Application of fusarium graminearum pathogenic factor in wheat disease resistance breeding

Abstract

The invention belongs to the technical field of gene engineering, and relates to application of fusarium graminearum pathogenic factors in wheat disease resistance breeding. The invention provides a fusarium graminearum pathogenic factor gene combination. The fusarium graminearum pathogenic factor gene combination is composed of an FSE1 gene, an FSE2 gene, an FSE3 gene and an FSE4 gene, the FSE1 gene, the FSE2 gene, the FSE3 gene and the FSE4 gene are silenced at the same time or the expression levels of the FSE1 gene, the FSE2 gene, the FSE3 gene and the FSE4 gene are reduced at the same time, and the pathogenicity of fusarium graminearum can be effectively reduced. The invention constructs a recombinant vector, the recombinant vector targets the fusarium graminearum pathogenic factor gene combination, and after the recombinant vector is introduced into a plant, the expression levels of the FSE1 gene, the FSE2 gene, the FSE3 gene and the FSE4 gene after the plant is infected by fusarium graminearum can be effectively reduced, the disease resistance of the plant to gibberellic disease is improved, and the fusarium graminearum pathogenic factor gene combination is improved. And the main agronomic traits of the plant are not influenced.

Description

Technical Field

[0001] This invention belongs to the field of genetic engineering technology and relates to the application of Fusarium graminearum pathogenic factors in wheat disease resistance breeding. Background Technology

[0002] Fusarium graminearum, also known as the graminearum fungus, is a parasitic fungus belonging to the Poaceae family and other plants, and can also grow saprophytically in soil. It is an important fungal pathogen of grain crops, causing various diseases such as wheat scab and corn stalk rot, which negatively impact crop yield and quality to varying degrees. Crops infected with Fusarium graminearum contain certain amounts of secondary metabolites, such as triazolidinediones and fusarium ketones, which have toxicity and carcinogenicity, adversely affecting the quality of agricultural products and food safety.

[0003] Under favorable weather conditions, agricultural measures are often insufficient to completely control agricultural diseases caused by Fusarium graminearum. Chemical control is currently the main means of controlling diseases related to Fusarium graminearum, such as wheat scab and corn stalk rot. However, chemical control may cause mild phytotoxicity (stunting) due to excessively high concentrations or extreme weather conditions. Long-term use of a single type of pesticide (such as carbendazim or some triazoles) can lead to pesticide resistance in the pathogen, reducing its effectiveness. Chemical pesticides also pose potential risks to non-target organisms (such as bees, natural enemy insects, and aquatic organisms). Therefore, exploring control strategies that reduce the pathogenicity of Fusarium graminearum and block its infection process has become a research focus. The effective implementation of this strategy urgently requires the systematic mining and identification of key pathogenic genes in Fusarium graminearum to provide a theoretical basis and genetic resources for its precise control.

[0004] In recent years, the role of small RNAs in plant-pathogen interactions has received increasing attention, especially the regulatory mechanisms of cross-species RNAs, which have become a research hotspot. Based on this mechanism, researchers have developed cross-species RNA interference technologies, including spray-induced gene silencing (SIGS) and host-induced gene silencing (HIGS). Inhibition through HIGS and SIGS... CHS3b , FgPP1 , FgSGE1 , FgSTE12 and CYP51 Gene expression can enhance wheat resistance to Fusarium head blight. However, research targeting the genes encoding pathogenic secretory proteins has not yet been reported. Therefore, systematically identifying the genes encoding key pathogenic secretory proteins and using them as RNAi silencing targets is of great significance for developing Fusarium head blight control technologies and creating disease-resistant gramineous crops as germplasm. Summary of the Invention

[0005] The purpose of this invention is to discover resistance genes against Fusarium graminearum in grasses and to cultivate stable resistant varieties. To this end, this invention provides the application of Fusarium graminearum pathogenic factors in wheat disease resistance breeding to address this need in the field.

[0006] On one hand, this invention relates to a gene combination of pathogenic factors of Fusarium graminearum, wherein the gene combination of pathogenic factors of Fusarium graminearum consists of... FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Genetic composition; The FSE1 The gene encodes the FSE1 protein, the amino acid sequence of which is shown in SEQ ID NO: 1; The FSE2 The gene encodes the FSE2 protein, the amino acid sequence of which is shown in SEQ ID NO: 2; The FSE3 The gene encodes the FSE3 protein, the amino acid sequence of which is shown in SEQ ID NO: 3; The FSE4 The gene encodes the FSE4 protein, the amino acid sequence of which is shown in SEQ ID NO: 4; Simultaneous silence FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Genes, or simultaneously reduced FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 The gene expression level can effectively reduce the pathogenicity of Fusarium graminearum.

