genus Clostridium, to ferment (usually simultaneously) several different sugars, e.g. at least two different sugars, typically at least two different sugars that contain five carbon atoms (such as glucose or mannose), and / or at least two different sugars that contain six carbon atoms (such as xylose, arabinose or fructose), preferably at least three different sugars selected, e.g., from glucose, xylose and mannose; glucose, arabinose and mannose; and glucose, xylose and arabinose.

[0134] In another particular embodiment, the DNA sequence of interest encodes at least one product of interest, preferably a product that promotes the production of a solvent by a bacterium, such as a bacterium of the genus Clostridium, Bacillus or Lactobacillus, typically at least one protein of interest, such as an enzyme; a membrane protein, such as a transporter; a protein for the maturation of other proteins (chaperone proteins); a transcription factor; or a combination thereof.

[0135] In a preferred embodiment, the DNA sequence of interest facilitates the production of a solvent and generally comprises: i) a sequence encoding an enzyme, e.g., an enzyme involved in the conversion of an aldehyde to an alcohol, e.g., an alcohol dehydrogenase (e.g., a sequence selected from adh, adhE, adhE1, adhE2, bdhA, bdhB, and bdhC), a sequence encoding a transferase (e.g., a sequence selected from ctfA, ctfB, atoA, and atoB), a sequence encoding a decarboxylase (e.g., adc), a sequence encoding a hydrogenase (e.g., a sequence encoding a ketone), a sequence encoding a ketone, ... ii) a sequence encoding an enzyme selected from sequences encoding a membrane protein, e.g., a phosphotransferase (e.g., a sequence selected from among glcG, bglC, cbe4532, cbe4533, cbe4982, cbe4983, cbe0751); iii) a sequence encoding a transcription factor (e.g., a sequence selected from among sigL, sigE, sigF, sigG, sigH, sigK); and iv) a combination thereof.

[0136] Furthermore, the inventors describe examples in which a nucleic acid of interest recognizes (at least partially binds) and preferably targets, i.e. recognizes and enables cleavage, at least one strand of: i) a target sequence, ii) a sequence that regulates transcription of the target sequence, or iii) a sequence adjacent to the target sequence, in the genome of a bacterium of interest.

[0137] The sequence to be recognized is also referred to herein as the "target sequence" or "targeting sequence."

[0138] Also described are genetic tools that comprise or consist of said nucleic acid of interest, where the nucleic acid of interest is typically present within the "second" or "nth" nucleic acid of the genetic tool described herein.

[0139] A nucleic acid of interest is generally used herein to suppress a recognised sequence in the bacterial genome or to modify its expression, e.g. to regulate / control its expression, in particular to inhibit it, preferably to modify it so that said bacterium is unable to express a protein, in particular a functional protein, originating from said sequence.

[0140] When the target sequence is a sequence that encodes an enzyme that allows the bacterium of interest to grow in a medium containing an antibiotic to which the bacterium is resistant, a sequence that regulates the transcription of such a sequence, or a sequence adjacent to such a sequence, the antibiotic is generally an antibiotic belonging to the amphenicol class. Examples of amphenicols described herein are chloramphenicol, thiamphenicol, azidamphenicol and furofenicol (Schwarz S. et al., 2004), in particular chloramphenicol and thiamphenicol.

[0141] In certain embodiments, the nucleic acid of interest is at least 100% identical or 80% identical, preferably 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to the DNA region / portion / sequence targeted in the bacterial genome and capable of hybridizing to all or a portion of the complementary sequence of said region / portion / sequence, generally a sequence comprising at least 1 nucleotide, preferably a sequence comprising at least 1, 2, 3, 4, 5, 10, 14, 15, 20, 25, 30, 35 or 40 nucleotides, generally between 1, 10 or 20 nucleotides and 1000 nucleotides, such as between 1, 10 or 20 nucleotides and 900, 800, 700, 600, 500, 400, 500, 600, 700, 800, 900, 10 ... The nucleic acid of interest may comprise at least one complementary region of the target sequence that can hybridize to a sequence comprising between 300 or 200 nucleotides, between 1, 10 or 20 nucleotides and 100 nucleotides, between 1, 10 or 20 nucleotides and 50 nucleotides, or between 1, 10 or 20 nucleotides and 40 nucleotides, such as 10-40 nucleotides, 10-30 nucleotides, 10-20 nucleotides, 20-30 nucleotides, 15-40 nucleotides, 15-30 nucleotides or 15-20 nucleotides, preferably 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides. The complementary region of the target sequence present in the nucleic acid of interest may correspond to the "SDS" region of the guide RNA (gRNA) used in the CRISPR tool, as described herein.

[0142] In another particular embodiment described, the nucleic acid of interest comprises at least two regions complementary to the target sequence, each of which is 100% identical or at least 80% identical, preferably at least 85%, 90%, 95%, 96%, 97%, 98% or 99% identical to said DNA region / part / sequence targeted in the bacterial genome. These regions are capable of hybridizing to the above sequences, which comprise all or part of the complementary sequence of said region / part / sequence, generally at least one nucleotide, preferably at least 100 nucleotides, generally 100-1000 nucleotides. The complementary region of the target sequence present in the nucleic acid of interest can recognize, preferably target, the 5' and 3' flanking regions of the targeting sequence in a tool for genetic modification described herein, such as, for example, the genetic tool ClosTron®, the genetic tool Targetron® or an allelic exchange tool of the ACE® type.

[0143] According to a particular aspect, the target sequence is a sequence encoding an amphenicol-O-acetyltransferase, e.g., chloramphenicol-O-acetyltransferase or thiamphenicol-O-acetyltransferase, in the genome of a bacterium of interest, e.g., of the genus Clostridium, capable of growing in a medium containing one or more antibiotics belonging to the amphenicol class, e.g., chloramphenicol and / or thiamphenicol, and is a sequence that regulates the transcription of such a sequence or is adjacent to such a sequence.

[0144] The recognized sequence is, for example, the sequence of SEQ ID NO: 18, which corresponds to the gene catB (CIBE_3859) encoding chloramphenicol-O-acetyltransferase of C. beijerinckii DSM6423, or an amino acid sequence that is at least 70%, 75%, 80%, 85%, 90% or 95% identical to said chloramphenicol-O-acetyltransferase, or a sequence that comprises all or at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of SEQ ID NO: 18. In other words, the recognized sequence can be a sequence comprising at least 1 nucleotide, preferably at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35 or 40 nucleotides, generally 1 to 40 nucleotides, preferably 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides of SEQ ID NO:18.

[0145] Examples of amino acid sequences that are at least 70% identical to the chloramphenicol-O-acetyltransferase encoded by SEQ ID NO: 18 correspond to the sequences defined in the NCBI database with the following reference numbers: WP_077843937.1, SEQ ID NO: 44 (WP_063843219.1), SEQ ID NO: 45 (WP_078116092.1), SEQ ID NO: 46 (WP_077840383.1), SEQ ID NO: 47 (WP_077307770.1), SEQ ID NO: 48 (WP_103699368.1), SEQ ID NO: 49 (WP_087701812.1), SEQ ID NO: 50 (WP_017210112.1), SEQ ID NO: 51 (WP_077831818.1), SEQ ID NO: 52 (WP_012059398.1), SEQ ID NO: 53 (WP _077363893.1), SEQ ID NO:54 (WP_015393553.1), SEQ ID NO:55 (WP_023973814.1), SEQ ID NO:56 (WP_026887895.1), SEQ ID NO:57 (AWK51568.1), SEQ ID NO:58 (WP_003359882.1), SEQ ID NO:59 (WP_091687918.1), SEQ ID NO:60 (WP_0556685 44.1), SEQ ID NO:61 (KGK90159.1), SEQ ID NO:62 (WP_032079033.1), SEQ ID NO:63 (WP_029163167.1), SEQ ID NO:64 (WP_017414356.1), SEQ ID NO:65 (WP_073285202.1), SEQ ID NO:66 (WP_063843220.1) and SEQ ID NO:67 (WP_021281995.1).

[0146] Examples of amino acid sequences that are at least 75% identical to the chloramphenicol-O-acetyltransferase encoded by SEQ ID NO: 18 are the sequences WP_077843937.1, WP_063843219.1, WP_078116092.1, WP_077840383.1, WP_077307770.1, WP_103699368.1, WP_087701812.1, WP_0 17210112.1, WP_077831818.1, WP_012059398.1, WP_077363893.1, WP_015393553.1, WP_023973814.1, WP_026887895.1, AWK51568.1, WP_003359882.1, WP_091687918.1, WP_055668544.1 and KGK90159.1.

[0147] Examples of amino acid sequences that are at least 90% identical to the chloramphenicol-O-acetyltransferase encoded by SEQ ID NO: 18 are the sequences WP_077843937.1, WP_063843219.1, WP_078116092.1, WP_077840383.1, WP_077307770.1, WP_103699368.1, WP_087701812.1, WP_017210112.1, WP_077831818.1, WP_012059398.1, WP_077363893.1, WP_015393553.1, WP_023973814.1, WP_026887895.1 and AWK51568.1.

[0148] Examples of amino acid sequences that are at least 95% identical to the chloramphenicol-O-acetyltransferase encoded by SEQ ID NO:18 correspond to the sequences WP_077843937.1, WP_063843219.1, WP_078116092.1, WP_077840383.1, WP_077307770.1, WP_103699368.1, WP_087701812.1, WP_017210112.1, WP_077831818.1, WP_012059398.1, WP_077363893.1, WP_015393553.1, WP_023973814.1 and WP_026887895.1.

[0149] Preferred amino acid sequences that are at least 99% identical to the chloramphenicol-O-acetyltransferase encoded by SEQ ID NO: 18 are the sequences WP_077843937.1, SEQ ID NO: 44 (WP_063843219.1) and SEQ ID NO: 45 (WP_078116092.1).

[0150] The particular sequence identical to SEQ ID NO: 18 is the sequence defined in the NCBI database under the reference number WP_077843937.1.

[0151] By way of specific example, the target sequence is SEQ ID NO:68, which corresponds to the gene catQ encoding chloramphenicol-O-acetyltransferase of C. perfringens, the amino acid sequence of which corresponds to SEQ ID NO:66 (WP_063843220.1), or a sequence that is at least 70%, 75%, 80%, 85%, 90% or 95% identical to said chloramphenicol-O-acetyltransferase, or a sequence that comprises all or at least 70%, 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98% or 99% of SEQ ID NO:68.

