30 results about "Campylobacter jejuni" patented technology

The invention belongs to the technical field of microbial genetic engineering, and particularly relates to an alpha-2, 3-sialyltransferase mutant and application thereof. The a-2, 3-sialyltransferase mutants V175N, P198A, G173D, D174Q, F196K and A315H are obtained by performing site-specific mutagenesis on six amino acids in an a-2, 3-sialyltransferase amino acid sequence coded by a gene derived from Campylobacter jejuni (OH4384), the yield of 3 '-sialyllactose is remarkably increased by single-point mutagenesis of the V175N, the yield of 3'-sialyllactose is remarkably increased by single-point mutagenesis of the V175N, the yield of 3 '-sialyllactose is remarkably increased by single-point mutagenesis of the P198A, the G173D, the D174Q, the F196K and the A315H, the optimal recombinant microbial strain 3 '-SL-09 (V175N / P198A / D174Q) is obtained through combination of multiple mutation sites, the yield can reach 5.91 g / L, the bottleneck problem of low catalytic efficiency of sialyltransferase is effectively solved, and an enzyme element with excellent performance is provided for high-efficiency and low-cost biological manufacturing of 3'-SL.

The invention relates to the technical field of microorganisms, in particular to a lactobacillus plantarum strain LM2 and application of the lactobacillus plantarum strain LM2. The strain has relatively high GABA (gamma-aminobutyric acid) production capacity and nitrite degradation capacity, has a bacteriostatic effect on intestinal pathogens such as staphylococcus aureus, salmonella enteritidis, listeria monocytogenes and campylobacter jejuni, has a good bacteriostatic function, also has good acid resistance and cholate resistance, and can be used for preparing a bacterial strain for treating intestinal diseases. The strain can well survive in artificial intestinal juice and artificial gastric juice; in order to increase the yield of GABA, the accelerant capable of remarkably promoting the growth of the strain LM2 is obtained by researching the accelerant, and the highest survival rate of the freeze-dried powder prepared by optimizing the accelerant and the freeze-dried powder can reach 99% or above, the nitrite degradation rate can reach 99% or above, the yield of GABA is increased to 3.0 g / L or above, and the freeze-dried powder is bacterial powder capable of being widely applied.

The invention discloses bifidobacterium breve with hypoglycemic capacity and application, a product and a method thereof, and belongs to the technical field of microorganisms. The invention provides a bifidobacterium breve (Bifidobacterium breve) strain BBr37 with the blood sugar reducing capacity, and the preservation number of the bifidobacterium breve strain BBr37 is CGMCC (China General Microbiological Culture Collection Center) NO.32423. The invention also provides an application of the strain BBr37 in preparation of hypoglycemic drugs or health-care foods with an auxiliary hypoglycemic function or bacteriostatic agents or non-treatment-destination bacteriostasis, and a product and a method based on the strain BBr37. The strain BBr37 disclosed by the invention has a relatively strong inhibition effect on escherichia coli, staphylococcus aureus, salmonella, haemophilus parasuis, haemophilus parainfluenza, campylobacter jejuni and enterocolitis yarrowia, and can effectively achieve the effects of reducing blood sugar and regulating intestinal flora.

This invention discloses a fermented microbial preparation for inhibiting Campylobacter jejuni in calves, its preparation method, and its application. The fermented microbial preparation is a co-fermentation product of a mixture of Lygodium japonicum decoction and liquid culture medium, inoculated with Lactobacillus paracasei; the Lactobacillus paracasei is... Lacticaseibacillus paracasei KQNIU. Comparative experiments in this invention revealed that, compared to other types of traditional Chinese medicine, the inhibitory effect of fermented Lygodium japonicum on Campylobacter jejuni is significantly higher than that of other types of traditional Chinese medicine. Furthermore, the co-fermentation of the traditional Chinese medicine Lygodium japonicum and the probiotic Lactobacillus paracasei KQNIU achieves a synergistic effect between the two, overcoming the problem of limited efficacy when used alone.

The invention discloses a campylobacter jejuni rapid detection method and a kit based on a specific molecular target rpoZ. The sequence of the molecular target is as shown in SEQ ID NO. 1. The PCR / qPCR detection kit for detecting campylobacter jejuni is established on the basis of the target rpoZ, has extremely high specificity, only has specific amplification signals for nucleic acid of campylobacter jejuni, and has no cross reaction for other common food-borne pathogenic bacteria such as escherichia coli, salmonella and staphylococcus aureus. Meanwhile, the sensitivity is high, and the nucleic acid detection target can detect the campylobacter jejuni genome DNA as low as 132fg / mu L. The method can effectively detect campylobacter jejuni in samples such as food, is high in specificity, good in accuracy and simple to operate, and can be applied to the fields of food safety and the like.

