43 results about "Ornithine" patented technology

The present invention discloses Anti-hirsutism compositions, use and methods for managing hirsutism in a subject using the composition comprising turmeric oil standardized to contain Aromatic Turmerone (ar-Turmerone), Eflornithine; Nigella sativa extract; Oroxylum indicum extract; and Licorice extract either individually or combinations thereof. The invention also discloses use of the above composition in inhibiting the activity of ornithine decarboxylase and 5-α-reductase.

The invention relates to a method for determining enzyme activity of ODC1 (ornithine decarboxylase 1), which comprises the following steps: digesting, centrifuging and resuspending cells, and taking a part of sample to detect protein concentration; the method comprises the following steps: cracking cells by using a specially-made enzyme activity cell lysis solution and a protein lysis solution, and ensuring full cracking through ultrasonication; carrying out quantitative analysis on the protein in the lysate by adopting a BCA kit; in the enzyme activity detection stage, a cell lysis solution and an enzyme activity detection working solution containing a specific fluorescent probe (CB6) are mixed and react at 37 DEG C for a certain time, and then the change of fluorescence intensity is determined by a multifunctional fluorescence microplate reader, so that the enzyme activity of the ODC1 is evaluated. According to the method, accurate determination of the ODC1 enzyme activity is realized by optimizing cell treatment, protein quantification and enzyme activity detection processes. The method has the advantages of simplicity and convenience in operation, high sensitivity, good specificity and the like, and is suitable for the fields of basic research, drug screening and the like related to the ODC1 enzyme activity.

A composition for relieving hangovers and protecting the liver, made from the following raw materials in the indicated weight ratios: 3-20 parts of kudzu root extract, 2-20 parts of Japanese raisin tree fruit extract, 1-12 parts of N-acetylcysteine, 1-12 parts of L-ornithine, 1-15 parts of L-glutamine, 0.2-8 parts of glycyrrhetinic acid glycyrrhiza extract, 0.05-5 parts of curcumin, 0.005-0.5 parts of piperine, 0.5-10 parts of vitamin C, 0.01-2 parts of B vitamins complex, 0.1-8 parts of electrolyte salts, and 1-25 parts of honey or oligosaccharides.

An ornithine decarboxylase gene related to Auricularia auricula-judae degradation and application thereof belong to the field of bioengineering technology. In order to solve the technical problem that there is lack of key functional genes and molecular targets which can be used for early identification, anti-degradation molecular breeding and strain rejuvenation due to continuous subculture leading to degradation in Auricularia auricula-judae industry, based on the G1, G10 and G20 mycelium transcriptome difference analysis of Auricularia auricula-judae strain Heiwei S1908, the ornithine decarboxylase gene g4162 significantly differentially expressed between normal mycelium and G20 degraded mycelium is screened, the molecular function of the gene in the degradation of Auricularia auricula-judae subculture is determined, and the system biology information prediction of the gene coding protein is completed, which provides core gene resources and theoretical basis for the degradation mechanism research, molecular detection kit development, anti-degradation germplasm screening and gene breeding of Auricularia auricula-judae.

The present application relates to a microorganism having the ability to produce L-ornithine and a method for producing L-ornithine using the same.

The invention relates to the technical field of construction of recombinant bacteria, in particular to recombinant corynebacterium glutamicum for producing L-ornithine as well as a construction method and application of the recombinant corynebacterium glutamicum for producing L-ornithine, corynebacterium glutamicum SO30 is taken as an original strain, a SigD gene and a FruR gene are sequentially knocked out through a suicide plasmid pK18mobsacB mediated homologous recombination technology, and double knockout recombinant corynebacterium glutamicum SO30-SigD-FruR is constructed. The L-ornithine yield of the strain subjected to shake-flask fermentation reaches 51.88 g / L and is increased by 56.7% compared with that of an original strain SO30; the fermentation yield of a 5L bioreactor reaches 123 g / L and is increased by 57.6% compared with that of an original strain SO30, and the cell biomass and the sugar conversion rate are remarkably increased. Through global transcriptional regulation factor transformation, the existing yield bottleneck is broken through, and efficient strains and technical support are provided for industrial fermentation production of L-ornithine.

