159 results about "Viral Activity" patented technology

The invention discloses an anti-EV71 virus activity buthus martensii toxin polypeptide as well as a preparation method and application thereof, and belongs to the technical field of antiviral preparations. A scorpion tail electricity-saving stimulation method is adopted to obtain crude scorpion venom, and centrifugation and freeze drying are performed to obtain scorpion venom freeze-dried powder; dissolving the scorpion toxin freeze-dried powder, filtering, removing sediment, carrying out ultrafiltration centrifugation, and separating to obtain the anti-EV71 virus activity scorpion toxin polypeptide. According to the present invention, the scorpion martensii toxin polypeptides S-I (lt; 3kDa) and S-II (3-10 kDa) obtained from the scorpion martensii have good EV71 virus resistance; under the same concentration, the relative molecular mass is lt; compared with the prior art, the scorpion margaritae toxin polypeptide with the molecular weight of 3kDa has better anti-EV71 virus activity, has no toxic effect on cells, has the potential of being used as an anti-EV71 virus drug, and provides a theoretical basis for biomedical research and clinical application of the scorpion margaritae toxin polypeptide.

The invention discloses a novel isoxazolopyrimidine derivative with anti-new coronavirus activity as well as a preparation method and application of the novel isoxazolopyrimidine derivative. The isoxazolopyrimidine compound provided by the invention has a good inhibition effect on SARS-CoV-2, and relates to the compound shown in the general formula (I), and pharmaceutically acceptable salts and solvent compounds thereof have a good inhibition effect on new coronavirus, and can be used for preparing antiviral drugs related to the new coronavirus for prevention, treatment or adjuvant treatment. # imgabs0 #

The invention belongs to the technical field of biological medicine, and particularly relates to application of anethomycin in preparation of medicine for inhibiting cysteine protease activity. The invention discovers that anethomycin has the function of inhibiting the activity of virus cysteine protease, especially 3C or 3CL protease, for the first time. Molecular docking proves that anethomycin can effectively bind to the catalytic activity center of Senecavirus (SVA) 3C protease. An in-vitro FRET enzyme activity experiment proves that the inhibition rate of 50 [mu] M of anethomycin on SVA 3C protease reaches up to 88.5%. Cellular level experiments show that the anethomycin can significantly inhibit replication of SVA viruses, shows broad-spectrum antiviral activity on various viruses such as encephalomyocarditis viruses (EMCV), porcine reproductive and respiratory syndrome viruses (PRRSV) and porcine deltacoronaviruses (PDCoV), and is low in cytotoxicity and high in selectivity index (SI).

The invention discloses pyridone endoperoxide with antibacterial and antiviral activity and application thereof, and belongs to the fields of organic compound synthesis and medical technology, food engineering and the like. The invention proves that the series of endoperoxides can effectively kill pathogenic bacteria, fungi and viruses, including propionibacterium acnes, escherichia coli, staphylococcus aureus, candida albicans, human papilloma viruses, herpes simplex viruses and the like. The internal peroxide designed by the invention has the capability of treating skin diseases, is expected to be developed into a first-line medicine for treating skin diseases caused by pathogen invasion, and mainly relates to bacterial skin diseases, fungal skin diseases and viral skin diseases caused by pathogen infection. Meanwhile, the series of endoperoxides can be used for treating oral infection, periodontitis, infection of shoulder and other joint operations, and bacterial infection such as pressure sores. In addition, the peroxides in the series can also be used in the fields of food preservation, disinfectant preparation and the like.

The present invention provides: a novel human monoclonal antibody that binds to the spike (S) protein of severe acute respiratory syndrome coronavirus 2 (SARS-CoV-2) and neutralizes SARS-CoV-2; an antigen-binding fragment thereof; a pharmaceutical composition comprising the antibody or the antigen-binding fragment thereof; therefore, provided are: a human monoclonal antibody against SARS-CoV-2 coronavirus that binds to the S protein of the SARS-CoV-2 coronavirus and neutralizes the viral activity thereof including an immune escape mutation; an antigen-binding fragment thereof; a nucleic acid encoding the same; and a pharmaceutical composition for the treatment or prevention of SARS-CoV-2 coronavirus infection, comprising the antibody or the antigen-binding fragment thereof.