An antimicrobial peptide having an amino acid sequence selected from SEQ ID NOs: 2-12 is provided. The antimicrobial peptide has antimicrobial activity against Gram-negative bacteria, Campylobacter jejuni, Escherichia coli, Salmonella enterica subsp. enterica serovar typhimurium, Salmonella enterica subsp. enterica serovar choleraesuis, Klebsiella pneumonica, and / or Enterobacter cloacae. A composition, pharmaceutical composition, food additive, cosmetic composition, or hygine product having an antimicrobial peptide including an amino acid sequence selected from SEQ ID NOs: 2-12 is also provided. A method of treating an infectious disease caused by bacteria including a step of administering a pharmaceutical composition having the antimicrobial peptide as an active ingredient is also provided.

The invention discloses a dual digital PCR (polymerase chain reaction) detection method for monkey campylobacter jejuni and monkey enterocolitis yersinia, and relates to the technical field of microbiological detection, the detection method comprises the following specific steps: multi-source heterogeneous data collection: collecting monkey feces and intestinal tissue samples, extracting genome DNA (deoxyribonucleic acid) by using a phenol-chloroform method, detecting the concentration and purity of DNA, and detecting the concentration and purity of the DNA; after reaching the standard, storing at-20 DEG C for later use; according to the method, high-sensitivity and specific detection on the two pathogenic bacteria is realized through a combination of well-designed primers and probes, according to the method, a gyrA gene conserved region of monkey campylobacter jejuni CJ and a POL gene conserved region of monkey yersinia enterocolitica YE are used as detection targets, and specific fragments of 249bp and 182bp are amplified respectively; the method effectively avoids interference of non-specific amplification, can simultaneously detect two pathogenic bacteria in a single reaction system through a dual digital PCR technology, accurately calculates target gene copy number concentration through a Poisson distribution formula, and improves detection accuracy and reliability.

The present application relates to the field of microbial technology, in particular to bacillus subtilis BS-1 and its application in water buffalo silage feed, the strain BS-1 of the present application has good bacteriostatic activity on escherichia coli, salmonella and streptococcus uberis, after mixing and fermenting according to a specific proportion with orange peel and cassava residue, the bacteriostatic spectrum of the obtained silage feed is significantly enhanced, which can simultaneously inhibit escherichia coli, campylobacter jejuni, salmonella, streptococcus uberis, staphylococcus aureus and streptococcus agalactiae that cause diarrhea and mastitis. In the feed, after mixing 60%-75% of orange peel and 25%-40% of cassava residue, the crude protein content of the fermentation product is significantly improved, and the fiber content is reduced. Feeding test shows that the feed can significantly improve the milk yield and milk quality of lactating water buffalo, and effectively alleviate diarrhea. The present application provides a safe, efficient and nutritious silage feed with disease prevention function.

The present application relates to the field of agricultural husbandry and veterinary technology, in particular to a protease-resistant antibacterial peptide FR and application thereof. The present application provides a protease-resistant antibacterial peptide FR, and the amino acid sequence of the antibacterial peptide FR is shown as SEQ ID NO. 1. The results of the specific implementation of the present application show that the protease-resistant antibacterial peptide FR provided by the present application has the activity of resisting gram-negative bacteria (Escherichia coli, Shigella flexneri, Salmonella and Campylobacter jejuni, etc.), has low hemolytic activity, can resist the cleavage of high-concentration protease, and has very good application prospect. In summary, the antibacterial peptide FR provided by the present application has the advantages of resisting gastrointestinal environment, resisting high salt and resisting protease cleavage, can realize the killing effect on gram-negative bacteria in the presence of enzymes and salt ions, and has the characteristics of low hemolytic activity, thereby providing a new way for the development of antibiotic substitutes.