[0152] In other words, the recognized sequence may be a sequence comprising at least 1 nucleotide, preferably at least 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 35 or 40 nucleotides, generally 1 to 40 nucleotides, preferably 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29 or 30 nucleotides of SEQ ID NO:68.

[0153] In yet another particular example, the recognized sequence is selected from the nucleic acid sequences catB (SEQ ID NO: 18), catQ (SEQ ID NO: 68), catD (SEQ ID NO: 69, Schwarz S. et al., 2004) or catP (SEQ ID NO: 70, Schwarz S. et al., 2004), known by those skilled in the art, which are naturally occurring in the bacterium or artificially introduced into said bacterium.

[0154] As mentioned above, in another particular example, the target sequence may also be a sequence regulating the transcription of said coding sequence (encoding an enzyme that allows the bacterium of interest to grow in a medium containing the antibiotic to which it is resistant), typically a promoter sequence, such as the promoter sequence of the catB gene (SEQ ID NO: 73) or the promoter sequence of the catQ gene (SEQ ID NO: 74).

[0155] The nucleic acid of interest is then capable of recognizing, and therefore generally binding to, sequences which regulate the transcription of said coding sequence.

[0156] In another particular example, the target sequence may be a sequence adjacent to the coding sequence described above, for example a sequence adjacent to gene catB of SEQ ID NO: 18 or a sequence at least 70% identical to the latter. The flanking sequence generally comprises between 1, 10 or 20 and 1000 nucleotides, for example between 1, 10 or 20 and 900, 800, 700, 600, 500, 400, 300 or 200 nucleotides, between 1, 10 or 20 and 100 nucleotides, between 1, 10 or 20 and 50 nucleotides, or between 1, 10 or 20 and 40 nucleotides, for example between 10 and 40 nucleotides, between 10 and 30 nucleotides, between 10 and 20 nucleotides, between 20 and 30 nucleotides, between 15 and 40 nucleotides, between 15 and 30 nucleotides, or between 15 and 20 nucleotides.

[0157] In a particular aspect, the target sequence corresponds to a pair of sequences flanking the coding sequence, each flanking sequence typically comprising at least 20 nucleotides, typically between 100 and 1000 nucleotides, preferably between 200 and 800 nucleotides.

[0158] Particular examples of nucleic acids of interest used herein to transform and / or genetically modify a bacterium of interest are DNA fragments that i) recognize the coding sequence of, ii) regulate the transcription of, or iii) flank the coding sequence of, an enzyme of interest, preferably an amphenicol-O-acetyltransferase, such as chloramphenicol-O-acetyltransferase or thiamphenicol-O-acetyltransferase, in the genome of a bacterium, such as a bacterium of the genus Clostridium as mentioned above.

[0159] An example of a nucleic acid of interest of the present invention as described above is capable of suppressing a recognized sequence ("target sequence") in the genome of a bacterium or modifying its expression, e.g. regulating it, in particular inhibiting it, preferably modifying it so that said bacterium is unable to express a protein starting from said sequence, e.g. amphenicol-O-acetyltransferase, in particular a functional protein.

[0160] In certain embodiments where the recognized sequence encoding an enzyme is a sequence that confers resistance to chloramphenicol and / or thiamphenicol to the bacterium, the selection gene used is not a gene for resistance to chloramphenicol and / or thiamphenicol, and preferably is not any of the genes catB, catQ, catD or catP.

[0161] In a particular embodiment, the nucleic acid of interest comprises one or more guide RNAs (gRNAs) that target a sequence encoding an enzyme of interest, in particular amphenicol-O-acetyltransferase, regulate the transcription of said coding sequence or flank said coding sequence, and / or a modification matrix (also referred to herein as an "editing matrix"), e.g. a matrix that allows removing or modifying all or part of a target sequence, preferably to inhibit or suppress the expression of the target sequence, generally sequences located upstream and downstream of said target sequence. and a matrix comprising sequences (sequences homologous to said sequences located upstream and downstream of the target sequence) which are generally between 10 or 20 base pairs and 1000, 1500 or 2000 base pairs, for example 100, 200, 300, 400 or 500 base pairs and 1000, 1200, 1300, 1400 or 1500 base pairs, preferably 100 to 1500 or 100 to 1000 base pairs, more preferably 500 to 1000 or 200 to 800 base pairs.

[0162] In certain embodiments, the nucleic acid of interest used to transform and / or genetically modify the bacterium of interest contains a methyltransferase of the Dam and Dcm type (dam - dcm - It is a nucleic acid that has no methylation at the level of the motif recognized by the genotype (prepared from E. coli having the genotype).

[0163] When the transformed and / or genetically modified bacterium of interest belongs to C. beijerinckii bacteria, particularly to one of the subclades DSM6423, LMG7814, LMG7815, NRRL B-593 and NCCB27006, the nucleic acid of interest used as the genetic tool, e.g., a plasmid, can be prepared by the method of any one of the following methods: - and Dcm -A nucleic acid that is not methylated at a level that results in a motif recognized by a type methyltransferase, typically a nucleic acid in which the adenosine ("A") of the GATC motif and / or the second cytosine "C" of the CCWGG motif (where W can correspond to adenosine ("A") or thymine ("T")) are demethylated.

[0164] Dam - and Dcm - Nucleic acids that do not have methylation of the motif recognized by the methyltransferases are generally called dams. - dcm - The same nucleic acid can be prepared from Escherichia coli having the genotype (e.g., Escherichia coli INV 110, Invitrogen). This same nucleic acid can contain other methylations performed, for example, by ecoKI-type methyltransferases, the latter targeting the adenine ("A") of the AAC(N6)GTGC and GCAC(N6)GTT motifs (where N can correspond to any base).

[0165] In particular embodiments, the targeting sequence corresponds to a gene encoding amphenicol-O-acetyltransferase, such as gene catB, e.g., chloramphenicol-O-acetyltransferase, a sequence that regulates the transcription of this gene, or a sequence adjacent to this gene.

[0166] The nucleic acids of particular interest described by the inventors are, for example, vectors, preferably plasmids, such as the plasmid pCas9 of SEQ ID NO: 21 described in the experimental section of this specification. ind - ΔcatB or plasmid pCas9 of SEQ ID NO: 38 ind - gRNA_catB (Example 2), a version of said sequence that has no methylation, in particular at the level of the motifs recognized by methyltransferases of the Dam and Dcm type.

[0167] The present specification also relates to the use of the nucleic acids of interest for transforming and / or genetically modifying the bacteria of interest described herein.

[0168] Another aspect described by the inventors relates to a method for transforming and preferably further genetically modifying bacteria belonging to the phylum Firmicutes, such as bacteria of the genus Clostridium, Bacillus or Lactobacillus, generally solventogenic bacteria, in particular solventogenic bacteria of the genus Clostridium, with a genetic tool of the invention, generally a nucleic acid of interest according to the invention as described above. The method advantageously comprises a step of transforming said bacteria by introducing into said bacteria all or part of a genetic tool as described herein, in particular a nucleic acid of interest as described herein, preferably a "nucleic acid OPT" comprising or consisting of i) all or part of SEQ ID NO: 126 (OREP) and ii) a sequence that allows the genetic modification of the bacteria and / or the expression in said bacteria of a DNA sequence that is partially or completely deleted from the genetic material present in the wild type of said bacteria. The method may further comprise a step of obtaining, recovering, selecting or isolating the transformed bacteria, i.e. the bacteria that have the required recombination or recombination / modification or modification / optimization or optimization.

[0169] In a particular embodiment, the method for transforming, preferably genetically modifying, a bacterium as described herein is associated with a tool for genetic modification selected from CRISPR tools, tools based on the use of type II introns (e.g., the Targetron® tool or the ClosTron® tool) and allelic exchange tools (e.g., the ACE® tool) and comprises a step of transforming said bacterium by introducing a nucleic acid of interest according to the invention into said bacterium, as described above.

[0170] The present invention is generally advantageously used when a genetic modification tool selected for transforming, preferably genetically modifying, a bacterium belonging to the phylum Firmicutes, for example a bacterium of the genus Clostridium, is intended to be used in a bacterium, such as C. beijerinckii, which has a gene encoding an enzyme responsible for resistance to one or more antibiotics in the wild type and / or has at least one extrachromosomal DNA sequence in the wild type, and the application of the genetic tool comprises a step of transforming said bacterium with a nucleic acid allowing the expression of a resistance marker for an antibiotic to which the bacterium is resistant in the wild type, and / or a step of selecting bacteria transformed and / or genetically modified with said antibiotic (to which the bacterium is resistant in the wild type), preferably a step for selecting, among said bacteria, a bacterium that has deleted said extrachromosomal DNA sequence.

[0171] The modification advantageously obtained by the present invention, using a tool for genetic modification selected from, for example, CRISPR tools, tools based on the use of type II introns and allelic exchange tools, consists of deleting or rendering non-functional undesirable sequences, for example sequences encoding enzymes that confer resistance to one or more antibiotics to the bacterium. Another modification advantageously obtained by the present invention consists of genetically modifying a bacterium to improve its performance, for example in the production of a solvent or solvent mixture of interest, said bacterium having previously been modified by the present invention to be sensitive to an antibiotic to which it is resistant in the wild type and / or to remove extrachromosomal DNA sequences present in the wild type of said bacterium.

[0172] In a preferred embodiment, the method of the invention is based on the use (adoption) of CRISPR (Clustered Regularly Interspaced Short Palindromic Repeats) technology / genetic tools, in particular CRISPR / Cas (CRISPR-Associated protein) genetic tools.

[0173] The present invention can be implemented using conventional CRISPR / Cas genetic tools using a single plasmid containing nucleases, gRNA and a repair matrix as described in Wang et al. (2015).

[0174] Those skilled in the art can easily determine the sequence and structure of the gRNA depending on the chromosomal region or mobile genetic element to be targeted using well-known techniques (see, for example, DiCarlo et al., 2013).

[0175] The inventors have developed and described a genetic tool based on the use of two plasmids suitable for modifying bacteria of the genus Clostridium, which can also be used in the present invention (WO2017 / 064439, Wasels et al., 2017, and see FIG. 15 attached hereto).

[0176] In a particular embodiment, the "first" plasmid of this tool allows the expression of a Cas nuclease, and the "second" plasmid contains one or more gRNA expression cassettes (typically targeting different regions of the bacterial DNA) specific to the modification to be performed, as well as a repair matrix that allows the replacement of the part of the bacterial DNA targeted by Cas with the sequence of interest by a homologous recombination mechanism. The Cas gene and / or gRNA expression cassette(s) are under the control of a constitutive or inducible, preferably inducible, expression promoter known by the person skilled in the art (e.g., as described in application WO2017 / 064439, which is incorporated herein by reference), and preferably a different, but inducible expression promoter with the same inducer.