The invention relates to the technical field of nitrogen heterocyclic compounds, in particular to nitrogen heterocyclic alkaloid and application thereof in preventing and treating plant viruses. The structural formula of the nitrogen heterocyclic alkaloid is shown in the specification, wherein X is selected from any one of-OCH3,-OCH2CH3 and-O (CH2) 2CH3. An antiviral activity test result shows that the azacyclo-alkaloid series compounds provided by the invention have antiviral activity, and the antiviral activity level of part of azacyclo-alkaloid reaches or even exceeds that of a positive control drug. Therefore, the azacyclo-alkaloid is expected to be applied to prevention and treatment of plant viruses.

The application discloses an indole 3-amide derivative, a preparation method and application thereof. The compound has a structure shown in general formula I. The application further relates to a pharmaceutical composition containing the compound with the structure of formula I. Activity screening experiments show that the compound has good anti-dengue virus activity, and thus the application further provides application of the compound in preparation of an anti-dengue virus drug.

The present invention relates to the field of pharmaceutical technology, and discloses an anti-coronavirus polypeptide, a pharmaceutical composition and their applications. The anti-coronavirus polypeptide is based on the template EK1: SLDQINVTFLDLEYEMKKLEEAIKKLEESYIDLKEL-NH2 amino acid sequence. Through solid-phase synthesis, stapling and alanine modification are carried out on it, and the amino acids at specific positions are replaced with S5 and alanine. It is proved in the antiviral activity test that this kind of polypeptide molecule has anti-SARS-CoV-2 activity.

The application relates to the technical field of nitrogen heterocyclic compounds, in particular to a nitrogen heterocyclic alkaloid and application thereof in preventing and treating plant viruses. The structural formula of the nitrogen heterocyclic alkaloid is shown in the description, X is selected from any one of -OCH3, -OCH2CH3 and -O(CH2)2CH3. The anti-virus activity test result shows that the nitrogen heterocyclic alkaloid series compounds provided by the application all have anti-virus activity, wherein the anti-virus activity level of part of the nitrogen heterocyclic alkaloids reaches or even exceeds that of a positive control drug. Therefore, the nitrogen heterocyclic alkaloid can be expected to be applied to the prevention and treatment of plant viruses.

The invention discloses an application of sodium oxamate in preparation of anti-influenza virus products, and provides an application of sodium oxamate as a lactic dehydrogenase A inhibitor in preparation of anti-influenza virus products, the sodium oxamate has broad-spectrum antiviral activity, and can play a unique action mechanism by regulating host cell metabolism (such as protein lactylation). And a new direction is provided for overcoming virus resistance.

Provided are a buffer system for improving the stability and dispersibility of virus particles, a liquid preparation corresponding thereto, and a use thereof. The buffer system comprises a soluble salt substance, a polyol, and a pH buffer. The liquid preparation comprises a therapeutically effective amount of virus particles and the buffer system. The buffer system can significantly improve the stability and dispersibility of virus particles and reduce the content of aggregates and free nucleic acids. The signal response intensity of virus particles is not significantly reduced, viral activity is not significantly reduced, and the number of dispersed virus particles and the stability of the virus particles can be significantly improved (e.g., enhanced).

This invention relates to a zebrafish model, its establishment method, and its applications, relating to the biomedical field. The establishment method includes the following steps: injecting zebrafish with polyinosinic-polycytidylic acid (poly I:C), resuscitating, and culturing. This method can obtain a stable zebrafish model that can simulate an inflammatory state similar to that in humans following viral infection. This model can be used to assess whether antiviral drugs inhibit viral activity and the differences in efficacy among different antiviral drugs, thereby enabling preliminary screening of antiviral drugs.