The present invention discloses an antibacterial derivative peptide LL-37 I20M / V21R And its composition and application, belonging to the application field of peptide antibiotics, antibacterial derivative peptide LL-37 I20M / V21R , and its amino acid sequence is: LLGDFFRKSKEKIGKEFKRMRQRIKDFLRNLVPRTES. The antimicrobial peptide sustained-release microcapsules prepared by the present invention have higher stability and stronger bactericidal effect. The preparation method of the antimicrobial peptide sustained-release microcapsules is simple to operate, the encapsulation rate is as high as 87.31%, and the stability is strong. The prepared antimicrobial peptide LL-37 I20M / V21R The sustained-release microcapsule product can slowly release antimicrobial peptides to exert an antibacterial effect, and has a significant effect on the elimination of Campylobacter jejuni in the body, with a maximum reduction of 4.69lg (CFU / g). It is expected to become a new product and means of prevention and control of Campylobacter jejuni.

The invention belongs to the technical field of food safety and poultry processing, and particularly relates to an antibacterial composition for inhibiting VBNC state bacteria and application and a product thereof. The invention provides the antibacterial composition, the antibacterial composition is composed of carvacrol, diallyl sulfide and aluminum oxide nanoparticles, through the synergistic effect, the inhibition effect on VBNC campylobacter jejuni is remarkably improved, the antibacterial activity is enhanced, and the drug resistance risk is effectively reduced. The optimal ratio of the antibacterial agent is calculated through a dosage optimization method based on a mathematical model, the antibacterial effect is maximized, and the stability of the antibacterial agent in different processing environments is ensured. The problem that VBNC bacteria cannot be inhibited in the prior art is solved, and food safety is guaranteed. In addition, the combination of natural plant components and non-toxic nanoparticles is safe and environment-friendly, is suitable for multiple fields such as poultry processing, and has a wide application prospect.

The invention discloses a primer group for simultaneously detecting seven pet enteropathogenic bacteria and application thereof, the primer group comprises primer sequences as shown in SEQ ID NO: 1-14, and the seven pet enteropathogenic bacteria are hemorrhagic escherichia coli, salmonella enteritidis, campylobacter jejuni, clostridium difficile, clostridium perfringens, yersinia enteritidis and staphylococcus aureus. Extracting DNA (Deoxyribonucleic Acid) of a sample to be detected by using the excrement sample nucleic acid extraction kit; taking the sample DNA as a template, carrying out multiple PCR reaction by using the primer group to obtain an amplification curve, and if the Ct value of the amplification curve of the sample to be detected is 0 amp, detecting the Ct value of the sample to be detected; lt; c < tamp >; lt; 30, and the Ct value of the IPC is amp; lt; and 40, determining that the interpretation result is positive, and indicating that the sample to be detected contains the one or more enteropathogenic bacteria. According to the invention, a primer sequence with high sensitivity and specificity is adopted, so that the quality of a detection result is ensured; the detection method is simple to operate, time-saving and labor-saving; the detection flux is high, and the reagent consumable cost is low.

The present invention discloses species-specific molecular targets yclQ, crRNA, CRISPR / Cas12a systems, detection methods, and kits for detecting Campylobacter jejuni. The nucleotide sequence of the target yclQ is shown in SEQ ID NO.1. Based on the target yclQ, the present invention has developed three detection kits for Campylobacter jejuni, namely, a kit based on the RAA / PCR-CRISPR / Cas12a system, a chimeric fluorescence qPCR detection kit, and a probe-based qPCR detection kit. The above three kits can all achieve high detection sensitivity for detecting Campylobacter jejuni, among which the detection sensitivity of the first kit is 5.3×10 0 The detection method of the present invention has the characteristics of strong specificity, high sensitivity, fast detection speed, etc., and can be applied to the field of food safety.

To provide compositions and methods for detecting gastrointestinal pathogens.SOLUTION: Compositions, methods, kits, and uses are provided for detecting the presence of Salmonella, Shigella, Campylobacter, and Shigatoxigenic Eschelichia coli (STEC) in samples. In some embodiments, the compositions, methods, kits, and uses comprise one or more oligonucleotides or the use of one or more oligonucleotides. In some embodiments, the method is carried out as a multiplex assay with separate primers / probes for C.jejuni and C.coli. Some of the oligonucleotides contain inosine and / or contain 5-methylcytosine substituted nucleotides. Described is the use of cyclodextrin and / or Polysorbate 20 in the amplification reactions.SELECTED DRAWING: None

The invention relates to a food product for animals which can be used as a prophylactic measure to reduce the number of Campylobacter jejuni in hosts like poultry or swine.More specifically the invention is a food supplement comprising neohesperidin dihydrochalcone (NHDC) and peppermint oil (PMO).The invention also pertains to a feed comprising such a food supplement as well as to its use to reduce campylobacter carriage by poultry or swine and to a method of reducing the risk of Campylobacter spp. infection in humans.