[0177] The gRNAs that can be used correspond to the gRNAs described above in this specification.

[0178] A particular method involving CRISPR technology that can be used in the present invention to transform, and generally genetically modify, the bacteria described herein by homologous recombination comprises the following steps. a) introducing into bacteria a nucleic acid or genetic tool as described by the inventors in the presence of an agent for inducing the expression of an anti-CRISPR protein; and b) culturing the transformed bacteria obtained at the end of step a) in a medium that does not contain an inducer of expression of the anti-CRISPR protein (or under unrelated conditions), typically allowing expression of a DNA endonuclease / gRNA ribonucleoprotein complex, typically allowing expression of the Cas / gRNA (to stop production of the anti-CRISPR protein and allow the action of the endonuclease).

[0179] The inducer of expression of the anti-CRISPR protein is present in an amount sufficient to induce said expression. In the case of the promoter Pbgal, the inducer lactose makes it possible to remove the inhibition of expression (transcriptional repression) of the anti-CRISPR protein associated with the expression of the protein BgaR.

[0180] The expression inducer of the anti-CRISPR protein is preferably used at a concentration of about 1 mM to about 1 M, preferably about 10 mM to about 100 mM, for example, about 40 mM.

[0181] In a preferred embodiment, the anti-CRISPR protein is preferably capable of inhibiting, preferably neutralizing, the action of nucleases during the step of introducing the nucleic acid sequence of the genetic tool into the bacterial strain of interest.

[0182] In a particular embodiment, the method further comprises during or after step b) inducing the expression of one or more inducible promoters controlling the expression of the nuclease and / or the expression of one or more guide RNAs, if said promoter(s) are present in said genetic tool, in order to allow the desired genetic modification of said bacterium when said genetic tool is introduced into said bacterium. The induction is carried out with a substance capable of removing the inhibition of expression associated with the selected inducible promoter.

[0183] Thus, if there is an induction step, it can be carried out by any culture method on a medium that allows the expression of the endonuclease / gRNA ribonucleoprotein complex known to the skilled artisan after the introduction of the genetic tool into the target bacterium by the method of the present invention. It is carried out, for example, by contacting the bacterium with a suitable substance present in sufficient amount or by exposing it to UV light. This substance makes it possible to remove the inhibition of expression associated with the selected inducible promoter. If the selected promoter is an anhydrotetracycline (aTc)-inducible promoter selected from Pcm-2tetO1 and Pcm-tetO2 / 1, aTc is preferably at a concentration of about 1 ng / ml to about 5000 ng / ml, preferably about 10 ng / ml to 1000 ng / ml, about 10 ng / ml to 800 ng / ml, about 10 ng / ml to 500 ng / ml, 100 ng / ml or 200 ng / ml to about 800 ng / ml or 1000 ng / ml. ml, or from about 100 ng / ml or 200 ng / ml to about 500 ng / ml, 600 ng / ml or 700 ng / ml, for example about 50 ng / ml, 100 ng / ml, 150 ng / ml, 200 ng / ml, 250 ng / ml, 300 ng / ml, 350 ng / ml, 400 ng / ml, 450 ng / ml, 500 ng / ml, 550 ng / ml, 600 ng / ml, 650 ng / ml, 700 ng / ml, 750 ng / ml or 800 ng / ml.

[0184] In another particular embodiment, the method comprises an additional step c) of removing the nucleic acid comprising the repair matrix (after which the bacterial cell is considered to be "stripped" of said nucleic acid) and / or removing the guide RNA(s) or sequences encoding the guide RNA(s) introduced together with the genetic tool in step a).

[0185] In yet another particular embodiment, the method comprises, following step b) or step c), one or more additional steps of introducing a repair matrix different from the one(s) already introduced and an nth, for example a third, fourth, fifth, etc. nucleic acid comprising one or more guide RNA expression cassettes capable of integrating the sequence of interest contained in said different repair matrix into the targeting zone of the bacterial genome in the presence of an inducer inducing the expression of an anti-CRISPR protein, each additional step being followed by a step of culturing the bacteria thus transformed in a medium free of an inducer inducing the expression of the anti-CRISPR protein, typically allowing the expression of a Cas / gRNA ribonucleoprotein complex.

[0186] In a particular embodiment of the method according to the invention, a bacterium is transformed with such nucleic acid or genetic tool (e.g., encoded) an enzyme responsible for cleaving at least one strand of a target sequence of interest, in a particular embodiment, the enzyme is a nuclease, preferably a Cas-type nuclease, preferably a nuclease selected from Cas9 enzyme and MAD7 enzyme. In one embodiment, the target sequence of interest is a sequence that encodes an enzyme that confers resistance to one or more antibiotics, preferably one or more antibiotics belonging to the amphenicol class, typically amphenicol-O-acetyltransferase, such as chloramphenicol-O-acetyltransferase, such as the catB gene, or is a sequence that regulates the transcription of a coding sequence or is adjacent to said coding sequence.

[0187] When used, the anti-CRISPR protein is typically an "anti-Cas" protein as described above. The anti-CRISPR protein is advantageously an "anti-Cas9" protein or an "anti-MAD7" protein.

[0188] As well as the targeted DNA sites ("recognized sequences"), the editing / repair matrix itself may contain one or more nucleic acid sequences or nucleic acid sequence sites corresponding to natural and / or synthetic coding and / or non-coding sequences. The matrix may also contain one or more "foreign" sequences, i.e. sequences that are naturally absent from the genome of bacteria belonging to the phylum Firmicutes, in particular the genera Clostridium, Bacillus or Lactobacillus, or from the genome of a particular species of said genera. The matrix may also contain a combination of sequences.

[0189] The genetic tool used in the present invention makes it possible to induce the integration of a repair matrix into the bacterial genome of a nucleic acid of interest, a sequence or a portion of a DNA sequence comprising generally at least 1 base pair (bp), preferably at least 1 bp, 2 bp, 3 bp, 4 bp, 5 bp, 10 bp, 15 bp, 20 bp, 50 bp, 100 bp, 1000 bp, 10000 bp, 100000 bp or 1000000 bp, generally 1 bp to 20 kb, such as 2 kb, 3 kb, 4 kb, 5 kb, 6 kb, 7 kb, 8 kb, 9 kb, 10 kb, 11 kb, 12 kb or 13 kb, or 1 bp to 10 kb, preferably 10 bp to 10 kb or 1 kb to 10 kb, such as 1 bp to 5 kb, 2 kb to 5 kb, or 2.5 kb or 3 kb to 5 kb.

[0190] In certain embodiments, expression of the DNA sequence of interest enables the bacterium belonging to the phylum Firmicutes, in particular the genera Clostridium, Bacillus or Lactobacillus, to ferment (generally simultaneously) a plurality of different sugars, e.g. at least two different sugars, generally at least two different sugars among sugars containing five carbon atoms (e.g. glucose or mannose) and / or among sugars containing six carbon atoms (e.g. xylose, arabinose or fructose), preferably at least three different sugars selected from, e.g. glucose, xylose and mannose; glucose, arabinose and mannose; and glucose, xylose and arabinose.

[0191] In another specific embodiment, the DNA sequence of interest encodes at least one product of interest, preferably a product that facilitates solvent production by the modified bacterium, typically at least one protein of interest, e.g., an enzyme; a membrane protein, such as a transporter; a protein for the maturation of other proteins (chaperone proteins); a transcription factor; or a combination thereof.

[0192] The genetic tool elements (nucleic acids or gRNAs) are introduced into the bacteria by any direct or indirect method known by a person skilled in the art, such as transformation, conjugation, microinjection, transfection, electroporation, etc., preferably by the electroporation method (Mermelstein et al., 1993).

[0193] In another embodiment, the method of the invention is based on the use of type II introns, for example using ClosTron® technology / genetic tools or Targetron® genetic tools.

[0194] The Targetron® technology is based on the use of a reprogrammable group II intron (based on the Lactococcus lactis intron Ll.ltrB) that can be rapidly integrated into the bacterial genome at a desired locus (Chen et al., 2005; Wang et al., 2013), usually for the purpose of inactivating a targeted gene. The mechanism of recognition of the editing site and insertion into the genome by retrosplicing is based on the homology of the intron with the region (zone) of interest on the one hand and on the activity of a protein (ltrA) on the other hand.

[0195] The ClosTron® technology is based on a similar approach, adding a selection marker within the intron sequence (Heap et al., 2007). This marker allows the selection of the intron's integration into the genome, facilitating the creation of the desired mutant. This genetic system also utilizes a type I intron. In fact, the selection marker (called RAM, short for retrotransposition activation marker) is interrupted by such a genetic element, preventing its expression from the plasmid (more precise description of this system: Zhong et al.). Splicing of this genetic element takes place before integration into the genome, resulting in a chromosome carrying an active form of the resistance gene. An optimized version of this system contains FLP / FRT sites upstream and downstream of this gene, which allows the resistance gene to be removed using the recombinase FRT (Heap et al., 2010).

[0196] In another embodiment, the method according to the invention is based on the use of allelic exchange tools, for example using ACE® technology / genetic tools.

[0197] The ACE® technology is based on the use of an auxotrophic mutant (uracil auxotrophy due to deletion of the pyrE gene in C. acetobutylicum ATCC 824, which also results in resistance to 5-fluoroorotic acid (5-FOA); Heap et al., 2012). This system uses an allelic exchange mechanism well known to those skilled in the art. After transformation with a pseudo-suicide vector (very low copies), the integration of the latter into the bacterial chromosome by a first allelic exchange event can be confirmed by the resistance gene originally present on the plasmid. This integration step can occur in two ways: either into the pyrE locus or into another locus: In the case of integration at the pyrE locus, the pyrE gene is also placed on the plasmid but is not expressed (it lacks a functional promoter). A second recombination restores a functional pyrE gene, which can then be selected for by auxotrophy (minimal medium without uracil). Since the non-functional pyrE gene also carries a selectable trait (sensitivity to 5-FOA), other integrations are possible in the same model by successively switching the state of pyrE between functional and non-functional.

[0198] When integrating into another locus, one targets a genomic region that allows expression of a counter-selection marker after recombination (typically an operon behind another gene, preferably a highly expressed gene). This second recombination is then selected for by auxotrophy (minimal medium without uracil).

[0199] In the embodiments described based on the use of type II introns, e.g. using ClosTron® technology / genetic tools or Targetron® genetic tools, or based on the use of allelic exchange tools, e.g. using ACE® technology / genetic tools, the targeted sequence will generally be one of the sequences described herein.