[0007] SEQ ID NO: 1 is as follows, MHSFNILLSSSLFALTQAHSVILGAQGLDSSPNSVGFQVDPEIARNCITINPCQQDATIIRDAEITANIVNQCGRTEISGNIDVGENTENAIAAKQVTQVEAGGELTVTIHQVNADGAGPYVCDLDESSNTNTNIQNLTVTNNIPGTNGLSQAKTQAFNITVKMPDDLNCFGASTGNICTVRCRNNALAGPFGGCFAVQQAD TDKKTNTPQNIKTTQTLNGINAQILQNQKDFEDSVAANENATSDEAAQNKAAVDALLGATVVTSAFATETPTVDLGRPPVATPDPNEGKDGQAGDNNGGNNGGNNGGNNGGNNGGNNGGGNGGNNGGNNGGGNGGQGNNGQGGQGNNQGGNGGNGGNRGGNRGGNGGNPFGGNGGNPFAGGNGQKAKRGFSIRRMSKRTVF。

[0008] SEQ ID NO: 2 MFSTLFFSALAFSYSVQAHGTITRVIGANGVVMPGLTIRDGTPRSSSTSAASGAQVDTSVIRDPELGTKKSSALGRTSKGPVDATHVIKIFMHGIKGRSVADDILGGGEEAVREAASFVTGNAGAVVNESEHTANGLLHDFFQGAKGVPSPRGYIEDGLDKFAGVGAKTGLPTTASDGTLKLIYHQVNEDGAGPLMVDVDFTSGGTDPSAFKSVEVVHNIIGVLGFSTVSSTDFPVVVKVPAGKVCSGKVAGMSGVCIARVRNSATAGPFGGAAAFTHSPITSTGKKPSAKFRNRHI.

[0009] SEQ ID NO:3 as follows, MAPIKNLVWALFVAADLAAAHSVITNAVGDAGGSGMALGVDTSTPRDGTRRRPFQTDATRFRGASADTVGETLAGGDNQVEQGTADIMEETGDQLPQVNPGGSLEMTVHQVNSDGAGPYTCMINADGTGTSWENIPVTTNVEGNDRGR NRDGEMGDFPLVASIPAGQTCTGTVAGEDNVCLVRCQNPARAGPFGGVIPVQMAQTNNAGNGTETDAGNATETGAGNAVETGAGNNAGNAGNNAGNTAGNTAGNNAGNNAGNNADDEEDAEEEDETTTGTGNNRNNRNNRRATRFFA.

[0010] SEQ ID NO: 4 is as follows, MHFYALIPAFITAVSAHGVVISVEGANGVSMPGLSIADGTPRDCSSNGCGSQADTAIIRDRELGTSEASALGRTQGNGPVDASVMIANFLGTSGSNNVPTNNGSDSGVGVEDDLSGLNRGGRNNNRKQRRQLGNLLGGLFGGGRG GGNGEKADKPNESSVAATAGEGATSDRQINQDGAGPMRADIDATSGGTDPDAFKSAEVTNDVPGVGFGGLSLATNTDFPLTVKMPQGMTCEGTVGGANNVCIVRVRNSAAAGPFGGSGAFTQSASARKRAIAFRLKKRMQIVRN.

[0011] Furthermore, in the Fusarium graminearum pathogenic factor gene combination provided by the present invention, the... FSE1 The nucleotide sequence of the gene is shown in SEQ ID NO: 5; The FSE2 The nucleotide sequence of the gene is shown in SEQ ID NO: 6; The FSE3 The nucleotide sequence of the gene is shown in SEQ ID NO: 7; The FSE4 The nucleotide sequence of the gene is shown in SEQ ID NO: 8.