The invention relates to the technical field of gene engineering, in particular to a novel calreticulin-carrying oncolytic adenovirus as well as application and a preparation method thereof. In the oncolytic adenovirus, a plasmid skeleton of a recombinant plasmid is type-5 adenovirus, and a nucleotide sequence of an E3 region of the plasmid skeleton has Gp19k fragment deletion; the recombinant plasmid comprises a CMV promoter and a nucleotide sequence used for coding calreticulin, the CMV promoter and the nucleotide sequence used for coding calreticulin are located at the deletion position of a Gp19k fragment, and the CMV promoter and the nucleotide sequence used for coding calreticulin are introduced into the deletion position of the Gp19k fragment of the type 5 adenovirus. The oncolytic virus can be normally replicated, calreticulin overexpression is realized under the condition that the virus activity is ensured, and the method has a good effect on various cancer cells, and can become an effective means for a'general cancer species' therapy.

The invention discloses a nucleoside antiviral NHC diester prodrug as shown in a formula I and pharmaceutically acceptable salts thereof, and a preparation method and medical application of the nucleoside antiviral NHC diester prodrug. Pharmacological experiments prove that the compound disclosed by the invention has relatively strong inhibitory activity on replication of multiple RNA viruses. Particularly, the compound has good lung microsome release efficiency, the species difference of the lung release efficiency is small, the consistency of the in-vivo drug effect of the antiviral drug and the in-vivo drug effect of the antiviral drug can be improved, and the risk of species difference of prodrug release antiviral active ingredients is avoided. Therefore, the compound provided by the invention has good broad-spectrum antiviral activity, and can be used as a broad-spectrum antiviral drug for treating various respiratory virus infections.

The invention relates to application of a compound in preparation of a medicine for treating related diseases and / or symptoms caused by new coronavirus infection. The compound has efficient activity of inhibiting new coronavirus infection in vivo and in vitro, and is low in cytotoxicity. Meanwhile, as a host AXL receptor inhibitor, the SARS-CoV-2 inhibitor blocks the binding site of the SARS-CoV-2 and the receptor AXL of the SARS-CoV-2, and as an interferon inducer, the SARS-CoV-2 inhibitor can strongly up-regulate the expression of I-type interferon, and double-targeting host receptor and interferon pathway can exert strong anti-neocoronavirus activity. Therefore, the compound disclosed by the invention is based on a novel anti-new coronavirus double-targeting strategy of blocking AXL receptor effect and up-regulating interferon response, is relatively safe to host cells, and can be used for preventing and treating new coronavirus infection.

The invention discloses a compound as shown in a formula 1 and pharmaceutically acceptable salts thereof, and discloses a preparation method and application thereof. The compound as shown in the formula 1 in the figure 2 and the pharmaceutically acceptable salt thereof can be used for preparing antiviral drugs or drugs for treating dengue fever. The compound as shown in the formula 1 provided by the invention has good anti-dengue virus activity and low cytotoxicity, DENV1-4 can be remarkably inhibited at the concentration of 1 mu M, especially EC50 of cellular level anti-DENV-2 can reach 2.12 nM, and stronger antiviral activity is shown. In addition, the CC50 of the compound 1 is greater than 200 [mu] M, and the toxicity to host cells is lower. The compound 1 provided by the invention has higher safety and treatment window, has potential to be used for preparing anti-dengue virus drugs, and has great popularization and application values.

The invention relates to an anti-influenza compound as well as a preparation method and application thereof, and the anti-influenza compound has a structure as shown in formula (I): (I) wherein X1 is CR3 or N; x2 is CR4 or N; z is CR5 or N; y1 is CR6 or N; y2 is CR7 or N; y3 is CR8 or N; w is-NH-or-N = CH-; in the formula, R1 is-R < 9 >-COO < 10 >,-(CR < 122 >) < n >-R < 11 >-(CR < 122 >) < n >-O-H,-(CR < 122 >) < m >-O-H,-(CR < 122 >) < h >-COO < 10 > or-R < 11 >-CONR < 13 >-R < 14 >. The compound provided by the invention has strong inhibitory activity on influenza virus, and is subjected to in-vivo antiviral activity test, action mechanism analysis and pharmacokinetic characteristic evaluation at the same time.