The invention relates to the technical field of metabonomics analysis, in particular to application of a metabolic marker in preparation of a head and neck squamous cell carcinoma diagnostic product, a kit, a screening method of the metabolic marker of the head and neck squamous cell carcinoma, a diagnostic model and a construction method and application of the diagnostic model. The metabolic marker comprises at least one of lactic acid, sphingosine, cadaverine, uridine diphosphate, allantoic acid, hydroxyproline, sphingosine-1-phosphoric acid, indole-3-acetaldehyde, pantothenic acid, fumaric acid, malic acid, prostaglandin or ornithine in red blood cells and / or plasma. The screened red blood cells and plasma metabolism markers can be used for predicting or diagnosing the head and neck squamous cell carcinoma respectively or independently, particularly, the red blood cell metabolism markers can provide more stable tumor microenvironment information, and the metabolism stability is high and is not easily influenced by diet and circadian rhythm.

The present invention relates to a composition for hangover relief and liver function improvement, comprising L-ornithine, and a preparation method therefor. According to the present invention, the advantages are achieved of having low burden on the human body, while at the same time exhibiting a sufficient hangover relief effect. Accordingly, the embodiments of the present invention provide hangover relief and liver function improving effects.

The present disclosure relates to a method for optimizing a virus membrane fusion inhibitor, abroad-spectrum anti-coronavirus lipopeptide and use thereof. The present disclosure provides compounds or pharmaceutically acceptable salts thereof or derivatives thereof, wherein the compounds are shown in formula (I) or formula (II), X1 is an amino-terminal protecting group; X2 is a polypeptide with an amino acid sequence of (EAAAK)n or A[(EAAAK)n]A; X3 is lysine or cysteine or 2,3-diaminopropionic acid or ornithine or 2,4-diaminobutyric acid or 2,7-diaminoheptonic acid; X4 is a lipophilic compound group modified on X3 or X4 is a lipophilic compound group modified on K in X2; X5 is a carboxyl-terminal protecting group.

[Object] The present application aims to provide an ornithine assembly having low toxicity, effects even when administered orally, and high bioavailability. In addition, the present application aims to provide an ornithine assembly effective for the prevention or treatment of liver damage. [Solution] A condensate in which an acyl group or the like is introduced into the ornithine side chain amino group of polyethylene glycol-b-polyornithine is provided, and further, a new assembly independent of PIC is provided.

This disclosure provides a polypeptide and a nanoassembly of formula (I) and a method for preparing the same. In formula (I), R1 is selected from any of the following groups: aliphatic primary amine residues, aromatic primary amine residues, and residues based on modified polyethylene glycol; R2 is selected from any of the following groups: H, amino protecting group; wherein, when R2 represents an amino protecting group, R3 represents H, and when R2 represents H, R3 represents H or is absent; n includes 1 to 1000, representing the degree of polymerization of the amino acid monomers on the polypeptide backbone; x includes 1 to 3; wherein, when x = 1, the polypeptide backbone corresponds to 2,4-diaminobutyric acid, when x = 2, the polypeptide backbone corresponds to ornithine, and when x = 3, the polypeptide backbone corresponds to lysine amino acid residues. The polypeptide provided in this disclosure can, after ultraviolet light irradiation (or other types of side-chain protecting groups and their corresponding deprotection), expose amino groups on the side chains of the polypeptide backbone, and undergo amino cyclization attacking the amide bond, leading to self-degradation of the backbone.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention discloses a nutritional health-care product for preventing and treating urethral calculus and a preparation method thereof, and belongs to the technical field of health care, the nutritional health-care product comprises modified citric acid chelated magnesium, L-ornithine-L-aspartic acid double salt, L-citrulline, a composite plant extract with a specific ratio, functional dietary fiber and the like. The preparation process comprises the key steps of preparation of modified citric acid chelated magnesium, enzymolysis-ultrasonic synergistic extraction of the composite plant extract, graded mixing, precise forming and the like. The utilization rate of the magnesium element is larger than or equal to 85%, the content of plant active ingredients is remarkably increased, calculus crystallization can be synergistically inhibited, calculus discharging is promoted, metabolism is adjusted, the product storage stability and forming quality are excellent, and the product is suitable for urethral calculus prevention and postoperative rehabilitation.