[0012] SEQ ID NO: 5 is as follows,

[0013] SEQ ID NO: 6 is as follows, ATGTTCAGCACGTTGTTCTTTTCTGCCCTGGCCTTCAGCTATTCGGTACAAGCTCATGGAACCATCACAAGAGTGATTGGTGCCAACGGCGTCGTTATGCCTGGGCTCACTATACGCGACGGAACCCCTCGATCATCTACCTCTGCTGCTTCTGGGGCACAGGTAGATACCAGCGTCATCCGCGACCCGGAACTTGGTACCAAGAAGTCATCGGCCCTCGGTCGCACCAGCAAAGGTCCAGTCGACGCCACTCATGTTATCAAAATATTCATGCATGGTATCAAGGGCCGATCTGTTGCTGATGATATTCTCGGGGGTGGAGAGGAAGCGGTGAGAGAAGCTGCGTCCTTTGTTACTGGCAACGCCGGTGCTGTCGTAAATGAATCTGAGCACACCGCCAATGGCCTTTTACATGACTTCTTCCAAGGTGCAAAGGGAGTTCCATCTCCTCGTGGATACATTGAAGACGGTCTAGATAAATTCGCTGGAGTAGGTGCTAAAACTGGGTTGCCAACCACTGCATCTGATGGAACTCTCAAGCTCATCTATCATCAGGTTAATGAGGACGGTGCTGGCCCCCTGATGGTAGACGTCGACTTCACTTCGGGAGGCACTGATCCATCAGCGTTCAAATCCGTAGAAGTGGTTCATAATATCATTGGCGTATTGGGATTTTCAACCGTAAGCTCAACTGACTTTCCGGTCGTTGTCAAAGTGCCTGCCGGTAAAGTTTGTTCCGGAAAGGTAGCCGGCATGTCTGGTGTTTGCATTGCGAGGGTGCGAAACAGTGCCACTGCTGGCCCCTTTGGCGGAGCTGCCGCCTTTACACATTCTCCTATAACTTCTACGGGAAAGAAGCCCAGCGCAAAGTTTCGTAACCGCCATATCTAG。

[0014] SEQ ID NO: 7 is as follows, ATGGCTCCCATCAAGAACCTCGTCTGGGCCCTTTTCGTCGCCGCTGACCTCGCCGCTGCTCACAGTGTCATCACCAACGCTGTCGGCGATGCTGGTGGCTCTGGCATGGCTCTCGGTGTTGACACCTCCACTCCTCGTGATGGCACCCGACGCCGTCCTTTCCAGACCGATGCTACTCGCTTCCGTGGCGCCTCCGCTGATACTGTCGGCGAGACTCTCGCTGGTGGTGACAACCAGGTTGAGCAGGGTACCGCCGACATCATGGAGGAGACAGGTGATCAGCTTCCTCAAGTCAACCCTGGTGGTAGCCTTGAGATGACTGTCCACCAAGTCAACTCTGATGGTGCTGGCCCTTACACCTGTATGATCAACGCCGATGGTACTGGTACCTCTTGGGAGAACATTCCCGTCACTACCAATGTCGAGGGCAACGACCGTGGCCGCAACCGTGATGGTGAGATGGGTGATTTCCCTCTCGTGGCCTCCATCCCTGCTGGACAGACTTGCACTGGTACAGTTGCTGGTGAAGATAACGTCTGCCTTGTTCGTTGCCAGAACCCGGCCCGTGCTGGTCCCTTCGGTGGTGTCATCCCAGTTCAGATGGCTCAGACAAACAACGCCGGCAATGGCACCGAGACAGACGCTGGTAATGCCACTGAGACAGGCGCCGGCAACGCTGTTGAGACCGGTGCTGGAAACAACGCTGGAAACGCTGGCAACAACGCCGGTAACACTGCTGGTAACACCGCTGGTAACAACGCTGGTAACAACGCTGGCAACAACGCCGACGACGAGGAAGATGCCGAAGAGGAGGACGAGACCACCACTGGCACCGGCAACAACCGCAACAACCGCAACAACCGCCGCGCCACTCGCTTCTTCGCATAA。

[0015] SEQ ID NO: 8 is as follows, .

[0016] On the other hand, the present invention relates to a recombinant vector that targets the Fusarium graminearum pathogenic factor gene combination, and the recombinant vector can simultaneously silence... FSE1 Gene, FSE2 Gene, FSE3 Genes andFSE4 Genes or simultaneously reduced FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Gene expression levels.

[0017] Furthermore, in the recombinant vector provided by the present invention, the recombinant vector is a HIGS vector, and the HIGS vector contains simultaneously targeted... FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Fragments of genes.

[0018] Furthermore, in the recombinant vector provided by the present invention, the HIGS vector comprises a fragment as shown in SEQ ID NO: 9.

