34 results about "WAS PROTEIN" patented technology

The present invention is in the field of recombinant protein, in particular protein, such as antibody, manufacturing.

Methods for determining a representation of a protein complex, given a constituent target complex of that protein complex are presented; where the constituent target complex is a single entity constituent or subcomplex of the protein complex; and wherein a protein complex is a complex of some combination of one or more of proteins, nucleic acids, metal ions, and small molecules. A recursive neural network is devised, wherein for each iteration of the recursion, a representation of the output constituent of the protein complex together with the input constituent target complex is passed into the neural network as input for the next iteration. Some embodiments of the invention include design and manufacturing of effective synthetic biologic drugs, monoclonal antibody (mAb) drug, Antibody Drug Conjugate (ADC), peptide ligand drug, and small molecule drugs (SMDs).

The present invention provides a method of transpeptidation, a transpeptidation product obtainable from the method, and a chimeric fusion polypeptide. An exemplary method of transpeptidation includes linking a donor substrate to a recipient protein or peptide using a transpeptidase, where the donor substrate is a protein, peptide, amino acid amide, or amino acid ester, and where the linking reaction produces a linking product and a by-product as a substrate for the transpeptidase; and cleaving one or more amino acids from the end of the by-product using an exopeptidase such that the truncated by-product is not a substrate for the transpeptidase, thereby moving the reaction equilibrium of the transpeptidation reaction to the ligation product.

The present disclosure relates to plant-based ingredients, particularly protein ingredients, that are suitable for use as processing intermediates in a variety of alternative consumable applications, including vegetarian or vegan analogs, and methods of making the same. The plant-based ingredients have desirable organoleptic properties that result from reduced saponin content in the plants or plant parts from which they are obtained. The present disclosure includes ingredients and products made by using such plants and plant parts, as well as related methods and compositions associated therewith.

The utility model discloses an online ultrafiltration permeate liquid protein leakage monitoring system belongs to the biopharmaceutical technical field. The system includes ultrafilter, nondestructive protein concentration detection subassembly and alarm component, be equipped with drainage pipe on the ultrafilter, nondestructive protein concentration detection subassembly is established on the drainage pipe, the alarm component is electrically connected with nondestructive protein concentration detection subassembly through the controller. Through nondestructive protein concentration detection subassembly real -time, nondestructive monitoring the protein concentration of filtrate in drainage pipe, and will relevant protein concentration signal transmission to controller, when there is protein leakage, the controller controls the alarm component and sends the alarm. Realized real -time protein concentration monitoring to filtrate, can in time, accurate discovery protein leakage, realizes nondestructive protein concentration monitoring to filtrate simultaneously, avoids causing product loss, ensures product yield, no longer uses trichloroacetic acid and detects protein concentration, significantly reduced the biopharmaceutical workshop pollution risk.

The invention discloses a light-controlled protein loading and releasing platform based on bent nanowires and a preparation method and application thereof. The preparation method comprises five steps of mask preparation, bent nanowire preparation, amination treatment, photo-acid modification and antibody attachment. The platform uses the bent nanowire as the substrate, has the characteristics of high specific surface area, nano confinement effect and high absorptivity, and can obviously improve the maximum capacity, so that the platform is easy to absorb both low-abundance protein and high-abundance protein. Furthermore, due to the fact that the target biomolecule is protein, by means of the principle that specific adsorption of the target biomolecule is sensitive to the pH value of the environment, a reversible photoacid molecule is used as a light-operated gate in the preparation method, the local pH value is adjusted to control specific adsorption and dissociation of the protein and the antibody, and the specific adsorption and dissociation of the protein and the antibody are controlled. And due to the high absorptivity of the bent nanowires, the bent nanowires can be dissociated in an extremely short time, and the local pH value is reduced, so that the protein is quickly released.

Described herein are protein-drug conjugates and compositions thereof that are useful, for example, for target-specific delivery of therapeutic moieties, e.g., camptothecin analogs and / or derivatives. In certain embodiments, provided are specific and efficient methods for producing protein-drug constructs (e.g., antibody-drug conjugates) utilizing a combination of transglutaminase and 1,3-cycloaddition techniques. Camptothecin analogs, antibody-drug conjugates, and compositions which comprise glutaminyl-modified antibodies and camptothecin analog payloads and are provided.