The invention discloses a method for synthesizing spermidine through a double-bacterium co-culture system, and relates to the technical field of bioengineering. The method comprises the following steps: constructing a first strain for synthesizing and secreting ornithine; a second strain is constructed and used for synthesizing aspartic semialdehyde and butanediamine, the second strain comprises carboxyl spermidine dehydrogenase and carboxyl spermidine decarboxylase, the carboxyl spermidine dehydrogenase is a mutant enzyme obtained by performing G13A and / or K159R mutation on an amino acid sequence as shown in SEQ ID NO: 1, and the carboxyl spermidine decarboxylase is a mutant enzyme obtained by performing G13A and / or K159R mutation on an amino acid sequence as shown in SEQ ID NO: 2. The carboxyl spermidine decarboxylase is a mutant enzyme obtained by carrying out D82E single-point mutation on an amino acid sequence as shown in SEQ ID NO: 2; and co-culturing and fermenting the first strain and the second strain to synthesize spermidine. According to the present invention, the metabolism division and the efficient synergy can be achieved, the metabolism load and the butanediamine toxicity accumulation can be reduced, and the catalytic efficiency of the key reaction and the cofactor utilization efficiency can be improved so as to significantly improve the spermidine yield and the conversion efficiency.

The invention relates to the technical field of gene engineering and enzyme engineering, in particular to an ornithine decarboxylase mutant, a gene, a recombinant plasmid, a recombinant strain and application. The ornithine decarboxylase mutant is obtained by mutating wild type ornithine decarboxylase of which the amino acid sequence is as shown in SEQ ID NO.1, and the mutation sites of the ornithine decarboxylase mutant comprise any one or more of Y104F, A264V, Q263E, R157K, S325C and V265A. The ornithine decarboxylase mutant with high enzyme activity is obtained by performing single-point mutation or multi-site combined mutation on wild ornithine decarboxylase, so that the substrate conversion rate of ornithine decarboxylation reaction and the synthetic efficiency of butanediamine are remarkably improved; the speed limiting bottleneck of the ornithine decarboxylation reaction in the synthesis path from glucose to ornithine and then to butanediamine is successfully broken through, and the overall efficiency of the metabolic path is remarkably optimized.

The present disclosure provides a modified human OTC protein having improved properties for the treatment of OTC deficiency in a patient. Preferably, the protein of the disclosure is produced from a codon optimized mRNA suitable for administration to a patient suffering from OTC deficiency wherein upon administration of the mRNA to the patient, the protein of the disclosure is expressed in the patient in therapeutically effective amounts to treat OTC deficiency. The present disclosure also provides codon optimized mRNA sequences encoding wild type human OTC comprising a 5′ UTR derived from a gene expressed by Arabidopsis thaliana for use in treating OTC deficiency in a patient.

This application relates to the fields of genetic engineering and enzyme engineering, specifically to an ornithine decarboxylase mutant, gene, recombinant plasmid, recombinant strain, and its applications. The ornithine decarboxylase mutant is obtained by mutating the wild-type ornithine decarboxylase with the amino acid sequence shown in SEQ ID NO.1, and the mutation sites of the ornithine decarboxylase mutant include any one or more of Y104F, A264V, Q263E, R157K, S325C, and V265A. By performing single-point or multi-site combination mutations on the wild-type ornithine decarboxylase, a high-activity ornithine decarboxylase mutant is obtained, thereby significantly improving the substrate conversion rate of the ornithine decarboxylation reaction and the synthesis efficiency of butanediamine. This successfully overcomes the rate-limiting bottleneck of the ornithine decarboxylation reaction in the synthetic pathway from glucose to ornithine and then to butanediamine, significantly optimizing the overall efficiency of this metabolic pathway.

