104 results about "Ornithine" patented technology

The invention relates to the field of fermentation processes, in particular to a method for preparing 1, 4-butanediol through multi-strain synergistic fermentation, which comprises the following steps: inoculating a first strain and a second strain into a culture medium containing glucose and / or xylose for synergistic fermentation, producing ornithine by the first strain by taking glucose and / or xylose as a substrate, and converting ornithine into 1, 4-butanediol by the second strain. The invention discloses 1, 4-butanediol. Glucose is converted into ornithine through the first strain, ornithine is converted into 1, 4-butanediol through the second strain, the first strain and the second strain are subjected to synergistic fermentation, preparation of 1, 4-butanediol through microbial synergistic fermentation is achieved, and higher metabolic capacity and higher production efficiency are achieved. The mixed sugar of xylose and glucose prepared from biomass raw materials is used as a substrate for fermentation, so that the method has the advantages that the raw materials are easy to obtain, renewable and low in cost, and the production cost can be reduced.

The specification describes an improved serum-free animal cell culture medium, which can used for the production of a protein of interest. Ornithine, or a combination of ornithine and putrescine can be added to serum-free media or chemically defined media to improve viable cell density, to reduce cell doubling time, and to increase the production of a protein of interest.

The invention belongs to the technical field of crop cultivation, and particularly discloses a two-component flavor enhancer for rice flavor enhancement as well as a preparation method and application of the two-component flavor enhancer for rice flavor enhancement, and the two-component flavor enhancer is prepared from a component A and a component B in a weight ratio of 1: (0.9-1.1), wherein the component A is prepared from the following raw materials in parts by weight: 80 to 120 parts of proline and 180 to 220 parts of ornithine; the component B is prepared from 2 to 5 parts of colloidal chitosan nano-selenium and 350 to 450 parts of zinc oxide quantum dots. The flavor enhancer developed in the invention is helpful for efficiently increasing the content of free proline and proline dehydrogenase, increasing the accumulation of 2-AP in rice grains, and effectively improving the rice fragrance.

The present invention provides an objective non-invasive method for examining renal dysfunction in cats. This method for testing renal dysfunction is a method for testing renal dysfunction in cats, and comprises a step for measuring the level of one or more D-amino acids selected from the group consisting of D-tyrosine, D-methionine, D-tryptophan, D-ornithine, and D-histidine in urine of a subject.

The present invention discloses Anti-hirsutism compositions, use and methods for managing hirsutism in a subject using the composition comprising turmeric oil standardized to contain Aromatic Turmerone (ar-Turmerone), Eflornithine; Nigella sativa extract; Oroxylum indicum extract; and Licorice extract either individually or combinations thereof. The invention also discloses use of the above composition in inhibiting the activity of ornithine decarboxylase and 5-α-reductase.

The invention discloses a polyarginine nano-particle as well as a preparation method and application thereof. The preparation method comprises the following steps: polymerizing ornithine-carboxylic anhydride (NCA) serving as a monomer with leucine to obtain a diblock polymer, or polymerizing the ornithine-carboxylic anhydride monomer, and then performing guanidination treatment and self-assembly to obtain the polyarginine nanoparticles. The polyarginine nano-particles prepared by the invention can be combined with free nucleic acid released by injured tissues or cells in traumatic brain injury (TBI) to remove the free nucleic acid and prevent downstream immune response reaction, so that the proinflammatory factor level is remarkably reduced, and the purposes of relieving inflammation and treating TBI are achieved; compared with the traditional cationic amino acid (polylysine), the polyarginine material adopted by the invention can effectively improve the prognosis of TBI patients. Therefore, the invention provides the nano material with remarkably improved DNA binding capacity and treatment effect, and the nano material has important significance in treatment of traumatic brain injury.