[0200] Special Advantageously, the nucleic acid and genetic tools of the invention make it possible to introduce small and large sequences of interest into bacteria in one step, i.e. using a single nucleic acid (generally the "nucleic acid OPT" or the "second" or "nth" nucleic acid of the tool as described herein), or in several steps, i.e. using several nucleic acids (generally the "second" or "nth" nucleic acid as described herein), preferably in one step.

[0201] In certain embodiments of the invention, the nucleic acids and genetic tools of the invention make it possible to suppress a targeted portion of bacterial DNA or to replace it with a shorter sequence (e.g., a sequence lacking at least one base pair) and / or a non-functional sequence. In preferred specific embodiments of the invention, the nucleic acids and genetic tools of the invention advantageously make it possible to introduce into a bacterium, for example into a bacterial genome, a nucleic acid of interest that comprises at least one base pair and up to 2 kb, 3 kb, 4 kb, 5 kb, 6 kb, 7 kb, 8 kb, 9 kb, 10 kb, 11 kb, 12 kb, 13 kb, 14 kb or 15 kb.

[0202] The present invention further relates to transformed and / or genetically modified bacteria, generally belonging to the phylum Firmicutes, for example belonging to the genera Clostridium, Bacillus or Lactobacillus, generally solventogenic bacteria, preferably belonging to a species corresponding to one of the subclades described by the inventors herein or obtained using a method as described by the inventors herein, as well as bacteria, clones, mutants or genetically modified organisms derived therefrom, and uses thereof.

[0203] An example of a bacterium thus transformed and / or genetically modified according to the invention is a bacterium that no longer expresses an enzyme that confers resistance to one or more antibiotics, in particular a bacterium that no longer expresses amphenicol-O-acetyltransferase, for example a bacterium which in the wild expresses the gene catB, and which, when transformed and / or genetically modified according to the invention, is deleted or rendered inexpressible. Thus, a bacterium transformed and / or genetically modified according to the invention is rendered sensitive to amphenicols, such as the amphenicols described herein, in particular chloramphenicol or thiamphenicol.

[0204] Specific examples of preferred genetically modified bacteria according to the present invention are registered with the Belgian Co-ordinated Collections of Microorganisms ("BCCM"), KL Ledeganckstraat 35, B-9000 Ghent - Belgium on December 6, 2018. Receiving The bacterium is also identified as C. beijerinckii IFP962 ΔcatB, registered under the accession number LMG P-31151.

[0205] In another specific example of a preferred genetically modified bacterium of the present invention, the bacterium defined herein as C. beijerinckii is a bacterium that has been deposited in the collection BCCM-LM on February 20, 2019. Receiving The strain is C. beijerinckii IFP963 ΔcatB ΔpNF2, registered under the accession number LMG P-31277.

[0206] The present specification also relates to any derived bacterium, clone, mutant or genetically modified version of one of the above bacteria, for example any derived bacterium, clone, mutant or genetically modified version of the above bacteria that is sensitive to amphenicol, such as thiamphenicol and / or chloramphenicol, and generally lacks the gene catB of SEQ ID NO: 18 and the plasmid pNF2.

[0207] In a particular embodiment, the transformed and / or genetically modified bacteria according to the invention, for example the bacterium C. beijerinckii IFP962 ΔcatB or the bacterium C. beijerinckii IFP963 ΔcatB ΔpNF2, can still be transformed, preferably genetically modified. This can be done using a nucleic acid, for example a plasmid as described herein, for example in the experimental part. An example of a nucleic acid that can be advantageously used is the plasmid pCas9 of sequence SEQ ID NO: 23. acr (as described in the experimental section of this specification), or pCas9 ind (SEQ ID NO: 22), pCas9 cond(SEQ ID NO: 133) and pMAD7 (SEQ ID NO: 134).

[0208] A particular aspect of the invention indeed relates to the use of a genetically modified bacterium as described herein, preferably the bacterium C. beijerinckii IFP962 ΔcatB deposited under accession number LMG P-31151 (herein also described as C. beijerinckii DSM 6423 ΔcatB), more preferably the bacterium C. beijerinckii IFP963 ΔcatB ΔpNF2 deposited under accession number LMG P-31277, or a genetically modified version of one of the latter, for the production of one or more solvents, at least isopropanol, preferably on an industrial scale, by expression of one or more nucleic acids of interest spontaneously introduced into its genome, for example by means of one of the nucleic acids, genetic tools or methods described herein.

[0209] The present invention also relates to a kit comprising (i) a nucleic acid as described herein, e.g., an "OPT nucleic acid" or a DNA fragment recognizing a target sequence in a bacterium belonging to the phylum Firmicutes as described herein, and (ii) at least one tool, preferably several tools, selected from the following elements of genetic modification tools for transforming and generally genetically modifying a bacterium of this type to produce an improved variant of said bacterium; a nucleic acid which is a gRNA; a nucleic acid which is a repair matrix; an "OPT nucleic acid"; at least one primer pair, e.g., a primer pair as described herein; and an inducer that allows expression of a protein encoded by said tool, e.g., a Cas9 or MAD7-type nuclease.

[0210] Genetic modification tools for transforming and generally genetically modifying bacteria belonging to the Firmicutes phylum described herein can be selected from, for example, "nucleic acid OPT", CRISPR tools, tools based on the use of type II introns and allelic exchange tools, as described above.

[0211] In certain embodiments, the kit comprises some or all of the elements of the genetic tools described herein.

[0212] A particular kit for transforming, preferably genetically modifying, a bacterium belonging to the phylum Firmicutes described herein or for producing at least one solvent, such as a solvent mixture, using this type of bacterium comprises a nucleic acid comprising or consisting of i) all or part of the sequence of SEQ ID NO: 126, and ii) a sequence enabling genetic modification of the bacterium and / or expression in said bacterium of a DNA sequence that has been partially or completely deleted from the genetic material present in the wild type of said bacterium; and at least one inducer suitable for an inducible promoter of expression of a selected anti-CRISPR protein used in the genetic tool described herein.

[0213] The kit may further comprise one or more inducers suitable for the selected inducible promoter(s) that may optionally be used in the genetic tool to regulate expression of the nuclease(s) and / or one or more guide RNAs used.

[0214] Certain kits of the present invention allow for the expression of a nuclease that includes a label (or "tag").

[0215] The kits of the present invention may further comprise one or more consumables, including a culture medium, at least one competent bacterium belonging to the phylum Firmicutes as described herein, such as a bacterium of the genus Clostridium, Bacillus or Lactobacillus (i.e., for purposes of transformation), at least one gRNA, a nuclease, one or more selection molecules, or an instruction leaflet.

[0216] The present specification also relates to the use of a kit of the invention or one or more components of this kit, as described herein, for carrying out a method of transformation and ideal genetic modification of bacteria belonging to the phylum Firmicutes, such as bacteria of the genera Clostridium, Bacillus or Lactobacillus (for example the bacterium C. beijerinckii IFP962 ΔcatB deposited under the accession number LMG P-31151), preferably a bacterium that in the wild state carries both a bacterial chromosome and at least one DNA molecule different from the chromosomal DNA (usually a natural plasmid), most preferably the bacterium C. beijerinckii IFP963 ΔcatB ΔpNF2 (deposited under the accession number LMG P-31277), and / or for producing a solvent(s) or biofuel(s), or a mixture thereof, preferably on an industrial scale, using said bacteria.

[0217] Solvents which may be produced are typically acetone, butanol, ethanol, isopropanol or mixtures thereof, typically ethanol / isopropanol, butanol / isopropanol or ethanol / butanol mixtures, preferably isopropanol / butanol mixtures.

[0218] The use of the transformed bacteria in the present invention typically enables industrial-scale annual production of at least 100 tons of acetone, at least 100 tons of ethanol, at least 1000 tons of isopropanol, at least 1800 tons of butanol, or at least 40,000 tons of a mixture thereof.

[0219] The following examples are intended to more fully illustrate the invention without limiting its scope. EXAMPLES

[0220] Example 1 material and method Culture conditions C. acetobutylicum DSM792 was grown in 2YTG medium (tryptone 16 g.l -1, yeast extract 10g.l -1 , glucose 5g.l -1 , NaCl 4g.l -1 E. coli NEB10B was cultured in LB medium (tryptone 10 g.l -1 , yeast extract 5g.l -1 , NaCl 5g.l -1 The solid medium was cultured at 15 g.l -1 The agarose was added to the liquid medium. Erythromycin (40 mg or 500 mg / l in 2YTG or LB medium, respectively) was added. -1 concentration), chloramphenicol (25 mg or 12.5 mg.l on solid or liquid LB medium, respectively), -1 ), and thiamphenicol (15 mg.l in 2YTG medium). -1 ) was used where necessary.

[0221] Nucleic acid handling All enzymes and kits used were used according to the supplier's recommendations.

[0222] Plasmid construction Plasmid pCas9 shown in Figure 4 acr (SEQ ID NO: 23) and a fragment (SEQ ID NO: 81) containing bgaR and acrIIA4 under the control of the promoter Pbgal, synthesized by Eurofins Genomics, were inserted into the vector pCas9 ind The construct was constructed by cloning at the level of the SacI site of ( Wasels et al., 2017 ).

[0223] Plasmid pGRNA ind (SEQ ID NO: 82) was constructed by cloning an expression cassette of the gRNA (SEQ ID NO: 83) into the SacI site of the vector pEC750C (SEQ ID NO: 106) under the control of the promoter Pcm-2tetO1 (Dong et al., 2012) synthesized by Eurofins Genomics (Wasels et al., 2017).

[0224] Plasmids pGRNA-xylB (SEQ ID NO: 102), pGRNA-xylR (SEQ ID NO: 103), pGRNA-glcG (SEQ ID NO: 104) and pGRNA-bdhB (SEQ ID NO: 105) were ligated with the respective primer pairs 5'-TCATGATTTCTCCATATTAGCTAG-' and 5'-AAACCTAGCTAATATGGAGAAATC-3', 5'-TCATGTTACACTTGGAACAGGCGT-3' and 5'-AAACACGCCTGTTCCAAGTGTAAC-3', 5'-TCATTTCCGGCAGTAGGATCCCCA-3' and 5'-AAACTGGGGATCCTACTGCCGGAA-3', 5'-TCATGCTTATTACGACATAACACA-3' and 5'-AAACTGTGTTATGTCGTAATAAGC-3' to form plasmid pGRNA digested with BsaI. ind (SEQ ID NO:82).