The present disclosure relates to a microorganism of the genus Corynebacterium in which the activity of fumarate hydratase is enhanced, and a method for producing L-amino acids using same. The microorganism of the genus Corynebacterium with enhanced fumarate hydratase exhibits increased production capability of L-amino acids such as L-arginine, L-citrulline, L-ornithine, O-acetylhomoserine, L-homoserine, and L-histidine, compared to a parent strain in which the fumarate hydratase is not enhanced, and the microorganism with enhanced fumarate hydratase can be widely used for the production of L-amino acids.

The invention belongs to the technical field of biology, and discloses an Ileibacterium valens strain and application thereof.The Ileibacterium valens strain has the preservation number of GDMCC No: 67610, the preservation date of January 8, 2026, the classification name of Ileibacterium valens is named as Ileibacterium valens, the preservation unit is Guangdong Microbial Culture Collection Center, the preservation address is 59 building, No.100 Courtyard, Xianlie Middle Road, Guangzhou City, the Ileibacterium valens strain can obviously improve the ornithine level in the liver, and the content of ornithine in the liver can be obviously reduced. The traditional Chinese medicine composition has a certain improvement effect on metabolic disorder, hepatic lesion and fat deposition caused by MASLD induced by high-fat, high-glucose and high-cholesterol diet, and is expressed in that the levels of TC, LDL, AST and ALT in serum can be remarkably reduced.

The invention discloses a lactoferrin-derived bioactive polypeptide as well as preparation and application thereof. The amino acid sequence of the bioactive polypeptide conforms to the general formula TKCX1QWQRX2MX3K, wherein X1 is phenylalanine (F), arginine (R) or alanine (A); x2 is alanine (A), asparagine (N), tryptophan (W) or ornithine (O), and X3 is arginine (R) or lysine (K). In-vitro experiment results prove that the bioactive polypeptide disclosed by the invention has good effects of resisting oxidation, relieving and brightening skin color; when the composition is applied to cosmetics, damage to skin caused by environmental stimulation and endogenous pressure can be relieved, and the skin color can be improved.

To provide an improved serum-free animal cell culture medium that can be used for production of a protein of interest.SOLUTION: Inclusion of ornithine, either with or without putrescine, in serum-free cell culture medium ("OS" medium) increases cell viability and density, decreases cell doubling time, and allows for high titer protein production by these cells.SELECTED DRAWING: None

This invention discloses a composition of *Brachystomum clavatum* CUP3, *Brachystomum clavatum* CUP3, and *Raoultella ornithine-lysinogen* RAO1, and its application in controlling bacterial wilt in crops. *Brachystomum clavatum* CUP3 is classified as... Cupriavidus yeoncheonensis The invention discloses the application of *Cup3*, a copper-loving bacterium, in the control of soil-borne bacterial wilt in crops. The invention also discloses a bacterial composition containing *Cup3* and *Rauvolfia ornithine-releasing* RAO1, or a fermentation broth containing *Cup3* and *Rauvolfia ornithine-releasing* RAO1; wherein the preservation number of *Rauvolfia ornithine-releasing* RAO1 is GDMCC NO:67513. Both *Cup3* and the bacterial composition can reduce the occurrence of bacterial wilt in tomatoes, especially the bacterial composition, which can significantly reduce the occurrence of bacterial wilt in tomatoes.