The invention provides an application of Akti-1 / 2 in preparation of an anti-new coronavirus drug. And the new coronavirus is SARS-CoV-2 (Sarcabose Region The chemical name of the Akti-1 / 2 is 1, 3-dihydro-1-[1-[4-(6-phenyl-1H-imidazo [4, 5-g] quinoxaline-7-yl) phenylmethyl]-4-piperidinyl]-2H-benzimidazole-2-ketone, in-vitro Vero cell infection model research shows that the Akti-1 / 2 can inhibit replication of an original strain of the new coronavirus (SARS-CoV-2), and the activity of resisting the new coronavirus is achieved. In a Vero cell infection model, the IC50 (half maximal inhibitory concentration) of the SARS-CoV-2 original strain is 0.039 [mu] M. Therefore, the Akti-1 / 2 can be used for research and development of anti-new coronavirus infection drugs, and has a good development prospect.

To provide, in particular, a method of producing an immunogenic composition exhibiting reduced virucidal activity, as well as the immunogenic composition and uses thereof.SOLUTION: The method in particular comprises the steps of: (a) providing a mixture with a first liquid and a recombinant protein, (b) concentrating the recombinant protein in the mixture by removing a portion of the first liquid from the mixture, and (c) processing the solution resulting from step (b) by continuous diafiltration.SELECTED DRAWING: Figure 1

An ink comprises (i) a carrier; (ii) graphene and / or graphene oxide particles dispersed in the carrier; and (iii) a viral active and / or anti-microbial component adhered to the graphene and / or graphene oxide particles.

This device for outputting a virus action suppressing component carries out: a step for detecting the humidity in a space when an active ingredient composed of a virus action suppressing component is outputted into the space; a step for determining whether the humidity in the space is at least a first set value; and a step, if the humidity in the space is at least the first set value, for increasing the amount of the active ingredient outputted into the space more than in the case where the humidity in the space is less than the first set value. This configuration makes it possible to increase the virus action suppressing effect when the humidity is high.

An object of the present invention is to provide a compound having significantly higher antiviral activity than iHA100, an intermediate for producing the compound, a drug containing the highly active compound, etc. A solution of the present invention is a hemagglutinin-binding peptide, a pharmaceutically acceptable salt thereof, or a solvate thereof, wherein the hemagglutinin-binding peptide relates to: (1) a polypeptide composed of the amino acid sequence shown in SEQ ID NO: 1 or 2: Trp-Thr-MeGly-Asp-MePhe-MePhe-Ala-MeAla-His-Tyr-Thr-Val-hydPro-Ala-Cys (SEQ ID NO: 1), Trp-Thr-MeGly-Asp-MePhe-MePhe-Ala-MeAla-His-Tyr-Thr-Val-hydPro-Ala-Cys-Lys (SEQ ID NO: 2), etc.

The invention discloses a heterocyclic compound shown as a formula (I) or a formula (IIa) or a stereoisomer and a medicinal salt thereof, and a pharmaceutical composition containing the formula (I) or the formula (IIa). The compound disclosed by the invention has remarkable anti-HSV virus activity and physicochemical properties of a long-acting compound, and can be used for preparing a drug of a virus HSV inhibitor or a pharmaceutical composition containing the drug and the like.

The invention discloses a nucleoside compound and application thereof, and mainly relates to a nucleoside compound as shown in a formula (I) or various prodrugs, stereoisomers, pharmaceutically acceptable salts and racemic compounds of the nucleoside compound, a pharmaceutical composition containing the formula (I) and application of the nucleoside compound or the prodrugs, the stereoisomers, the pharmaceutically acceptable salts and the racemic compounds in preparation of drugs for preventing and / or treating RNA virus infection. Furthermore, the compound disclosed by the invention has remarkable broad-spectrum anti-RNA virus activity, overcomes the instability of a raw medicine in water, has a good patent medicine prospect and good oral bioavailability, and can be used for preparing a medicine of a virus RNA dependent RNA polymerase inhibitor or a medicine composition containing the medicine and the like.

Described herein are compositions, uses thereof, and methods for treating a viral infection in a host cell or organism infected by the virus, such as coronaviruses (e.g., severe acute respiratory syndrome coronavirus [SARS-CoV], severe acute respiratory syndrome coronavirus 2 [SARS-CoV-2, the virus and its mutant forms that cause COVID-19], Middle East respiratory syndrome coronavirus [MERS-CoV]), Zika virus, Lassa virus, Crimean Congo hemorrhagic fever virus, hepatitis E virus, and other RNA viruses. Also described herein are synthetic rocaglate compositions, uses thereof, and methods for reducing or inhibiting translation initiation of a messenger ribonucleic acid (mRNA) of a virus in a host cell or organism infected by the virus.