[0225] Plasmid pGRNA-ΔbdhB (SEQ ID NO: 79) was constructed by cloning a DNA fragment obtained by overlapping PCR assembly of PCR products obtained with primers 5'-ATGCATGGATCCAAACGAACCCAAAAAGAAAGTTTC-3' and 5'-GGTTGATTTCAAATCTGTGTAAACCTACCG-3' on the one hand and 5'-ACACAGATTTGAAATCAACCACTTTAACCC-3' and 5'-ATGCATGTCGACTCTTAAGAACATGTATAAAGTATGG-3' on the other hand into vector pGRNA-bdhB digested with BamHI and SacI.

[0226] Plasmid pGRNA-ΔbdhA ΔbdhB (SEQ ID NO: 80) was constructed by cloning a DNA fragment obtained by overlapping PCR assembly of PCR products obtained with primers 5'-ATGCATGGATCCAAACGAACCCAAAAAGAAAGTTTC-3' and 5'-GCTAAGTTTTAAATCTGTGTAAACCTACCG-3' on the one hand and 5'-ACACAGATTTAAAACTTAGCATACTTCTTACC-3' and 5'-ATGCATGTCGACCTTCTAATCTCCTCTACTATTTTAG-3' on the other hand into vector pGRNA-bdhB digested with BamHI and SacI.

[0227] Transformation C. acetobutylicum DSM792 was transformed according to the protocol described by Mermelstein et al., 1993. It was transformed with a plasmid containing a gRNA expression cassette and a Cas9 expression plasmid (pCas9 ind or pCas9 acr Selection of C. acetobutylicum DSM792 transformants, which already contained erythromycin (40 mg.l -1 ), thiamphenicol (15 mg.l -1 ) and lactose (40 nM).

[0228] Induction of cas9 expression During the growth of the resulting transformants, erythromycin (40 mg / l -1 ), thiamphenicol (15 mg.l -1 ) and cas9 and gRNA expression inducer, aTc (1 mg.l -1 Induction of cas9 expression was performed in solid 2YTG medium containing 5% naphthalene.

[0229] Amplification of the bdh locus Control of genome editing of C. acetobutylicum DSM792 at the loci of bdhA and bdhB genes was performed by PCR using Q5® High-Fidelity DNA polymerase enzyme (NEB) and primer V1 (5′-ACACATTGAAGGGAGCTTTT-3′) and primer V2 (5′-GGCAACAACATCAGGCCTTT-3′).

[0230] result Transformation efficiency To evaluate the effect of acrIIA4 gene insertion on the transformation frequency of Cas9 expression plasmid, pCas9 ind (SEQ ID NO: 22) or pCas9 acr Various gRNA expression plasmids were transformed into the DSM792 strain containing (SEQ ID NO: 23) and the transformants were selected on lactose-supplemented medium. The transformation frequencies obtained are shown in FIG.

[0231] Creation of ΔbdhB and ΔbdhAΔbdhB mutants A target plasmid containing a gRNA expression cassette targeting bdhB (pGRNA-bdhB-SEQ ID NO: 105) and two derivative plasmids containing a repair matrix allowing deletion of the bdhB gene alone (pGRNA-ΔbdhB-SEQ ID NO: 79) or the bdhA and bdhB genes (pGRNA-ΔbdhAΔbdhB-SEQ ID NO: 80) were transformed into pCas9 ind (SEQ ID NO: 22) or pCas9 acr (SEQ ID NO: 23) was transformed into strain DSM792. The transformation frequencies obtained are shown in Table 2.

[0232] [Table 2]

[0233] pCas9 ind or pCas9 acrTransformation frequencies of bdhB-targeting plasmids in DSM792 strains containing . The frequencies are expressed as the number of transformants obtained per μg of DNA used for transformation and are the average of at least two independent experiments.

[0234] The resulting transformants were cultured on medium supplemented with anhydrotetracycline, aTc, to induce expression of the CRISPR / Cas9 system (Figure 6).

[0235] The desired modification was confirmed by PCR of genomic DNA of two aTc-resistant colonies (Figure 7).

[0236] conclusion The CRISPR / Cas9-based genetic tool described by Wasels et al. (2017) uses two plasmids: - The first plasmid, pCas9 ind comprises Cas9 under the control of an aTc inducible promoter, and - A second plasmid derived from pEC750C contains a gRNA expression cassette (under the control of a second aTc-inducible promoter) and an editing matrix to repair double-stranded breaks induced by this system.

[0237] However, despite using an aTc inducible promoter to control gRNA expression similar to that of Cas9, the inventors observed that certain gRNAs were still highly toxic, thereby limiting the efficiency of bacterial transformation with genetic tools and therefore chromosomal modification.

[0238] To improve this genetic tool, we modified the cas9 expression plasmid by inserting the anti-CRISPR gene, acrIIA4, under the control of a lactose-inducible promoter, which significantly improved the transformation efficiency of the different gRNA expression plasmids and allowed us to obtain transformants for all plasmids tested.

[0239] pCas9 ind We were also able to edit the bdhB locus in the C. acetobutylicum DSM792 genome using a plasmid that could not be transferred into the DSM792 strain containing . The observed modification frequency was similar to previous observations (Wasels et al., 2017), with 100% of the colonies tested being modified.

[0240] In conclusion, modification of the cas9 expression plasmid allows for better control of the Cas9-gRNA ribonucleoprotein complex, advantageously facilitating the production of transformants in which the action of Cas9 can be triggered to obtain mutants of interest.

[0241] Example 2 material and method Culture conditions C. beijerinckii DSM6423 was grown in 2YTG medium (tryptone 16 g.L -1 , yeast extract 10g.L -1 , glucose 5g.L -1 , NaCl 4 g.L -1 E. coli NEB10-β and INV110 were cultured in LB medium (tryptone 10 g.L -1 , yeast extract 5g.L -1 , NaCl 5 g.L -1 ) and the solid medium was 15 g.L -1 The agarose was added to the liquid medium. Erythromycin (20 mg or 500 mg.L in 2YTG or LB medium, respectively) -1 concentration), chloramphenicol (25 mg or 12.5 mg.L in solid or liquid LB medium, respectively). -1 ), thiamphenicol (15 mg.L in 2YTG medium -1 ) or spectinomycin (100 mg or 650 mg.L in LB or 2YTG medium, respectively). -1 Concentrations of 100 mg / mL or less were used where necessary.

[0242] Nucleic Acids and Plasmid Vectors All enzymes and kits were used according to the supplier's recommendations.

[0243] The colony PCR assay was observed with the following protocol: An isolated colony of C. beijerinckii DSM 6423 was resuspended in 100 μL of Tris 10 mM pH 7.5 EDTA 5 mM. The solution was heated at 98° C. for 10 minutes without stirring. 0.5 μL of this bacterial lysate can then be used as a PCR matrix in a 10 μL reaction containing Phire (Thermo Scientific), Phusion (Thermo Scientific), Q5 (NEB) or KAPA2G Robust (Sigma-Aldrich) polymerase.

[0244] The list of primers (name / DNA sequence) used in all constructions is detailed below: ΔcatB_fwd : TGTTATGGATTATAAGCGGCTCGAGGACGTCAAACCATGTTAATCATTGC ΔcatB_rev : AATCTATCACTGATAGGGACTCGAGCAATTTCACCAAAGAATTCGCTAGC ΔcatB_gRNA_rev : AATCTATCACTGATAGGGACTCGAGGGGCAAAAGTGTAAAGACAAGCTTC RH076 : CATATAATAAAAGGAAACCTCTTGATCG RH077 : ATTGCCAGCCTAACACTTGG RH001 : ATCTCCATGGACGCGTGACGTCGACATAAGGTACCAGGAATTAGAGCAGC RH002 : TCTATCTCCAGCTCTAGACCATTATTATTCCTCCAAGTTTGCT RH003 : ATAATGGTCTAGAGCTGGAGATAGATTATTTGGTACTAAG RH004 : TATGACCATGATTACGAATTCGAGCTCGAAGCGCTTATTATTGCATTAGC pEX-fwd : CAGATTGTACTGAGAGTGCACC pEX-rev : GTGAGCGGATAACAATTTCACAC pEC750C-fwd : CAATATTCCACAATATTATATTATAAGCTAGC M13-rev : CAGGAAACAGCTATGAC RH010 : CGGATATTGCATTACCAGTAGC RH011 : TTATCAATCTCTTACACATGGAGC RH025 : TAGTATGCCGCCATTATTACGACA RH134 : GTCGACGTGGAATTGTGAGC pNF2_fwd : GGGCGCACTTATACACCACC pNF2_rev : TGCTACGCACCCCCTAAAGG RH021 : ACTTGGGTCGACCACGATAAAACAAGGTTTTAAGG RH022 : TACCAGGGATCCGTATTAATGTAACTATGATATCAATTCTTG aad9-fwd2 : ATGCATGGTCCCAATGAATAGGTTTACACTTACTTTAGTTTTATGG aad9-rev : ATGCGAGTTAACAACTTCTAAAATCTGATTACCAATTAG RH031 : ATGCATGGATCCCAATGAATAGGTTTACACTTACTTTAGTTTTATGG RH032 : ATGCGAGAGCTCAACTTCTAAAATCTGATTACCAATTAG RH138 : ATGCATGGATCCGTCTGACAGTTACCAGGTCC RH139 : ATGCGAGAGCTCCAATTGTTCAAAAAAATAATGGCGGAG RH140 : ATGCATGGATCCCGGCAGTTTTTCTTTTTCGG RH141 : ATGCGAGAGCTCGGTTAAATACTAGTTTTTAGTTACAGAC

[0245] The following plasmid vectors were prepared: - Plasmid No. 1: pEX-A258-ΔcatB (SEQ ID NO: 17) It contains a synthetic DNA fragment ΔcatB cloned into the plasmid pEX-A258, which contains i) a guide RNA expression cassette targeting the catB gene (chloramphenicol resistance gene encoding chloramphenicol-O-acetyltransferase - SEQ ID NO: 18) of C. beijerinckii DSM6423 under the control of an anhydrotetracycline inducible promoter (expression cassette: SEQ ID NO: 19), and ii) an editing matrix (SEQ ID NO: 20) containing 400 bp of homology located upstream and downstream of the catB gene.

[0246] -Plasmid number 2: pCas9 ind -ΔcatB (see FIG. 9 and SEQ ID NO: 21) This was amplified by PCR (with primers ΔcatB_fwd and ΔcatB_rev) and digested with XhoI restriction enzyme into pCas9 ind (described in patent application WO2017 / 064439 - SEQ ID NO: 22).