The invention relates to a method for determining enzyme activity of ODC1 (ornithine decarboxylase 1), which comprises the following steps: digesting, centrifuging and resuspending cells, and taking a part of sample to detect protein concentration; the method comprises the following steps: cracking cells by using a specially-made enzyme activity cell lysis solution and a protein lysis solution, and ensuring full cracking through ultrasonication; carrying out quantitative analysis on the protein in the lysate by adopting a BCA kit; in the enzyme activity detection stage, a cell lysis solution and an enzyme activity detection working solution containing a specific fluorescent probe (CB6) are mixed and react at 37 DEG C for a certain time, and then the change of fluorescence intensity is determined by a multifunctional fluorescence microplate reader, so that the enzyme activity of the ODC1 is evaluated. According to the method, accurate determination of the ODC1 enzyme activity is realized by optimizing cell treatment, protein quantification and enzyme activity detection processes. The method has the advantages of simplicity and convenience in operation, high sensitivity, good specificity and the like, and is suitable for the fields of basic research, drug screening and the like related to the ODC1 enzyme activity.

A composition for relieving hangovers and protecting the liver, made from the following raw materials in the indicated weight ratios: 3-20 parts of kudzu root extract, 2-20 parts of Japanese raisin tree fruit extract, 1-12 parts of N-acetylcysteine, 1-12 parts of L-ornithine, 1-15 parts of L-glutamine, 0.2-8 parts of glycyrrhetinic acid glycyrrhiza extract, 0.05-5 parts of curcumin, 0.005-0.5 parts of piperine, 0.5-10 parts of vitamin C, 0.01-2 parts of B vitamins complex, 0.1-8 parts of electrolyte salts, and 1-25 parts of honey or oligosaccharides.

The invention discloses a reagent for enhancing aroma and improving quality of cigar tobacco leaves and application of the reagent, and relates to the technical field of tobacco fertilization and tobacco processing.The reagent comprises an ornithine solution with the mass concentration being 0.1-0.3%, or a glutamic acid solution with the mass concentration being 0.1-0.3%, or a proline solution with the mass concentration being 0.1-0.3%. The cigar tobacco aroma improving method has important significance on improving the quality of cigar tobacco raw materials, and is easy to operate, low in cost, economical and practical.

The invention provides a flora and an application of the flora in biodegradation of polyurethane plastics. The flora is prepared from raoultella ornithinolytica, klebsiella pneumoniae, coxakella rhizogenes and achromobacter xylosoxidans. According to the method, the polyurethane degrading flora is screened from the collected soil sample, the flora can efficiently degrade waterborne polyurethane and thermoplastic polyurethane elastomers with large chemical structure difference at the same time to degrade polyurethane plastic, the process is greatly simplified, the operation cost is reduced, traditional landfill incineration is replaced, green circulation of polyurethane is assisted, and the method has the advantages of being environmentally friendly and environmentally friendly. The method has important practical significance for solving the problem of environmental pollution caused by polyurethane waste and promoting green cyclic utilization of polyurethane materials.

Provided herein are fixed-dose combination formulations of a pharmaceutically effective amount of eflorithine together with a pharmaceutically effective amount of sulindac. Also provided are methods of use and of methods of manufacture of these formulations.

The invention relates to the technical field of plant genetic engineering, and discloses an overexpressed ornithine decarboxylase coding gene, an overexpressed transcription factor coding gene, application of biological materials of the overexpressed ornithine decarboxylase coding gene and the overexpressed transcription factor coding gene, and a method for increasing the nicotine content in tobacco. Meanwhile, the nicotine content in tobacco overexpressed with the two genes is remarkably increased compared with that of a wild type, and is far greater than the increasing amplitude of any one of the genes overexpressed independently, so that the problems that in the prior art, the nicotine content cannot be remarkably increased through gene coordinated regulation and control, and the nicotine increasing amplitude bottleneck is difficult to break through are effectively solved; powerful support is provided for high-nicotine tobacco cultivation.