The invention discloses a method and a kit for rapidly detecting campylobacter jejuni based on a specific molecular target glnp. The sequence of the molecular target is as shown in SEQ ID NO. 1. The PCR / qPCR detection kit for detecting campylobacter jejuni is established based on the target glnp, has extremely high specificity, only has a specific amplification signal for nucleic acid of campylobacter jejuni, and does not have any cross reaction for other common food-borne pathogenic bacteria such as escherichia coli, salmonella and staphylococcus aureus. Meanwhile, the sensitivity is high, and the nucleic acid detection target can detect the campylobacter jejuni genome DNA as low as 132fg / mu L. The method has the advantages of short detection time, high specificity, high detection sensitivity, simplicity in operation and the like.

The invention relates to an integrated campylobacter jejuni detection device and a method thereof.The integrated campylobacter jejuni detection device comprises a base, a first moving assembly is arranged on the base, a clamping assembly used for containing a transfer pipette is arranged on the first moving assembly, and a pressing assembly is arranged on the clamping assembly; the base is further provided with a second moving assembly and a plurality of placing seats used for placing vessels, the second moving assembly is provided with a camera shooting assembly used for observing changes of campylobacter jejuni in the vessels, and the campylobacter jejuni can be automatically moved into the observation vessels from the culture tank; meanwhile, a culture solution containing bacteria and remaining at the outlet end of the pipette can be prevented from dripping on the outer side in the transfer-in process.

The invention discloses a campylobacter jejuni liquid-phase probe targeted capturing and library building method and a kit thereof, and belongs to the technical field of germ detection. Specific probe enrichment, magnetic bead purification and high-throughput sequencing are combined, and the problems that in the prior art, low-load detection is difficult, information is incomplete, and operation is tedious are solved. Aiming at the characteristics of wide food-borne transmission, multiple low-load samples and strong complex matrix interference of campylobacter jejuni, low-load accurate detection, whole-genome information analysis and high-throughput standardized operation are realized through a liquid-phase probe targeted capture technology; the method is suitable for large-scale sample detection in the fields of food safety detection, clinical diagnosis, public health research and the like.

This invention discloses a monoclonal antibody for detecting the surface protein SapA of Campylobacter fetus and its application. The monoclonal antibodies are named 4F6 and 7B3, and the amino acid sequences of the heavy and light chain variable regions of these two antibodies are disclosed. The monoclonal antibody prepared by this invention can specifically recognize the surface protein SapA of Campylobacter fetus. The prepared monoclonal antibody has good specificity, showing no cross-reactivity with non-Camplybacteria such as standard Escherichia coli, Salmonella, Listeria, Klebsiella pneumoniae, Staphylococcus aureus, and Streptococcus, and also with Campylobacter jejuni and Campylobacter coli. The test strip prepared by combining the monoclonal antibody of this invention with colloidal gold can achieve rapid on-site detection of Campylobacter fetus with a low detection limit and high sensitivity, successfully developing an immunological method for the specific detection of Campylobacter fetus.

The present invention belongs to the field of application of peptide antibiotics. Provided are antibacterial derived peptide LL-37 I20M / V21R, a composition thereof and the use thereof. The prepared antibacterial derived peptide has higher stability and stronger bactericidal effects. The sustained-release microcapsule of the antibacterial derived peptide has the characteristics that the preparation method is simple in operation, the encapsulation rate is up to 87.31%, and the stability is high. The prepared sustained-release microcapsule product of antibacterial peptide LL-37 I20M / V21R can slowly release the antibacterial peptide to exert an antibacterial effect, and has a significant in-vivo reduction effect on Campylobacter jejuni, with a maximum reduction of 4.69 lg (CFU / g).

The present invention relates to an animal food product which can be used as a prophylactic measure to reduce the number of Campylobacter jejuni in a host, such as poultry or swine. More specifically, the present invention is a food supplement comprising neohesperidin dihydrochalcone (NHDC) and peppermint oil (PMO). The invention also covers a feed containing the food supplement and application of the feed to reduction of campylobacter carried by poultry or pigs, and provides a method for reducing the risk of human being infected with enterobacter flexus.