[0247] -Plasmid number 3: pCas9 acr (See FIG. 10 and SEQ ID NO:23)

[0248] - Plasmid No. 4: pEC750S-uppHR (see FIG. 11 and SEQ ID NO: 24) It contains the repair matrix (SEQ ID NO: 25) used for the deletion of the upp gene and consists of two DNA fragments (respective size: 500 bp (SEQ ID NO: 26) and 377 bp (SEQ ID NO: 27)) that are homologous to the upstream and downstream of the upp gene. The assembly was obtained using the Gibson cloning system (New England Biolabs, Gibson assembly Master Mix2X). For this purpose, the upstream and downstream parts were amplified by PCR from the genomic DNA of the DSM6423 strain (see Mate de Gerando et al., 2018 and accession number PRJEB11626 (https: / / www.ebi.ac.uk / ena / data / view / PRJEB11626)) with the respective primers RH001 / RH002 and RH003 / RH004. These two fragments were then assembled in pEC750S, previously linearized with restriction enzymes (SalI and SacI restriction enzymes).

[0249] - Plasmid No. 5: pEX-A2-gRNA-upp (see FIG. 12 and SEQ ID NO: 28) This plasmid contains a gRNA-upp DNA fragment corresponding to an expression cassette (SEQ ID NO: 29) of a gRNA targeting the upp gene (protospacer targeting upp (SEQ ID NO: 31)) under the control of a constitutive promoter (non-coding RNA of sequence SEQ ID NO: 30) inserted into a replicating plasmid called pEX-A2.

[0250] - Plasmid No. 6: pEC750S-Δupp (see FIG. 13 and SEQ ID NO: 32) It contains a DNA fragment based on the plasmid pEC750S-uppHR (SEQ ID NO: 24) and additionally contains a guide RNA expression cassette targeting the upp gene under the control of a constitutive promoter. This fragment was inserted into pEX-A2 and designated pEX-A2-gRNA-upp. The insert was then amplified by PCR using primers pEX-fwd and pEX-rev and cut with restriction enzymes XhoI and NcoI. Finally, the fragment was cloned by ligation into pEC750S-uppHR, which had been previously cut with the same restriction enzymes, to obtain pEC750S-Δupp.

[0251] - Plasmid No. 7: pEC750C-Δupp (see FIG. 14 and SEQ ID NO: 33) The cassette containing the guide RNA and repair matrix was amplified with primers pEC750C-fwd and M13-rev. The amplified product was digested with restriction enzymes XhoI and SacI and cloned by enzymatic ligation into pEC750C to obtain pEC750C-Δupp.

[0252] - Plasmid No. 8: pGRNA-pNF2 (see FIG. 15 and SEQ ID NO: 34) This plasmid is based on pEC750C and contains a guide RNA expression cassette targeted to plasmid pNF2 (SEQ ID NO: 118).

[0253] -Plasmid number 9: pCas9 ind - gRNAcatB (see Figure 23 and SEQ ID NO: 38) This is a sequence encoding a guide RNA sequence targeting the catB locus amplified by PCR (primers ΔcatB_fwd and ΔcatB_gRNA_rev), which is expressed as pCas9 ind (described in patent application WO2017 / 064439) contains the sequences cloned after cleavage and ligation of various DNAs with the XhoI restriction enzyme.

[0254] - Plasmid No. 10: pNF3 (see FIG. 25 and SEQ ID NO: 119) It contains a part of pNF2, including in particular the origin of replication and the gene encoding the plasmid replication protein (CIBE_p20001), amplified with primers RH021 and RH022. This PCR product was then cloned at the level of the restriction sites SalI and BamHI of the plasmid pUC19 (SEQ ID NO: 117).

[0255] - Plasmid No. 11: pEC751S (see FIG. 26 and SEQ ID NO: 121) It contains all elements of pEC750C (SEQ ID NO: 106) except for the chloramphenicol resistance gene catP (SEQ ID NO: 70), which has been replaced by the gene aad9 (SEQ ID NO: 130) of Enterococcus faecalis, which confers resistance to spectinomycin. This element was amplified with primers aad9-fwd2 and aad9-rev starting from plasmid pMTL007S-E1 (SEQ ID NO: 120) and cloned into pEC750C at sites AvaII and HpaI, in place of gene catP (SEQ ID NO: 70).

[0256] - Plasmid No. 12: pNF3S (see FIG. 27 and SEQ ID NO: 123) It contains all the elements of pNF3 with the insertion of the gene aad9 (amplified with primers RH031 and RH032 starting from pEC751S) between sites BamHI and SacI.

[0257] - Plasmid No. 13: pNF3E (see FIG. 28 and SEQ ID NO: 124) It contains all the elements of pNF3 with the insertion of the Clostridium difficile gene ermB (SEQ ID NO: 131) under the control of the promoter miniPthl. This element was amplified starting from pFW01 with primers RH138 and RH139 and cloned between the sites BamHI and SacI of pNF3E.

[0258] - Plasmid No. 14: pNF3C (see FIG. 29 and SEQ ID NO: 125) It contains all the elements of pNF3 with the insertion of the Clostridium perfringens gene catP (SEQ ID NO: 70), which was amplified starting from pEC750C with primers RH140 and RH141 and cloned between sites BamHI and SacI of pNF3E.

[0259] Result No. 1 Transformation of C. beijerinckii strain DSM6423 The plasmid was then transferred to E. coli dam - dcm - The plasmid pCas9 was introduced into the DSM6423 strain (INV110, Invitrogen) and replicated therein, before being transformed into the DSM6423 strain according to the protocol described by Mermelstein et al. (1993). ind -ΔcatB allows for the removal of Dam- and Dcm-type methylation, but with the following modifications: transform the strain with a larger amount of plasmid (20 μg), OD600 = 0.8, and electroporation parameters of 100 Ω, 25 μF, and 1400 V. Transform the plasmid pCas9 by growing it on a petri dish containing erythromycin (20 μg / mL). ind -ΔcatB containing C. beijerinckii DSM6423 transformants were obtained.

[0260] Induction of cas9 expression and generation of C. beijerinckii DSM6423 ΔcatB strain (C. beijerinckii IFP962 ΔcatB) Next, several erythromycin-resistant colonies were taken up in 100 μL of culture medium (2YTG) and diluted 10:1 with the culture medium. 4 For each colony, 8 μL of each dilution was added to a petri dish containing erythromycin and anhydrotetracycline (200 ng / mL) to induce expression of the gene encoding the nuclease Cas9. After extraction of genomic DNA, the deletion of gene catB in the clone grown on this dish was confirmed by PCR using primers RH076 and RH077 (see FIG. 16).

[0261] Verification of susceptibility of C. beijerinckii DSM6423 ΔcatB strain to thiamphenicol To confirm that the deletion of gene catB actually confers new thiamphenicol sensitivity, a comparative analysis was performed using agar medium. C. beijerinckii DSM6423 and C. beijerinckii DSM6423 ΔcatB were precultured in 2YTG medium, and 100 μL of this culture was inoculated onto 2YTG agar medium with or without thiamphenicol at a concentration of 15 mg / L. As can be seen from Figure 17, only the initial strain, C. beijerinckii DSM6423, was able to grow on the medium containing thiamphenicol.

[0262] Deletion of gene upp in C. beijerinckii DSM6423 ΔcatB strain by CRISPR-Cas9 tool A clone of the C. beijerinckii DSM6423 ΔcatB strain was cloned into the vector pCas9, which is unmethylated at the level of the motifs recognized by the dam and dcm methyltransferases. acr (dam - dcm - The plasmid pCas9 maintained in C. beijerinckii strain DSM6423 was previously transformed with E. coli having the genotype acr The presence of was confirmed by PCR on colonies using primers RH025 and RH134.

[0263] Erythromycin-resistant clones were then transformed with pre-demethylated pEC750C-Δupp, and the resulting colonies were selected on a medium containing erythromycin (20 μg / mL), thiamphenicol (15 μg / mL), and lactose (40 mM).

[0264] Next, several of these clones were resuspended in 100 μL of culture medium (2YTG), and then diluted with culture medium (dilution factor 10 4 Five microliters of each dilution was added to a petri dish containing erythromycin, thiamphenicol, and anhydrotetracycline (200 ng / mL) (see FIG. 18).

[0265] For each clone, two colonies resistant to aTc were tested by colony PCR with primers intended to amplify the upp locus (see FIG. 19).

[0266] Deletion of the native plasmid pNF2 in C. beijerinckii DSM6423 ΔcatB strain by CRISPR-Cas9 tools The vector pCas9 is unmethylated at the level of motifs recognized by Dam- and Dcm-type methyltransferases. ind (dam - A clone of C. beijerinckii DSM6423 ΔcatB strain was previously transformed with pCas9 (prepared from E. coli with the dcm genotype). ind The presence of primer pCas9 ind _fwd (SEQ ID NO: 42) and pCas9 ind This was confirmed by PCR using _rev (SEQ ID NO: 43) (see FIG. 20).

[0267] The erythromycin-resistant clones were then used to - dcm - Transformation of pGRNA-pNF2 prepared from E. coli having the genotype was carried out.

[0268] Several colonies obtained on the medium containing erythromycin (20 μg / mL) and thiamphenicol (15 μg / mL) were resuspended in culture medium and diluted 10-fold. 4The mixture was serially diluted 1:1000 to 1:1000. Eight microliters (8 μL) of each dilution was added to a petri dish containing erythromycin, thiamphenicol, and anhydrotetracycline (200 ng / mL) to induce expression of the CRISPR / Cas9 system.

[0269] The absence of the native plasmid pNF2 was confirmed by PCR using primers pNF2_fwd (SEQ ID NO: 39) and pNF2_rev (SEQ ID NO: 40) (see FIG. 21).

[0270] conclusion In the course of this study, we successfully introduced and maintained various plasmids in Clostridium beijerinckii DSM6423 strain, and successfully silenced gene catB using the single plasmid-based CRISPR-Cas9 tool. The thiamphenicol sensitivity of the resulting recombinant strains was confirmed by agar medium assay.

[0271] This deletion allows a more efficient use of the CRISPR-Cas9 tool, which requires two plasmids, as described in patent application FR 1854835. As two examples showing the usefulness of the present invention, the deletion of the gene upp and the removal of a non-essential native plasmid for the Clostridium beijerinckii DSM 6423 strain were performed.

