5 results about "Teriparatide" patented technology

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The application relates to the technical field of biomedical materials, and specifically discloses a preparation method of a double-crosslinked 3D-printed bone repair scaffold. The scaffold is made of a biphasic calcium phosphate matrix and a gelatin methacrylate hydrogel outer layer. The preparation method comprises the following steps: firstly, preparing biphasic calcium phosphate ink, and constructing a porous scaffold blank through 3D printing; then, carrying out double-crosslinking treatment of calcium chloride solution and glutaraldehyde solution in sequence to obtain a scaffold matrix with enhanced mechanical properties; then, preparing gelatin methacrylate hydrogel loaded with modified teriparatide, and compounding the gelatin methacrylate hydrogel with the scaffold matrix; and finally, obtaining the final product after blue light crosslinking and solidification. The bone repair scaffold has good biocompatibility and osteogenic activity, and can effectively promote bone defect repair. In addition, the preparation method is controllable and has good repeatability, the structure of the scaffold is accurately controlled through the 3D printing technology, and a new approach is provided for the preparation of personalized bone repair materials.

The present application belongs to the field of biological medicine, and particularly relates to a teriparatide oral preparation, a preparation method and application thereof. Specifically, the present application provides a teriparatide oral preparation, which comprises exosome-encapsulated teriparatide, wherein the surface of the exosome is grafted with succinylated epsilon-polylysine. The present application uses exosomes grafted with succinylated epsilon-polylysine to encapsulate and orally deliver teriparatide, and it is found that the exosomes can realize the release of teriparatide in the intestinal tract, and can also promote the intestinal wall permeability of teriparatide, thereby significantly improving the bioavailability of the oral teriparatide.

The invention discloses a long-acting parathyroid hormone receptor stimulant fusion protein and application thereof. The fusion protein can inhibit the activity of RANKL and promote PTHR-mediated bone anabolism, and comprises a first arm and a second arm, the first arm comprises a functional region targeting RANKL and an Fc region, and the second arm comprises a functional region capable of activating PTHR and an Fc region. The long-acting parathyroid hormone receptor stimulant fusion protein has the advantages of better drug effect, more lasting effect, better safety, higher structural stability, higher expression quantity and the like, and the comprehensive performance of the long-acting parathyroid hormone receptor stimulant fusion protein is superior to that of the existing or potential treatment means such as teriparatide, PEG-PTH, anti-RANKL monoclonal antibody, romomonoclonal antibody or a control sample synPTH-alpha RANKL-1.

The invention relates to the technical field of biomedical materials, and particularly discloses a preparation method of a double-crosslinking 3D printing bone repair scaffold. The scaffold is prepared by compounding a biphase calcium phosphate matrix and a gelatin methylacrylate hydrogel outer layer. The preparation method comprises the following steps: firstly, preparing biphase calcium phosphate ink, and constructing a porous scaffold blank through 3D printing; sequentially carrying out double crosslinking treatment on a calcium chloride solution and a glutaraldehyde solution to obtain a scaffold matrix with enhanced mechanical properties; then preparing gelatin methylacrylate hydrogel loaded with modified teriparatide, compounding the gelatin methylacrylate hydrogel with a scaffold matrix, and carrying out blue light cross-linking curing to obtain a final product. The bone repair scaffold provided by the invention has good biocompatibility and osteogenic activity, and can effectively promote bone defect repair. Besides, the preparation method is controllable in process and good in repeatability, precise regulation and control of the scaffold structure are achieved through the 3D printing technology, and a new way is provided for preparation of personalized bone repair materials.