Described herein are protein-payload conjugates and compositions thereof that are useful, for example, for target-specific delivery of therapeutic and / or imaging agent moieties. In certain embodiments, provided are specific and efficient methods for producing protein-payload constructs (e.g., antibody-drug conjugates) utilizing a combination of transglutaminase and Diels-Alder techniques. Antibody-drug conjugates and compositions which comprise glutaminyl-modified antibodies, Diels-Alder adducts, and reactive payloads and are provided.

Provided herein are proteins that inhibit both the metalloprotease activity and disintegrin activity of human ADAM8, wherein the protein comprises an antigen-binding domain that: (i) binds specifically to human ADAM8; and (ii) binds to an epitope within human ADAM8 that includes at least one amino acid within the sequence of SEQ ID NO: 1, nucleic acids, vectors, compositions, and methods of use thereof (e.g., methods of treatment and methods of diagnosing).

The application discloses a hydroxylase and application thereof in synthesis of 14-deoxoandrographolide. The hydroxylase is protein CYP72A399, and the amino acid sequence of the protein CYP72A399 is shown as SEQ ID No: 2. Experiments prove that the protein CYP72A399 can be used as a hydroxylase to catalyze new andrographolide aglycone to generate 14-deoxoandrographolide. Therefore, the protein CYP72A399 has important theoretical and practical significance for synthesis of 14-deoxoandrographolide and cultivation of high-quality andrographis paniculata. The application has important application value.

Methods, compositions, kits, and systems are provided for identifying protein-binding regions in genomic DNA. The method may include contacting genomic DNA with an adenine methyltransferase (A-MTase), wherein the A-MTase methylates adenine residues in a region of the genomic DNA that is not protein-binding; and performing single-molecule long-read sequencing on the contacted genomic DNA to detect locations in the genomic DNA lacking methylated adenine residues, thereby identifying regions in the genomic DNA that are protein-binding. The bound region may be a nucleosome location, and the method can determine the nucleosome location in the genomic DNA. A method is also provided for visualizing chromatin regions that are not protein-binding and spatially serve as substrates for the A-MTase within the cell by visualizing the location of methylated adenine after contacting the cell with the adenine methyltransferase (A-MTase).

The present disclosure relates a conjugate having the structure (I): or a pharmaceutically acceptable salt or solvate thereof, wherein: RBM is a receptor binding molecule; L is a linker bound to RBM and M; E is a spacer; W is a moiety which, after cleavage of the group Z is capable of forming a ring together with the spacer E, Y1 and the phosphorus; Z is a cleavable group; HC is a molecule comprising a 4 to 20 membered heterocyclic ring comprising the groups LE, PBL, XE1 and RE1, LE is a linker bound to the 4 to 20 membered heterocyclic ring and to PBL, or LE is a linker bound to PBL and RE1; PBL is a protein binding ligand and n is an integer ranging from 1 to 20. The conjugates are useful in the treatment of cancer.

This invention discloses an AI-2 quenching enzyme and its application. The AI-2 quenching enzyme is protein QQ-5, with the amino acid sequence shown in SEQ ID NO:1. Experiments have demonstrated that protein QQ-5 possesses AI-2 quenching enzyme activity, which can significantly improve the disease resistance of aquatic animals to Vibrio, manifested in effectively increasing the survival rate of aquatic animals infected with Vibrio and delaying the time to death. Therefore, protein QQ-5 plays an important role in the control of AI-2 family signaling-mediated pathogenic bacteria in aquatic animals. This invention has significant application value.

Provided herein are protein-like polymers for tuning tau activity. In aspects, provided herein are protein-like polymers for inhibiting tau fibril propagation in a subject.