[0272] Result No.2 Transformation of C. beijerinckii strains The plasmid prepared in E. coli NEB 10-β was also used to transform C. beijerinckii NCIMB8052. However, for C. beijerinckii DSM6423, the plasmid was previously introduced and transformed into E. coli dam - dcm - (INV110, Invitrogen) strain, allowing the removal of Dam- and Dcm-type methylation on the plasmid of interest before transformation into the DSM6423 strain.

[0273] Transformations are otherwise performed similarly for each strain, i.e. according to the protocol described by Mermelstein et al. 1992, with the following modifications: strains are transformed with a larger amount of plasmid (5-20 μg), OD600 = 0.6-0.8, and electroporation parameters of 100 Ω, 25 μF, 1400 V. After 3 h of regeneration in 2YTG, they are plated onto Petri dishes (2YTG agar) containing the desired antibiotics (erythromycin: 20-40 μg / mL, thiamphenicol 15 μg / mL, spectinomycin 650 μg / mL).

[0274] Comparison of transformation efficiency of C. beijerinckii DSM6423 strain The C. beijerinckii strains DSM 6423 wild type, DSM 6423 ΔcatB and DSM 6423 ΔcatB ΔpNF2 were transformed in biological duplicates (Figure 30). This included the vector pCas9, which is difficult to use for bacterial engineering due to its particularly poor transformation efficiency. ind This vector additionally contains a gene conferring resistance to the antibiotic erythromycin, to which all three strains are sensitive.

[0275] The results show that the transformation efficiency was improved by approximately 15-20 fold due to the disappearance of the native plasmid pNF2.

[0276] In addition, the transformation efficiency of the plasmid pEC750C that confers resistance to thiamphenicol was verified only with DSM6423 ΔcatB (IFP962 ΔcatB) and DSM6423 ΔcatB ΔpNF2 (IFP963 ΔcatB ΔpNF2) because the wild-type strain is resistant to this antibiotic (Figure 31). With this plasmid, the improvement in transformation efficiency is even more remarkable (about 2000-fold improvement).

[0277] Comparison of transformation efficiency of plasmid pNF3 with that of other plasmids. To investigate the transformation efficiency of plasmids containing the replication origin of the native plasmid pNF2, plasmids pNF3E and pNF3C were introduced into the C. beijerinckii DSM6423 ΔcatB ΔpNF2 strain. The use of vectors containing erythromycin or chloramphenicol resistance genes allows a comparison of the transformation efficiency of the vectors depending on the nature of the resistance gene. In addition, plasmids pFW01 and pEC750C were transformed. These two plasmids contain resistance genes to different antibiotics (erythromycin and thiamphenicol, respectively) and are commonly used for transformation of C. beijerinckii and C. acetobutylicum.

[0278] As shown in Figure 32, vectors based on pNF3 have excellent transformation efficiency, especially usable in C. beijerinckii DSM6423 ΔcatB ΔpNF2. In particular, pNF3E (containing an erythromycin resistance gene) shows a much higher transformation efficiency than pFW01 containing the same resistance gene. This same plasmid could not be introduced into the wild-type strain C. beijerinckii DSM6423 (0 colonies obtained after transformation of 5 μg of plasmid into biological duplicates), demonstrating the effect of the presence of the native plasmid pNF2.

[0279] Verification of the transformability of plasmid pNF3 in other strains / species To demonstrate the possibility of using this novel plasmid in other solvent-prone Clostridium strains, we performed a comparative analysis of the transformation efficiencies of plasmids pFW01, pNF3E, and pNF3S in the ABE strain C. beijerinckii NCIMB8052 (FIG. 33). Since the NCIMB 8052 strain is inherently resistant to thiamphenicol, pNF3S, which confers resistance to spectinomycin, was used instead of pNF3C.

[0280] This result demonstrated that the NCIMB 8052 strain could be transformed with pNF3-based plasmids, demonstrating the applicability of these vectors to the broad species of C. beijerinckii.

[0281] The applicability of the series of synthetic vectors based on pNF3 was also tested in the C. acetobutylicum reference strain DSM 792. Transformation tests showed that this strain could be transformed with plasmid pNF3C (transformation efficiency was observed at 3 colonies per μg of transformed DNA compared to 120 colonies / μg for plasmid pEC750C).

[0282] Verification of compatibility of plasmid pNF3 with the genetic tools described in application no. FR18 / 73492 Patent application FR18 / 73492 describes the use of the CRISPR / Cas9 system with the ΔcatB strain and two plasmids that require the use of erythromycin resistance and thiamphenicol resistance genes. To demonstrate the advantages of the new plasmid family pNF3, the vector pNF3C was transformed with the plasmid pCas9 acr The transformation was performed in duplicate and showed a transformation efficiency of 0.625 ± 0.125 colonies / μg DNA (mean ± SEM), demonstrating the use of pNF3C-based vectors in pCas9. acr It has been demonstrated that it can be used in combination with the ΔcatB strain.

[0283] In parallel with these results, it was shown that a part of the plasmid pNF2 (SEQ ID NO: 118), including its origin of replication, can be arbitrarily modified and successfully reused to create a series of new shuttle vectors (SEQ ID NO: 119, 123, 124 and 125), which allow in particular replication in E. coli strains and reintroduction in C. beijerinckii DSM 6423. These new vectors have a transformation efficiency that is advantageous for carrying out gene editing, for example, in C. beijerinckii DSM 6423 and its derivatives, in particular with the CRISPR / Cas9 tool containing two different nucleic acids.

[0284] These new vectors were successfully tested in another strain of C. beijerinckii (NCIMB 8052) and Clostridium species (especially C. acetobutylicum), demonstrating their applicability in other organisms of the phylum Firmicutes, and also in the genus Bacillus.

[0285] conclusion These results demonstrate that suppression of the native plasmid pNF2 significantly increases the transformation frequency of bacteria harboring it (~15-fold for pFW01 and ~2000-fold for pEC750C). This result was interesting for Clostridium species, which are known to be difficult to transform, and in particular for the C. beijerinckii DSM6423 strain, which has a naturally low transformation efficiency (<5 colonies / μg plasmid).