The invention discloses a co-expression and antiviral activity analysis method of CH25H-IFITM3-ISG15. The method comprises the following steps: selecting HEK-293T, HEK-293, BHK-21, a VSV-GFP virus, an H3N2 subtype influenza virus and a pCK carrier, and preserving the selected HEK-293T, HEK-293, BHK-21, the VSV-GFP virus, the H3N2 subtype influenza virus and the pCK carrier; a recombinant plasmid pCK-CII is obtained; the method comprises the following steps: carrying out DNA (deoxyribonucleic acid) sequencing analysis, cell transfection and collection, Western blot analysis on pCK-CII expression, and pCK-CII anti-VSV-GFP and H3N2 subtype influenza virus activity experiments. According to the invention, the in-vitro anti-VSV-GFP and H3N2 subtype influenza virus activity on different source cells is preliminarily verified, a reference is provided for further research on the antiviral activity of a host limiting factor on other viruses, and a new idea is provided for research and development of broad-spectrum antiviral drugs.

Described herein are compositions, uses thereof, and methods for treating a viral infection in a host cell or organism infected by the virus, such as coronaviruses, Zika virus, Lassa virus, Crimean Congo hemorrhagic fever virus, hepatitis E virus, and other RNA viruses. Also described herein are synthetic rocaglate compositions, uses thereof, and methods for reducing or inhibiting translation initiation of a messenger ribonucleic acid (mRNA) of a virus in a host cell or organism infected by the virus.

The invention relates to the technical field of biological medicine, in particular to application of geldanamycin in preparation of a medicine for preventing and treating Newcastle disease virus. The compound with antifungal activity is obtained by separating, purifying and identifying the active substances of the strain, and is further verified to be geldanamycin. Through intracellular and extracellular combined experiment verification, the specific antiviral activity of the drug geldanamycin on the Newcastle disease virus is defined, and the geldanamycin can inhibit protein expression of the Newcastle disease virus, inhibit virions from being adsorbed to cells and directly inactivate the Newcastle disease virions; meanwhile, the geldanamycin can also up-regulate expression of an antiviral interferon gene in a cell, so that an all-around antiviral effect is realized.

The embodiment of the invention discloses a method and a kit for rapidly and accurately quantifying an active lentiviral vector. The method comprises the following steps: treating a lentiviral vector sample by using a treating fluid to obtain a pretreated sample; carrying out first fluorescence labeling on the sample by using specific dye labeled lentiviral vector nucleic acid; performing second fluorescence labeling on the sample by using a specific protein antibody or aptamer; detecting fluorescence signals of the particles in the sample by using a flow cytometer; and counting the number of the particles jointly marked by the first fluorescence and the second fluorescence in the sample so as to calculate the number of the active lentiviral vectors. According to the quantitative method for the activity of the lentiviral vector, accurate qualitative and quantitative detection is carried out on the active lentiviral vector; the method can distinguish the complete lentiviral vector from other empty-shell viruses, free nucleic acids and the like, has the characteristics of accurate virus activity characterization and short measurement time, and can complete all detection within 1 hour.

The invention discloses a phoebe zhennan water-soluble extract as well as an extraction method and application thereof, and belongs to the technical field of medicine extraction. The method comprises the following steps: S1, crushing a phoebe zhennan raw material, adding 6 times of water, extracting twice, 1 hour each time, and combining filtrates; s2, concentrating the filtrate obtained in the step S1 under reduced pressure until the volume is 1: 1, standing at low temperature, and taking supernate; and S3, centrifuging the supernate obtained in S2, discarding the precipitate, concentrating under reduced pressure, and drying at low temperature to obtain the phoebe zhennan water-soluble extract. The invention discloses a phoebe zhennan water-soluble extract and an extraction method and application thereof. The phoebe zhennan water-soluble extract has efficient broad-spectrum antiviral activity and can effectively inhibit respiratory virus activity.