[0019] SEQ ID NO: 9 is as follows,

[0020] On the other hand, the present invention relates to a recombinant Agrobacterium, which comprises the aforementioned recombinant vector.

[0021] On the other hand, the present invention relates to a method for improving the resistance of plants to Fusarium graminearum infection, comprising: introducing the recombinant vector into the plant.

[0022] On the other hand, the present invention relates to a method for improving the resistance of plants to Fusarium graminearum infection, comprising: reducing the resistance of plants to Fusarium graminearum infection after infection. FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Gene expression levels; The FSE1 The gene encodes the FSE1 protein, the amino acid sequence of which is shown in SEQ ID NO: 1; The FSE2 The gene encodes the FSE2 protein, the amino acid sequence of which is shown in SEQ ID NO: 2; The FSE3 The gene encodes the FSE3 protein, the amino acid sequence of which is shown in SEQ ID NO: 3; The FSE4 The gene encodes the FSE4 protein, the amino acid sequence of which is shown in SEQ ID NO: 4.

[0023] Furthermore, in the method for improving plant resistance to Fusarium graminearum infection provided by the present invention, the... FSE1 The nucleotide sequence of the gene is shown in SEQ ID NO: 5; The FSE2 The nucleotide sequence of the gene is shown in SEQ ID NO: 6; The FSE3 The nucleotide sequence of the gene is shown in SEQ ID NO: 7; The FSE4 The nucleotide sequence of the gene is shown in SEQ ID NO: 8.

[0024] On the other hand, the present invention relates to the gene combination of pathogenic factors of Fusarium graminearum, or the recombinant vector, or the application of the recombinant Agrobacterium in the breeding of disease-resistant wheat varieties.

[0025] Compared with the prior art, the technical solution provided by the present invention has at least the following beneficial effects or advantages: This invention is the first to systematically identify four key pathogenic secretory protein-coding genes in Fusarium graminearum. FSE1 Gene,FSE2 Gene, FSE3 Genes and FSE4 This invention proposes a multi-gene silencing strategy that simultaneously targets this gene combination, overcoming the limitations of previous single-target silencing methods, which may have limited effectiveness or be easily offset by pathogen compensation mechanisms. By carefully designing and constructing a recombinant HIGS vector capable of simultaneously silencing these four genes, and utilizing cross-border RNA interference, this invention achieves highly efficient and specific inhibition of the expression of key pathogenic genes in wheat plants infected with Fusarium graminearum. This significantly weakens the pathogen's infectivity and pathogenicity at the source, substantially enhancing the transgenic wheat's resistance to Fusarium head blight. Importantly, this host-induced gene silencing-based disease resistance is highly efficient and specific. Furthermore, rigorous verification has shown that the main agronomic traits of the transgenic wheat, such as plant height, ear length, tiller number, and grain weight, are not adversely affected, ensuring the synergy between disease resistance and high-yield traits. This solves the problem of often failing to balance disease resistance and yield traits in traditional disease-resistant breeding. Furthermore, this invention provides a genetic engineering-based biological control strategy that reduces dependence on chemical pesticides and helps avoid problems such as pesticide residues, environmental pollution, pathogen resistance development, and non-target biosafety risks. It provides a technical path and genetic resources for the green and sustainable control of wheat scab and has broad application prospects and important practical value in the breeding of disease-resistant varieties of wheat and other grasses. Attached Figure Description

[0026] To more clearly illustrate the technical solutions in the embodiments of the present invention or the prior art, the drawings used in the description of the embodiments or the prior art will be briefly introduced below. Obviously, the drawings described below are only some embodiments of the present invention. For those skilled in the art, other drawings can be obtained based on these drawings without creative effort.

[0027] Figure 1 For containing FSE A schematic diagram illustrating the construction of a gene silencing vector. This silencing vector utilizes Getway technology to... FSE The gene fragment was constructed into the PC336 vector, which contains the maize Ubi promoter.

[0028] Figure 2 This is an electrophoresis result of the transgenic wheat vector detection. In it, "M" represents the Marker; " FSE -HIGS1", FSE -HIGS2” FSE -HIGS3", FSE -HIGS4” FSE -HIGS5” FSE-HIGS6” FSE -HIGS7” FSE -HIGS8” FSE -HIGS9” FSE The "-HIGS10" sub-table represents different transgenic wheat plants, "Fielder" represents ordinary Fielder wheat plants, and "CK" represents negative control.