An ornithine decarboxylase gene related to Auricularia auricula-judae degradation and application thereof belong to the field of bioengineering technology. In order to solve the technical problem that there is lack of key functional genes and molecular targets which can be used for early identification, anti-degradation molecular breeding and strain rejuvenation due to continuous subculture leading to degradation in Auricularia auricula-judae industry, based on the G1, G10 and G20 mycelium transcriptome difference analysis of Auricularia auricula-judae strain Heiwei S1908, the ornithine decarboxylase gene g4162 significantly differentially expressed between normal mycelium and G20 degraded mycelium is screened, the molecular function of the gene in the degradation of Auricularia auricula-judae subculture is determined, and the system biology information prediction of the gene coding protein is completed, which provides core gene resources and theoretical basis for the degradation mechanism research, molecular detection kit development, anti-degradation germplasm screening and gene breeding of Auricularia auricula-judae.

Disclosed in the present invention are an atosiban derivative or a pharmaceutically acceptable salt thereof, and the preparation and the use thereof. The structure of the atosiban derivative or the pharmaceutically acceptable salt thereof is as shown in general formula (I) or (II). On the basis of the present invention, fatty acid acylation is performed on an ornithine residue in an atosiban peptide sequence to prepare the derivative, which can effectively improve the antagonistic effect of a parent nucleus. The oxytocin antagonistic effect of the atosiban derivative prepared in the present invention is obviously higher than that of atosiban acetate, and the effect can be effectively used for preventing and / or treating premature delivery when used as an oxytocin antagonist to prepare a drug.

The present invention provides a denitrifying strain capable of removing both toluene and nitrogen under anaerobic conditions and its application, belonging to the field of microbial technology. The denitrifying strain described in the present invention is Raoultella ornithinolytica strain 14, which is deposited in the China Center for Type Culture Collection with a deposit number of CCTCC NO: M 20241685. The Raoultella ornithinolytica strain 14 provided by the present invention can simultaneously achieve the functions of denitrification and toluene removal under anaerobic conditions, is easy to use, simple to operate, reduces the cost of sewage treatment, and has good application prospects in sewage treatment.

The present application relates to a microorganism having the ability to produce L-ornithine and a method for producing L-ornithine using the same.

The present invention provides an oral composition that suppresses off-flavors derived from ornithine.　Provided is an oral composition containing the following components (A) and (B): (A) 15 mass% to less than 30 mass% of ornithine; and (B) an aromatic ketone. The mass ratio [(B) / (A)] of component (A) and component (B) is 1.7×10-8 to 1.0×10-4.

The invention relates to the technical field of construction of recombinant bacteria, in particular to recombinant corynebacterium glutamicum for producing L-ornithine as well as a construction method and application of the recombinant corynebacterium glutamicum for producing L-ornithine, corynebacterium glutamicum SO30 is taken as an original strain, a SigD gene and a FruR gene are sequentially knocked out through a suicide plasmid pK18mobsacB mediated homologous recombination technology, and double knockout recombinant corynebacterium glutamicum SO30-SigD-FruR is constructed. The L-ornithine yield of the strain subjected to shake-flask fermentation reaches 51.88 g / L and is increased by 56.7% compared with that of an original strain SO30; the fermentation yield of a 5L bioreactor reaches 123 g / L and is increased by 57.6% compared with that of an original strain SO30, and the cell biomass and the sugar conversion rate are remarkably increased. Through global transcriptional regulation factor transformation, the existing yield bottleneck is broken through, and efficient strains and technical support are provided for industrial fermentation production of L-ornithine.