The application provides a method for rapidly identifying salt tolerance of vegetables based on CaLEA-Dc3 expression products, and belongs to the field of agricultural biotechnology, and comprises the following steps: screening vegetable materials with consistent growth states into a control group and a salt stress treatment group, applying clean water to the control group, and applying a salt solution to the salt stress treatment group; taking CaLEA-Dc3 expression products as a detection target; when the CaLEA-Dc3 expression products are mRNA generated by transcription of a CaLEA-Dc3 gene, qRT-PCR is used for detection; when the CaLEA-Dc3 expression products are proteins generated by translation of the CaLEA-Dc3 gene, ELISA is used for detection; and the repeatability of the detection results is verified. The application ensures data reliability through a standardized experimental process, i.e., specific primer design, antibody verification and repeated verification, overcomes the lag and subjectivity of traditional phenotype observation, provides a quantifiable scientific classification basis, realizes complementary verification at the transcription and translation levels through multiple verifications, avoids errors of single detection, ensures the reliability of salt tolerance evaluation results, and significantly improves the efficiency and accuracy of vegetable salt tolerance identification.

To provide a protein having excellent methane or butane oxidation ability, a microorganism expressing the protein, a composition for producing methanol or butanol containing the protein or the microorganism, and a method for producing methanol or butanol using the protein or the microorganism.SOLUTION: To provide a protein in which ferritin monomers fused with an ammonia oxidase activity domain having methane oxidation activity are self-assembled. The ammonia oxidase active domains are proteins selected from amoB1 and amoB2, each consisting of a unique amino acid sequence.SELECTED DRAWING: Figure 5

Provided herein are protein molecules that specifically bind PD-L1 and also exhibit activatable specific CD89 binding in diseased tissues. Further provided herein are uses of such protein molecules to treat cancer.

Provided are proteins and peptides suitable for binding lanthanide ions and / or actinide ions. Proteins of the present disclosure may contain or be one of the following sequences: DDKAACAX1GIAAVKAX2VEKLAPEAVPQKLKRALKIAEREQGEGX 3FX4X5CLX6ALX7DAKRALPKX8X9 (SEQ ID NO:1) or MMRTRTSLAVPRGFRGSALLADDKAACAX1GIAAVKAX2VEKLA-PEAVPQKLKRALKIAEREQGEGX3FX4X5CLX6ALX7DAKRALPKX8X9 (SEQ ID NO:52), where X1 is D or S; X2 is R or K; X3 is E, Q, or M; X4 is D, N, Q, or K; X5 E, N, Q, D, A, or T; X6 is E, A, or Q; X7 is D or E; X8 is Y, W, or absent; and X9 is G or absent, or a protein having at least 70% identity to SEQ ID NO:1 or 52. Proteins or peptides of the present disclosure may contain a metal-binding motif or be REX1X2EX3EX4DEC (SEQ ID NO:53), where X1 is any amino acid; X2 is any amino acid, (e.g., G, A, K, R); X3 is any amino acid, (e.g., G, A, or K); and X4 is F or Y; and the C forms a disulfide bond with another cysteine residue elsewhere in the peptide. Also provided are methods of using any one of the proteins or peptides, methods of making any one of the proteins or peptides, and kits.

Provided are proteins and protein-based sensors for detecting MnII. The proteins may have the following sequence: Z1-MPTTTTKVDIAAFDPDKDGTIHLKDALAAGSAAFDKLDPD-KDGTLHAKDLKGRVSEADLKKLDPDX1DGTLHKKDYLAAVEAQFKAAX2PDNDGTIX3ARX4LASPAGSALVNLIR-X5-Z2 (SEQ ID NO:1), where Z1 and Z2 correspond to a FRET pair, X1 is N or G, X2 is N or D, X3 is D or H, X4 is E or D, and X5 is optional and is the sequence GSGC (SEQ ID NO:40) and when X5 is present, then Z1 and Z2 are absent. Z1 and Z2 are optional. Also provided are methods of using the proteins to detect and separate MnII. Also provided are compositions, kits, and devices.

The invention belongs to the technical field of molecular diagnosis and immunotherapy, and particularly relates to a group of biomarkers and application thereof in diagnosis of immune-mediated necrotizing myopathy. The invention firstly provides a group of biomarkers for predicting, treating or diagnosing immune-mediated necrotizing myopathy, and the biomarkers are protein markers, and comprise one or a combination of more than two markers selected from CSRP3, HSP90AB1, MYH1, ITGB1BP2, SMPX, MYBPC2, CD9, ICAM1, ANKRD1 and NT5C1A. The invention also provides application of the marker in preparation of a product for predicting, treating or diagnosing immune-mediated necrotizing myopathy. Through muscle proteomics analysis, a unique and shared way in anti-SRP and anti-HMGCR myopathy is disclosed, and it is determined that HSP90AB1, ITGB1BP2, CD9, ICAM1 and ANKRD1 are potential biomarkers for the severity of IMNM diseases. These findings provide valuable insights for the determination of pathogenesis and therapeutic targets of IMNM.