[0029] Figure 3 yes FSE Genes in transgenic plants infected with Fusarium graminearum FSE -HIGS7 and " FSE The relative expression level of "-HIGS8" at 3d. Here, "Fielder" refers to the common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0030] Figure 4 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE -HIGS8" phenotypic results and diseased spikelet count 14 days after inoculation with Fusarium graminearum. Among them, "Fielder" refers to ordinary Fielder wheat plants. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0031] Figure 5 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE The growth status of "-HIGS8". "Fielder" refers to the common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0032] Figure 6 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE -HIGS8 plant height statistics. "Fielder" refers to the common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0033] Figure 7 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE -HIGS8" ear length statistics. "Fielder" refers to a common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0034] Figure 8 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE -HIGS8" tiller count. "Fielder" refers to a common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors.

[0035] Figure 9 Indicates that the genetically modified plant " FSE -HIGS7 and " FSE -HIGS8" refers to the 100-grain weight statistics. "Fielder" indicates a common Fielder wheat plant. FSE -HIGS7 and " FSE "-HIGS8" indicates that it contains FSE Transgenic plants with gene silencing vectors. Detailed Implementation

[0036] The technical solution of the present invention will be described below with reference to embodiments. However, the present invention is not limited to the following embodiments. Unless otherwise specified, the experimental and detection methods described in each embodiment are conventional methods; the reagents and materials described are commercially available unless otherwise specified. Unless otherwise specified, all percentages in the following embodiments refer to mass percentages. Unless otherwise specified, all proportions in the following embodiments refer to mass ratios.

[0037] The wheat variety used in the following examples is Fielder. Information about Fielder can be found in the following literature: Bai X, Zhan G, Tian S, et al. Transcription factor BZR2 activates chitinase Cht20.2 transcription to confer resistance to wheat stripe rust[J]. Plant Physiology, 2021, 187(4): 2749-2762.

[0038] Example This embodiment provides functional verification of the FSE gene combination.

[0039] According to the pathogenic factors of Fusarium graminearum FSE1 , FSE2 , FSE3 and FSE4 Based on the gene sequences, primers with homologous arms were designed to amplify fragments of approximately 200 bp on four genes. The primer names are FSE1-HGF and FHE1-HGR, FHE2-HGF and FHE2-HGR, FHE3-HGF and FHE3-HGR, and FHE4-HGF and FHE4-HGR, and the primer sequences are as follows:

[0040] Four silent fragments were amplified using cDNA from Fusarium graminearum infection stage as a template, and then ligated into a single fragment by in vitro PCR. The PCR system and reaction are as follows:

[0041] The in vitro PCR reaction program was as follows: 95℃ pre-denaturation for 3 min, 95℃ for 30 sec, 61℃ for 2 min, 72℃ for 4 min, 15 cycles, 72℃ for 10 min, 95℃ pre-denaturation again for 3 min, 95℃ for 30 sec, 58℃ for 40 sec, 72℃ for 4 min, 35 cycles, 72℃ for 10 min, 16℃ forever.

[0042] The obtained recombinant fragment was constructed into the silencing vector pC336 using Gateway technology (Invitrogen). After successful construction, the constructed recombinant vector was transformed into Agrobacterium EHA105 strain.

[0043] Using the Fielder wheat variety as the recipient, immature wheat embryos were transformed using Agrobacterium-mediated wheat genetic transformation. After differentiation, screening, regeneration, and rooting, transgenic wheat plants were finally obtained.

[0044] The transgenic wheat plants were planted in a soil substrate, and then leaves were cut to extract DNA. The presence of the target gene fragment was detected by PCR and electrophoresis. The electrophoresis results are shown below. Figure 2 . Figure 2 As can be seen in the text, FSE -HIGS2” FSE -HIGS3", FSE -HIGS5” FSE -HIGS6” FSE- HIGS7” FSE -HIGS8” wheat plants all contain the correct carrier bands.

[0045] For the plants containing the correct bands, wheat RNA was extracted and reverse transcribed to obtain cDNA 3 days after Fusarium graminearum infection. Using cDNA as a template and FgCHS5 as an internal control gene, quantitative real-time PCR (qRT-PCR) was used to detect different plants infected with Fusarium graminearum. FSE The relative expression level of genes is used to screen for genes that... FSE Wheat plants with significantly reduced gene expression levels. Quantitative PCR was performed using Taq-HS SYBR. ® The Green qPCR Premix (iScience) was used for quantitative PCR under the following conditions: 95°C pre-denaturation for 3 min; 95°C for 15 sec, 60°C for 30 sec, and 72°C for 45 sec, for 40 cycles. The method described in this invention significantly reduces... FSE Plants that express genes include: FSE- HIGS7” FSE -HIGS8", for specific relative expression levels, see [link to relevant documentation]. Figure 3 .