The invention discloses a method for detecting campylobacter jejuni cell swelling toxin CdtB in food, and provides application of a campylobacter jejuni cell swelling lethal toxin CdtB monoclonal antibody to detection of campylobacter jejuni in food for the first time. The invention aims to establish the detection kit and the detection method based on the campylobacter jejuni cell swelling toxin CdtB monoclonal antibody, and the detection kit and the detection method have relatively strong specificity and sensitivity. The CdtB monoclonal antibody prepared by the invention can be combined with CdtB protein secreted by campylobacter jejuni in food, so that the detection of the campylobacter jejuni is realized. The detection speed is high, semi-quantitative detection can be achieved, the detection sensitivity is high, and the lowest CdtB mass of 0.01 microgram can be detected.

The present disclosure relates to compounds and pharmaceutical compositions comprising same for the treatment, amelioration, and / or prevention of disease. In some embodiments, the disease is a bacterial infection. In some embodiments, the infection is caused by Acinetobacter spp., Clostridium spp., Enterococcus spp., Hemophilus spp., Legionella spp., Mycobacterium spp. (tuberculous and nontuberculous mycobacteria), Neisseria spp., Staphylococcus spp., Streptococcus spp., Listeria monocytogenes, Moraxella catarrhalis, Bacillus spp., Bacteroides spp., or any of the following: spp., Gardnerella vaginalis, Lactobacillus spp., Mobiluncus spp., Helicobacter pylori, Campylobacter jejuni, Chlamydia trachomatis, and / or Toxoplasma gondii. Preferably, the bacterial infection is caused by a bacterium belonging to the genus Staphylococcus aureus (S. aureus), A. baumannii (A. baumannii), E. faecium (E. faecalis), Staphylococcus epidermidis (S. epidermidis), Streptococcus pneumoniae (S. pneumoniae), Group A hemolytic streptococcus (S. pyogenes), Haemophilus influenzae (H. influenzae), M. abscessus (M. abscessus), M. tuberculosis (M. tuberculosis) and / or M. smegmatis (M.smegmatis), even more preferably the bacterial infection is caused by one or more bacteria belonging to the genus Acinetobacter, even more preferably by A. baumannii, even more preferably by A. baumannii having one or more resistance mechanisms to rifamycins, such as rifabutin and / or rifampicin.

The invention discloses a universal primer group for rapidly detecting campylobacter jejuni nucleic acid, a kit and application, belongs to the technical field of genetic engineering, and aims to solve the problem that when a sample is traditional campylobacter jejuni, qPCR (quantitative polymerase chain reaction) heating and cooling time needs at least 60 minutes. The designed primer comprises a primer group which is composed of nucleotide sequences as shown in SEQ ID NO.1 and SEQ ID NO.2 and aims at campylobacter jejuni conserved region genes. Based on an RPA / RAA constant-temperature amplification method, detection of campylobacter jejuni is completed within 30 minutes in the same tube system, and a direct electrophoresis method is selected for judgment according to the position of a target strip.

The present invention belongs to the field of food safety and poultry processing technology, and specifically relates to an antibacterial composition for inhibiting bacteria in the VBNC state, and its application and product. The present invention provides an antibacterial composition, which is composed of carvacrol, diallyl sulfide and aluminum oxide nanoparticles. The antibacterial composition significantly improves the inhibitory effect on VBNC Campylobacter jejuni through synergistic action, not only enhancing the antibacterial activity but also effectively reducing the risk of drug resistance. The present invention calculates the optimal ratio of antibacterial agents through a dosage optimization method based on a mathematical model, maximizes the antibacterial effect and ensures its stability in different processing environments. The present invention solves the problem of the inability to inhibit VBNC bacteria in the prior art and ensures food safety. In addition, the combination of natural plant ingredients and non-toxic nanoparticles is both safe and environmentally friendly, suitable for multiple fields such as poultry processing, and has broad application prospects.

The invention relates to the technical field of agriculture, animal husbandry and veterinary medicine, in particular to a protease cracking resistant antibacterial peptide FR and application thereof. The invention provides a protease cracking resistant antibacterial peptide FR. The amino acid sequence of the antibacterial peptide FR is as shown in SEQ ID NO. 1. The specific implementation result shows that the protease cracking resistant antibacterial peptide FR provided by the invention has the activity of resisting gram-negative bacteria (escherichia coli, shigella flexneri, salmonella, campylobacter jejuni and the like), also has low hemolytic activity, can resist cracking of high-concentration protease, and has a very good application prospect. In conclusion, the antibacterial peptide FR provided by the invention has the advantages of gastrointestinal tract environment resistance, high salt resistance and protease lysis resistance, can realize the killing effect on gram-negative bacteria in the presence of enzymes and salt ions, has the characteristic of low hemolytic activity, and provides a new way for development of antibiotic substitutes.