[0286] References - Banerjee, A., Leang, C., Ueki, T., Nevin, KP, & Lovley, DR (2014). Lactose-inducible system for metabolic engineering of Clostridium ljungdahlii. Applied and environmental microbiology, 80(8), 2410-2416. - Chen J.-S., Hiu S.F. (1986) Acetone-butanol-isopropanol production by Clostridium beijerinckii (synonym,Clostridium butylicum). Biotechnol. Lett. 8:371-376. - Cui, L., & Bikard, D. (2016). Consequences of Cas9 cleavage in the chromosome of Escherichia coli. Nucleic acids research, 44(9), 4243-4251. - Currie, D. H., Herring, C. D., Guss, A. M., Olson, D. G., Hogsett, D. A., & Lynd, L. R. (2013). Functional heterologous expression of an engineered full length CipA from Clostridium thermocellum in Thermoanaerobacterium saccharolyticum. Biotechnology for biofuels, 6(1), 32. - DiCarlo, J. E., Norville, J. E., Mali, P., Rios, X., Aach, J., & Church, G. M. (2013). Genome engineering in Saccharomyces cerevisiae using CRISPR-Cas systems. Nucleic acids research, 41(7), 4336-4343. - Dong, H., Tao, W., Zhang, Y., & Li, Y. (2012). Development of an anhydrotetracycline-inducible gene expression system for solvent-producing Clostridium acetobutylicum: A useful tool for strain engineering. Metabolic engineering, 14(1), 59-67. - Dong, D., Guo, M., Wang, S., Zhu, Y., Wang, S., Xiong, Z., ... & Huang, Z. (2017). Structural basis of CRISPR-SpyCas9 inhibition by an anti-CRISPR protein. Nature, 546(7658), 436. - Dupuy, B., Mani, N., Katayama, S., & Sonenshein, A. L. (2005). Transcription activation of a UV‐inducible Clostridium perfringens bacteriocin gene by a novel σ factor. Molecular microbiology, 55(4), 1196-1206. - Egholm, M., Buchardt, O., Nielsen, P. E., & Berg, R. H. (1992). Peptide nucleic acids (PNA). Oligonucleotide analogs with an achiral peptide backbone. Journal of the American Chemical Society, 114(5), 1895-1897. - Fonfara, I., Le Rhun, A., Chylinski, K., Makarova, K. S., Lecrivain, A. L., Bzdrenga, J., ... & Charpentier, E. (2013). Phylogeny of Cas9 determines functional exchangeability of dual-RNA and Cas9 among orthologous type II CRISPR-Cas systems. Nucleic acids research, 42(4), 2577-2590. - Garcia-Doval C, Jinek M. Molecular architectures and mechanisms of Class 2 CRISPR-associated nucleases. Curr Opin Struct Biol. 2017 Dec;47:157-166. doi: 10.1016 / j.sbi.2017.10.015 Ajouter au projet Citavi par DOI. Epub 2017 Nov 3. Review. - George H.A., Johnson J.L., Moore W. E. C., Holdeman, L. V., Chen J. S. (1983) Acetone, Isopropanol, and Butanol Production by Clostridium beijerinckii (syn. Clostridium butylicum) and Clostridium aurantibutyricum. Appl. Env. Microbiol. 45:1160-1163. - Gonzales y Tucker RD, Frazee B. View from the front lines: an emergency medicine perspective on clostridial infections in injection drug users. Anaerobe. 2014 Dec; 30:108-15. - Hartman, A. H., Liu, H., & Melville, S. B. (2011). Construction and characterization of a lactose-inducible promoter system for controlled gene expression in Clostridium perfringens. Applied and environmental microbiology, 77(2), 471-478. - Heap, J. T., Ehsaan, M., Cooksley, C. M., Ng, Y. K., Cartman, S. T., Winzer, K., & Minton, N. P. (2012). Integration of DNA into bacterial chromosomes from plasmids without a counter-selection marker. Nucleic acids research, 40(8), e59-e59. - Heap, J. T., Kuehne, S. A., Ehsaan, M., Cartman, S. T., Cooksley, C. M., Scott, J. C., & Minton, N. P. (2010). The ClosTron: mutagenesis in Clostridium refined and streamlined. Journal of microbiological methods, 80(1), 49-55. - Heap, J. T., Pennington, O. J., Cartman, S. T., Carter, G. P., & Minton, N. P. (2007). The ClosTron: a universal gene knock-out system for the genus Clostridium. Journal of microbiological methods, 70(3), 452-464. - Heap, J. T., Pennington, O. J., Cartman, S. T., & Minton, N. P. (2009). A modular system for Clostridium shuttle plasmids. Journal of microbiological methods, 78(1), 79-85. - Hidalgo-Cantabrana, C., O’Flaherty, S., & Barrangou, R. (2017). CRISPR-based engineering of next-generation lactic acid bacteria. Current opinion in microbiology, 37, 79-87. - Hiu S.F., Zhu C.-X., Yan R.-T., Chen J.-S. (1987) Butanol-ethanol dehydrogenase and butanol-ethanol-isopropanol dehydrogenase: different alcohol dehydrogenases in two strains of Clostridium beijerinckii (Clostridium butylicum). Appl. Env. Microbiol. 53:697-703. - Huang, H., Chai, C., Li, N., Rowe, P., Minton, N. P., Yang, S., & Gu, Y. (2016). CRISPR / Cas9-based efficient genome editing in Clostridium ljungdahlii, an autotrophic gas-fermenting bacterium. ACS synthetic biology, 5(12), 1355-1361. - Huggins, A.S., Bannam, T.L. and Rood, J.I. (1992) Comparative sequence analysis of the catB gene from Clostridium butyricum. Antimicrob. Agents Chemother. 36, 2548-2551. - Ismaiel A.A., Zhu C.X., Colby G.D., Chen, J. S. (1993). Purification and characterization of a primary-secondary alcohol dehydrogenase from two strains of Clostridium beijerinckii. J. Bacteriol. 175:5097-5105. - Jinek, M., Chylinski, K., Fonfara, I., Hauer, M., Doudna, J. A., & Charpentier, E. (2012). A programmable dual-RNA-guided DNA endonuclease in adaptive bacterial immunity. Science, 337(6096), 816-821. - Jones D.T., Woods D.R. (1986) Acetone-butanol fermentation revisited. Microbiological Reviews 50:484-524. - Kolek J., Sedlar K., Provaznik I., Patakova P. (2016). Dam and Dcm methylations prevent gene transfer into Clostridium pasteurianum NRRL B-598: development of methods for electrotransformation, conjugation, and sonoporation. Biotechnol Biofuels. 9:14. - Li, Q., Chen, J., Minton, N. P., Zhang, Y., Wen, Z., Liu, J., ... & Gu, Y. (2016). CRISPR‐based genome editing and expression control systems in Clostridium acetobutylicum and Clostridium beijerinckii. Biotechnology journal, 11(7), 961-972. - Makarova, K. S., Haft, D. H., Barrangou, R., Brouns, S. J., Charpentier, E., Horvath, P., ... & Van Der Oost, J. (2011). Evolution and classification of the CRISPR-Cas systems. Nature Reviews Microbiology, 9(6), 467. - Makarova, K. S., Wolf, Y. I., Alkhnbashi, O. S., Costa, F., Shah, S. A., Saunders, S. J., ... & Horvath, P. (2015). An updated evolutionary classification of CRISPR-Cas systems. Nature Reviews Microbiology, 13(11), 722. - Marino, N. D., Zhang, J. Y., Borges, A. L., Sousa, A. A., Leon, L. M., Rauch, B. J., ... & Bondy-Denomy, J. (2018). Discovery of widespread type I and type V CRISPR-Cas inhibitors. Science, 362(6411), 240-242. - Mate de Gerando, H., Wasels, F., Bisson, A., Clement, B., Bidard, F., Jourdier E., Lopez-Contreras A., Lopes Ferreira N. (2018). Genome and transcriptome of the natural isopropanol producer Clostridium beijerinckii DSM 6423. BMC genomics. 19:242. - Mearls, E. B., Olson, D. G., Herring, C. D., & Lynd, L. R. (2015). Development of a regulatable plasmid-based gene expression system for Clostridium thermocellum. Applied microbiology and biotechnology, 99(18), 7589-7599. - Mermelstein, L. D., & Papoutsakis, E. T. (1993). In vivo methylation in Escherichia coli by the Bacillus subtilis phage phi 3T I methyltransferase to protect plasmids from restriction upon transformation of Clostridium acetobutylicum ATCC 824. Applied and environmental microbiology, 59(4), 1077-1081. - Mermelstein L.D., Welker N.E., Bennett G.N., Papoutsakis E.T. (1992). Expression of cloned homologous fermentative genes in Clostridium acetobutylicum ATCC 824 10:190-195. - Mermelstein L.D., Welker N.E., Bennett G.N., Papoutsakis E.T. (1993). Expression of cloned homologous fermentative genes in Clostridium acetobutylicum ATCC 824 10:190-195. - Moon HG, Jang YS, Cho C, Lee J, Binkley R, Lee SY. One hundred years of clostridial butanol fermentation. FEMS Microbiol Lett. 2016 Feb;363(3). - Nagaraju, S., Davies, N. K., Walker, D. J. F., Koepke, M., & Simpson, S. D. (2016). Genome editing of Clostridium autoethanogenum using CRISPR / Cas9. Biotechnology for biofuels, 9(1), 219. - Nariya, H., Miyata, S., Kuwahara, T., & Okabe, A. (2011). Development and characterization of a xylose-inducible gene expression system for Clostridium perfringens. Applied and environmental microbiology, 77(23), 8439-8441. - Newcomb, M., Millen, J., Chen, C. Y., & Wu, J. D. (2011). Co-transcription of the celC gene cluster in Clostridium thermocellum. Applied microbiology and biotechnology, 90(2), 625-634. - Pawluk, A., Davidson, A. R., & Maxwell, K. L. (2018). Anti-CRISPR: Discovery, mechanism and function. Nature Reviews Microbiology, 16(1), 12 - Poehlein A., Solano J.D.M., Flitsch S.K., Krabben P., Winzer K., Reid S.J., Jones D.T., Green E., Minton N.P., Daniel R., Duerre P. (2017). Microbial solvent formation revisited by comparative genome analysis. Biotechnol Biofuels. 10:58. - Pyne, M. E., Bruder, M. R., Moo-Young, M., Chung, D. A., & Chou, C. P. (2016). Harnessing heterologous and endogenous CRISPR-Cas machineries for efficient markerless genome editing in Clostridium. Scientific reports, 6. - Rauch, B. J., Silvis, M. R., Hultquist, J. F., Waters, C. S., McGregor, M. J., Krogan, N. J., & Bondy-Denomy, J. (2017). Inhibition of CRISPR-Cas9 with bacteriophage proteins. Cell, 168(1-2), 150-158. - Rajewska M., Wegrzyn K, Konieczny I., FEMS Microbiol Rev. 2012 Mar; 36(2). AT-rich region and repeated sequences - the essential elements of replication origins of bacterial replicons :408-34. - Ransom, E. M., Ellermeier, C. D., & Weiss, D. S. (2015). Use of mCherry red fluorescent protein for studies of protein localization and gene expression in Clostridium difficile. Applied and environmental microbiology, 81(5), 1652-1660. - Rogers P., Chen J.-S., Zidwick M. (2006) in The prokaryotes. 3rd edition, Vol. 1, edited by Dworkin M (Springer, New York, USA,2006). 3rd edition, Vol. 1, pp. 672-755. - Schwarz S, Kehrenberg C, Doublet B, Cloeckaert A. Molecular basis of bacterial resistance to chloramphenicol and florfenicol. FEMS Microbiol Rev. 2004 Nov;28(5):519-42. - Stella S, Alcon P, Montoya G. Class 2 CRISPR-Cas RNA-guided endonucleases: Swiss Army knives of genome editing. Nat Struct Mol Biol. 2017 Nov;24(11):882-892. doi: 10.1038 / nsmb.3486. - Wang, S., Dong, S., Wang, P., Tao, Y., & Wang, Y. (2017). Genome Editing in Clostridium saccharoperbutylacetonicum N1-4 with the CRISPR-Cas9 System. Applied and Environmental Microbiology, 83(10), e00233-17. - Wang Y, Li X, Milne CB, et al. Development of a gene knockout system using mobile group II introns (Targetron) and genetic disruption of acid production pathways in Clostridium beijerinckii. Appl Environ Microbiol. 2013; 79(19): 5853-63. - Wang, Y. et al. Markerless chromosomal gene deletion in Clostridium beijerinckii using CRISPR / Cas9 system. J. Biotechnol.2015. 200: 1-5. - Wang, Y., Zhang, Z. T., Seo, S. O., Lynn, P., Lu, T., Jin, Y. S., & Blaschek, H. P. (2016). Bacterial genome editing with CRISPR-Cas9: deletion, Integration, single nucleotide modification, and desirable “clean” mutant selection in Clostridium beijerinckii as an example. ACS synthetic biology, 5(7), 721-732. - Wasels, F., Jean-Marie, J., Collas, F., Lopez-Contreras, A. M., & Ferreira, N. L. (2017). A two-plasmid inducible CRISPR / Cas9 genome editing tool for Clostridium acetobutylicum. Journal of microbiological methods. 140:5-11. - Xu, T., Li, Y., Shi, Z., Hemme, C. L., Li, Y., Zhu, Y., ... & Zhou, J. (2015). Efficient genome editing in Clostridium cellulolyticum via CRISPR-Cas9 nickase. Applied and environmental microbiology, 81(13), 4423-4431. - Yadav, R., Kumar, V., Baweja, M., & Shukla, P. (2018). Gene editing and genetic engineering approaches for advanced probiotics: A Review. Critical reviews in food science and nutrition, 58(10), 1735-1746. - Yue Chen, Bruce A. McClane, Derek J. Fisher, Julian I. Rood, Phalguni Gupta; Construction of an Alpha Toxin Gene Knockout Mutant of Clostridium perfringens Type A by Use of a Mobile Group II Intron; Appl. Environ. Microbiol. Nov 2005, 71 (11) 7542-7547; DOI: 10.1128 / AEM.71.11.7542-7547.2005. - Zhang, J., Liu, Y. J., Cui, G. Z., & Cui, Q. (2015). A novel arabinose-inducible genetic operation system developed for Clostridium cellulolyticum. Biotechnology for biofuels, 8(1), 36. - Zhang C., Tinggang L. Jianzhong H. (2018) Characterization and genome analysis of a butanol-isopropanol producing Clostridium beijerinckii strain BGS1. Biotechnol Biofuels (2018) 11:280. - Zhong, J., Karberg, M., & Lambowitz, A. M. (2003). Targeted and random bacterial gene disruption using a group II intron (targetron) vector containing a retrotransposition‐activated selectable marker. Nucleic acids research, 31(6), 1656-1664.

Claims

[Claim 1] The bacterium Clostridium beijerinckii deposited in the BCCM-LMG collection under the accession number LMG P-31277 on February 20, 2019, or a genetic recombinant thereof lacking the gene catB of SEQ ID NO: 18 and the plasmid pNF2.

Images