Disclosed herein are leukocyte-targeting molecules, pharmaceutical compositions comprising leukocyte-targeting molecules and an optional pharmaceutical agent, and methods of using same. In some embodiments, a leukocyte-targeting molecule is a peptide having the formula: X1X2AAX3AX4X5X17AX6X7X8AX9X10A(P)nX11x12(X13)n, or a pharmaceutically acceptable salt thereof: wherein X1, X2, X11, and X12 are each, independently, lysine, arginine, or ornithine; X3, X4, X5, X6, X7, X8, X9, and X10 are each, independently, valine, leucine, isoleucine, or norleucine; X13 is tyrosine; X17 is praline or alanine; and n is 0 or 1.

The present invention provides a pest control agent that is readily available and can control root-knot nematodes without adversely affecting crops or workers, as well as a method for controlling root-knot nematodes using the same. [Solution] A root-knot nematode control agent is provided which contains at least one basic amino acid selected from the group consisting of histidine, ornithine, arginine, and lysine, or at least one antioxidant component selected from the group consisting of cysteine, ascorbic acid, glucosamine, and hydroxyphenylacetic acid.

Provided are methods for treating patients with type 1 diabetes, wherein the patient has new onset type 1 diabetes no more than eight months before starting treatment, and has not previously received an immunomodulatory agent. Also provided are methods for improving cell health in a patient having type 1 diabetes. Also provided are methods for preserving residual C-peptide in a patient having type 1 diabetes. The methods comprise administering an effective amount of a pharmaceutical therapy that comprises eflornithine while the patient is maintained on a low polyamine diet, wherein the method prevents, delays, decreases the likelihood of, or decreases the severity of diabetic ketoacidosis severe hypoglycemia, progression of diabetic nephropathy and retinopathy.

This invention belongs to the fields of genetic engineering and enzyme engineering technology, specifically relating to overexpression. ynal Genetically engineered bacteria and a method for producing L-ornithine. The genetically engineered bacteria are used to overexpress... ynal The genes were modified to make them comparable to unmodified E. coli. ynal Enhanced gene expression intensity or increased expression level results in modified genetically engineered bacteria having enhanced L-ornithine production capacity.

This invention belongs to the fields of genetic engineering and enzyme engineering technology, specifically relating to overexpression. yneE Genetically engineered bacteria and a method for producing L-ornithine. The genetically engineered bacteria are used to overexpress... yneE The genes were modified to make them comparable to unmodified E. coli. yneE Enhanced gene expression intensity or increased expression level results in genetically engineered bacteria having an enhanced ability to produce L-ornithine.

A cosmetic composition is disclosed comprising i) at least one of methionine and its derivatives selected from methionine, S-adenosylmethionine, and S-adenosylmethioninamine; and ii) at least one of additional compounds selected from ornithine, agmatine, and their derivatives; wherein the weight ratio of the amount of said methionine and its derivatives to the amount of said additional compound is from 1:30 to 16:1.

The application belongs to the technical field of biological detection, and particularly relates to a biomarker composition and application thereof in MGMT promoter methylation detection. The biomarker composition comprises: phospholipids (L5PL) in LDL-5 subcomponent, creatinine, and ornithine. The application uses multiple biomarkers to determine whether a glioblastoma patient carries MGMT promoter methylation, has good sensitivity and specificity, is less traumatic to the patient, can overcome individual differences, and provides a new solution for prognosis evaluation of glioblastoma.

The present application relates to the technical field of cell engineering, and particularly relates to a culture medium for producing biological antibodies and a fermentation method thereof.The culture medium comprises a basic culture medium and a fermentation culture medium; the basic culture medium is based on a commercial culture medium and comprises the following components: fumaric acid, ferric ammonium citrate, astragaloside and baicalein; the fermentation culture medium is based on a commercial culture medium and comprises the following components: L-citrulline, L-ornithine, L-theanine, L-homoarginine, L-hydroxyproline, L-allo-threonine, mannose, isorhamnetin and ginkgolin.The culture medium combination can effectively improve the expression level of target antibodies, supports cells to maintain long-term activity in a high-density state; meanwhile, the charge variant distribution of the obtained antibodies is more uniform, and the product purity and consistency are significantly improved.