The use of Campylobacter jejuni and its toxin in the preparation of drugs for preventing, diagnosing, predicting, treating colorectal cancer and extra-intestinal tumor metastasis. Campylobacter, especially Campylobacter jejuni and toxin CDT, can be used as a marker to distinguish whether a colorectal cancer patient has metastasis. Experiments have proved that Campylobacter jejuni has the ability to promote metastasis and invasion. Campylobacter jejuni promotes the invasion and metastasis of colon cancer cells by CDT protein and the up-regulated JAK2 / STAT3 / MMP9 signaling pathway activated by CDT protein. When the process is blocked, the tumor metastasis-promoting ability of Campylobacter jejuni is weakened or lost. Campylobacter jejuni also promotes the metastasis of extra-intestinal tumors. Based on drugs or agents that can block this process, the metastasis of colorectal cancer cells and extra-intestinal tumors can be prevented and inhibited. Based on Campylobacter jejuni and its toxin, corresponding reagents or methods are developed for diagnosing or predicting the metastasis of colorectal cancer and extra-intestinal tumors. Through the marker provided in the present application, it is expected to inhibit tumor metastasis and prolong the survival of patients.

The invention discloses a novel cyclic antibacterial peptide with a broad-spectrum antibacterial effect and application of the novel cyclic antibacterial peptide, the obtained novel antibacterial peptide is named as N1-7567, and the novel cyclic antibacterial peptide belongs to the technical field of antibacterial peptides. The amino acid sequence of the novel antibacterial peptide N1-7567 is AFLKRFSCRLIRAGKYLSCLLQPAA, and the C at the 8 site and the C at the 19 site are S-S. The invention also discloses a preparation method of the novel antibacterial peptide N1-7567. The obtained antibacterial peptide has a broad-spectrum antibacterial effect, the minimum inhibitory concentration (MIC) of the antibacterial peptide N1-7567 to campylobacter jejuni 81-176 is 22.13 mu M, and the novel antibacterial peptide is expected to become a novel prevention and control product for campylobacter jejuni.

The invention relates to the technical field of infectious disease pathogen detection, and discloses a reagent method for ultra-fast detection of digestive tract infectious disease pathogens, which comprises the following steps: S1, the core of a TaqMan probe method is that a complete probe with free probe molecules cannot detect a fluorescence signal; fluorescence emitted by the luminous group can be absorbed and quenched by the quenching group, the probe is hydrolyzed, and a fluorescence signal can be detected when the luminous group is far away from the quenching group. According to the reagent method for ultrafast detection of the pathogens of the infectious diseases of the digestive tract, a PCR method is combined with a fluorescent probe detection technology, highly conserved sequences of salmonella, vibrio parahaemolyticus and campylobacter jejuni are taken as target regions respectively, specific primers and fluorescent probes are designed, and the three bacteria are detected; the whole process of sampling of a sample to be detected, PCR reaction amplification efficiency and the like is monitored, and then three pathogens and one internal reference are detected at the same time through one reaction hole.

The invention firstly provides an application of glutamyl hydroxamic acid in an iron ion-ururic acid system chromogenic reaction and a glutamyl hydroxamic acid-iron ion-ururic acid chromogenic reaction system. On the basis, the invention provides a colorimetric detection method for campylobacter based on a glutamyl hydroxamic acid-Fe < 3 + >-ururic acid chromogenic reaction. The detection method comprises the following steps: firstly enriching campylobacter in a detection device, then adding a glutamyl hydroxamic acid-Fe < 3 + >-ururic acid chromogenic reaction system, converting cell density into a remarkably amplified color signal, and finally performing color recognition. According to the detection method, by preparing a glutamyl hydroxamic acid-sodium alginate-FsC [Fe < 3 + >] polymer II, amplification conversion from bacterial density to a system color signal is realized, the detection limit is reduced, the sensitivity is improved, the operation is simple, and a feasible scheme for high-throughput detection of campylobacter is provided. The invention further provides a high-throughput campylobacter jejuni detection device, the detection device belongs to a portable biosensing platform, and low-density and high-throughput field detection of campylobacter in shellfish marine products is achieved.