Provided herein are protein complexes comprising lipid nanoparticles and bispecific antibody constructs, wherein the lipid nanoparticles comprise a cargo. Also provided are protein complexes comprising lipid nanoparticles, bispecific antibody constructs, and antibodies, wherein the lipid nanoparticles comprise a cargo. The protein complexes disclosed herein are useful, for example, for delivering the cargo to a cell or a tissue of interest.

Provided herein are proteins that include a Vascular Endothelial Growth Factor A (VEGF-A) protein binding domain; proteins that include an Epstein-Barr Virus BCL-2 homolog (BHRF1) protein binding domain; proteins that include a Severe Acute Respiratory Syndrome coronavirus (SARS-CoV-2) RBD protein binding domain; proteins that include an Interleukin-7 receptor subunit alpha (IL7R-α) protein binding domain; proteins that include a Programmed death-ligand 1 (PD-L1) protein binding domain; proteins that include a Tropomyosin-receptor kinase A (Trk-A) protein binding domain; and proteins that include an Interleukin-17 (IL-17A) protein binding domain.

Provided herein are protein molecules that specifically bind to PD-L1 and also exhibit activatable specific CD89 binding in diseased tissue. Further provided herein are uses of such protein molecules for the treatment of cancer.

Described herein are protein steroid conjugates that are useful, for example, for the target-specific delivery of glucocorticoids (GCs) to cells.

The invention provides a method for detecting antibody titer. The detection method comprises the following steps: loading a standard protein sample to an affinity chromatography column, carrying out ultraviolet detection on an elution product of the standard protein while eluting to obtain a standard protein elution curve, and establishing a standard curve of peak area and titer of the elution curve of the standard protein; loading a to-be-detected sample on the affinity chromatography column, performing ultraviolet detection on an elution product of the to-be-detected sample while eluting, and obtaining the antibody titer of the to-be-detected sample by utilizing the standard curve and the elution curve peak area of the to-be-detected sample; wherein the filler of the affinity chromatography column is protein A, a mobile phase A and a mobile phase B are used for elution, and both the mobile phase A and the mobile phase B contain arginine. The mobile phase containing arginine is used for elution of protein A affinity chromatography, the arginine can influence the surface tension of protein or the solubility of amino acid, and the sensitivity and accuracy of antibody titer detection are improved by influencing the hydrophobicity of a sample.

Provided herein are protein molecules that specifically bind to PD-L1 and also exhibit activatable specific CD28 binding in diseased tissue. Further provided herein are uses of such protein molecules for the treatment of cancer.

Provided are proteins capable of modifying 5' ends of RNA polynucleotides. The RNA polynucleotides are modified such that all or a portion of a 5' protecting group is removed by the protein. Methods of using the proteins to modify RNA polynucleotides, and kits containing the modified proteins are also provided.

Provided herein are protein molecules that specifically bind PD-L1 and also exhibit activatable specific CD28 binding in diseased tissues. Further provided herein are uses of such protein molecules to treat cancer.

This disclosure provides a composition comprising i) a pseudotyped retroviral vector particle or virus-like particle thereof comprising a) one envelope protein with antigen-binding activity, wherein said envelope protein is a recombinant protein that does not interact with at least one of its native receptor(s) and is fused at its ectodomain to a polypeptide comprising an antigen binding domain specific for a tag of a tagged polypeptide, and wherein said envelope protein is protein G, HN or H derived from the Paramyxoviridae family, and b) one envelope protein with fusion activity derived from the Paramyxoviridae family, and ii) said tagged polypeptide, wherein said tagged polypeptide binds specifically to an antigen expressed on the surface of a target cell, thereby transducing the target cell with said retroviral vector particle or thereby inducing uptake of the virus-like particle into the target cell. A pharmaceutical composition thereof and an in vitro method for transduction of targets cells with said vector particle are also disclosed.