The invention relates to the technical field of metabonomics analysis, in particular to application of a metabolic marker in preparation of a head and neck squamous cell carcinoma diagnostic product, a kit, a screening method of the metabolic marker of the head and neck squamous cell carcinoma, a diagnostic model and a construction method and application of the diagnostic model. The metabolic marker comprises at least one of lactic acid, sphingosine, cadaverine, uridine diphosphate, allantoic acid, hydroxyproline, sphingosine-1-phosphoric acid, indole-3-acetaldehyde, pantothenic acid, fumaric acid, malic acid, prostaglandin or ornithine in red blood cells and / or plasma. The screened red blood cells and plasma metabolism markers can be used for predicting or diagnosing the head and neck squamous cell carcinoma respectively or independently, particularly, the red blood cell metabolism markers can provide more stable tumor microenvironment information, and the metabolism stability is high and is not easily influenced by diet and circadian rhythm.

The present invention relates to a composition for hangover relief and liver function improvement, comprising L-ornithine, and a preparation method therefor. According to the present invention, the advantages are achieved of having low burden on the human body, while at the same time exhibiting a sufficient hangover relief effect. Accordingly, the embodiments of the present invention provide hangover relief and liver function improving effects.

The invention belongs to the technical field of biological medicines, and particularly relates to a marker for evaluating the curative effect of hydroxychloroquine on treating IgA nephropathy and application of the marker. The marker for evaluating the curative effect of the hydroxychloroquine on the IgA nephropathy is a combination of any one or any two or any three or any four or five of D-ornithine, L-arginine, L-cysteine, L-cystine and D-cysteine. Based on the five markers, a combined prediction model is constructed, the model shows relatively high prediction performance, and an early-stage non-invasive screening method can be provided for clinic and is used for identifying IgAN patients with potential HCQ treatment ineffectiveness.

The present invention relates to the technical field of camel thorn separation and purification, and discloses an ornithine alkaloid from camel thorn, an extraction method thereof, and an application thereof. The method comprises: crushing the dried aerial part of camel thorn, adding methanol, and heating under reflux for extraction. The obtained total extract of camel thorn is dispersed with water, extracted with petroleum ether, ethyl acetate, and dichloromethane, and concentrated. The dichloromethane extract is separated by gradient elution on a silica gel column, and the fifth fraction is purified and separated by gradient elution on a high-performance liquid chromatography (HPLC), and the eluate is collected to obtain the ornithine alkaloid from camel thorn at 7.3 minutes. The present invention discloses for the first time 2-methylhexahydro-3H-pyrrolo[1,2-a]imidazol-3-one from camel thorn, which has a certain inhibitory effect on human HeLa cervical cancer cells, thereby enabling the application of such compounds from camel thorn as potential anti-cervical cancer drugs.

The present disclosure relates to a method for optimizing a virus membrane fusion inhibitor, abroad-spectrum anti-coronavirus lipopeptide and use thereof. The present disclosure provides compounds or pharmaceutically acceptable salts thereof or derivatives thereof, wherein the compounds are shown in formula (I) or formula (II), X1 is an amino-terminal protecting group; X2 is a polypeptide with an amino acid sequence of (EAAAK)n or A[(EAAAK)n]A; X3 is lysine or cysteine or 2,3-diaminopropionic acid or ornithine or 2,4-diaminobutyric acid or 2,7-diaminoheptonic acid; X4 is a lipophilic compound group modified on X3 or X4 is a lipophilic compound group modified on K in X2; X5 is a carboxyl-terminal protecting group.

[Object] The present application aims to provide an ornithine assembly having low toxicity, effects even when administered orally, and high bioavailability. In addition, the present application aims to provide an ornithine assembly effective for the prevention or treatment of liver damage. [Solution] A condensate in which an acyl group or the like is introduced into the ornithine side chain amino group of polyethylene glycol-b-polyornithine is provided, and further, a new assembly independent of PIC is provided.

This disclosure provides a polypeptide and a nanoassembly of formula (I) and a method for preparing the same. In formula (I), R1 is selected from any of the following groups: aliphatic primary amine residues, aromatic primary amine residues, and residues based on modified polyethylene glycol; R2 is selected from any of the following groups: H, amino protecting group; wherein, when R2 represents an amino protecting group, R3 represents H, and when R2 represents H, R3 represents H or is absent; n includes 1 to 1000, representing the degree of polymerization of the amino acid monomers on the polypeptide backbone; x includes 1 to 3; wherein, when x = 1, the polypeptide backbone corresponds to 2,4-diaminobutyric acid, when x = 2, the polypeptide backbone corresponds to ornithine, and when x = 3, the polypeptide backbone corresponds to lysine amino acid residues. The polypeptide provided in this disclosure can, after ultraviolet light irradiation (or other types of side-chain protecting groups and their corresponding deprotection), expose amino groups on the side chains of the polypeptide backbone, and undergo amino cyclization attacking the amide bond, leading to self-degradation of the backbone.

Provided are a microorganism having L-ornithine-producing ability and a method of producing L-ornithine using the same.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention discloses a nutritional health-care product for preventing and treating urethral calculus and a preparation method thereof, and belongs to the technical field of health care, the nutritional health-care product comprises modified citric acid chelated magnesium, L-ornithine-L-aspartic acid double salt, L-citrulline, a composite plant extract with a specific ratio, functional dietary fiber and the like. The preparation process comprises the key steps of preparation of modified citric acid chelated magnesium, enzymolysis-ultrasonic synergistic extraction of the composite plant extract, graded mixing, precise forming and the like. The utilization rate of the magnesium element is larger than or equal to 85%, the content of plant active ingredients is remarkably increased, calculus crystallization can be synergistically inhibited, calculus discharging is promoted, metabolism is adjusted, the product storage stability and forming quality are excellent, and the product is suitable for urethral calculus prevention and postoperative rehabilitation.

The invention discloses a method for synthesizing spermidine through a double-bacterium co-culture system, and relates to the technical field of bioengineering. The method comprises the following steps: constructing a first strain for synthesizing and secreting ornithine; a second strain is constructed and used for synthesizing aspartic semialdehyde and butanediamine, the second strain comprises carboxyl spermidine dehydrogenase and carboxyl spermidine decarboxylase, the carboxyl spermidine dehydrogenase is a mutant enzyme obtained by performing G13A and / or K159R mutation on an amino acid sequence as shown in SEQ ID NO: 1, and the carboxyl spermidine decarboxylase is a mutant enzyme obtained by performing G13A and / or K159R mutation on an amino acid sequence as shown in SEQ ID NO: 2. The carboxyl spermidine decarboxylase is a mutant enzyme obtained by carrying out D82E single-point mutation on an amino acid sequence as shown in SEQ ID NO: 2; and co-culturing and fermenting the first strain and the second strain to synthesize spermidine. According to the present invention, the metabolism division and the efficient synergy can be achieved, the metabolism load and the butanediamine toxicity accumulation can be reduced, and the catalytic efficiency of the key reaction and the cofactor utilization efficiency can be improved so as to significantly improve the spermidine yield and the conversion efficiency.

The invention relates to the technical field of gene engineering and enzyme engineering, in particular to an ornithine decarboxylase mutant, a gene, a recombinant plasmid, a recombinant strain and application. The ornithine decarboxylase mutant is obtained by mutating wild type ornithine decarboxylase of which the amino acid sequence is as shown in SEQ ID NO.1, and the mutation sites of the ornithine decarboxylase mutant comprise any one or more of Y104F, A264V, Q263E, R157K, S325C and V265A. The ornithine decarboxylase mutant with high enzyme activity is obtained by performing single-point mutation or multi-site combined mutation on wild ornithine decarboxylase, so that the substrate conversion rate of ornithine decarboxylation reaction and the synthetic efficiency of butanediamine are remarkably improved; the speed limiting bottleneck of the ornithine decarboxylation reaction in the synthesis path from glucose to ornithine and then to butanediamine is successfully broken through, and the overall efficiency of the metabolic path is remarkably optimized.