[0046] Select wild-type strain PH-1 of Fusarium graminearum and inoculate it into the following plants using the single-flower drip method: FSE -HIGS7” FSE The resistance of "HIGS8" and wild-type Fielder wheat plants to Fusarium head blight was compared. The results are shown in […]. Figure 4 , Figure 4 yes" FSE -HIGS7” FSE Phenotypic results and statistical results of the number of diseased spikelets in "-HIGS8" transgenic wheat plants 14 days after inoculation with *Fallisneria buergeriana* PH-1 spores. Figure 4 It can be seen that, compared with wild-type Fielder wheat plants, " FSE -HIGS7” FSE The number of diseased ears in "-HIGS8" transgenic wheat plants was significantly reduced.

[0047] Comparison of transgenic wheat plants FSE -HIGS7” FSE The main agronomic traits (including tiller number, plant height, spike length, and 100-grain weight) of "HIGS8" and wild-type Fielder wheat plants are shown in the experimental results. Figures 5 - 9 , Figures 5 - 9 These are statistical results regarding the growth status of transgenic wheat plants, including ear length, number of tillers, plant height, and thousand-grain weight. Figures 5 - 9 It can be seen that the transfer of wheat FSE Gene silencing vectors do not affect the main agronomic traits of wheat.

[0048] As described above, the basic principles, main features, and advantages of the present invention have been well described. The above embodiments and specifications are merely descriptions of preferred embodiments of the present invention, and the present invention is not limited to the above embodiments. Various changes and improvements made to the technical solutions of the present invention by those skilled in the art without departing from the spirit and scope of the present invention should fall within the protection scope defined by the present invention.

Claims

1. A gene combination of pathogenic factors of Fusarium graminearum, characterized in that, The Fusarium graminearum pathogenic factor gene combination is composed of FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Genetic composition; The FSE1 The gene encodes the FSE1 protein, the amino acid sequence of which is shown in SEQ ID NO: 1; The FSE2 The gene encodes the FSE2 protein, the amino acid sequence of which is shown in SEQ ID NO: 2; The FSE3 The gene encodes the FSE3 protein, the amino acid sequence of which is shown in SEQ ID NO: 3; The FSE4 The gene encodes the FSE4 protein, the amino acid sequence of which is shown in SEQ ID NO: 4; Simultaneous silence FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Genes, or simultaneously reduced FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 The gene expression level can effectively reduce the pathogenicity of Fusarium graminearum.

2. The Fusarium graminearum pathogenic factor gene combination according to claim 1, characterized in that, The FSE1 The nucleotide sequence of the gene is shown in SEQ ID NO: 5; The FSE2 The nucleotide sequence of the gene is shown in SEQ ID NO: 6; The FSE3 The nucleotide sequence of the gene is shown in SEQ ID NO: 7; The FSE4 The nucleotide sequence of the gene is shown in SEQ ID NO:

8.

3. A recombinant vector, characterized in that, The recombinant vector targets the Fusarium graminearum pathogenic factor gene combination of claim 1, and the recombinant vector can simultaneously silence... FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Genes or simultaneously reduced FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Gene expression levels.

4. The recombinant vector according to claim 3, characterized in that, The recombinant vector is a HIGS vector, which contains simultaneous targeting... FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Fragments of genes.

5. The recombinant vector according to claim 4, characterized in that, The HIGS vector contains a fragment as shown in SEQ ID NO:

9.

6. A recombinant Agrobacterium, characterized in that, It includes the recombinant vector as described in any one of claims 3 to 5.

7. A method for improving plant resistance to Fusarium graminearum infection, characterized in that, include: The recombinant vector according to any one of claims 3 to 5 is introduced into the plant.

8. A method for improving plant resistance to Fusarium graminearum infection, characterized in that, include: Reduce the risk of plant infection by Fusarium graminearum FSE1 Gene, FSE2 Gene, FSE3 Genes and FSE4 Gene expression levels; The FSE1 The gene encodes the FSE1 protein, the amino acid sequence of which is shown in SEQ ID NO: 1; The FSE2 The gene encodes the FSE2 protein, the amino acid sequence of which is shown in SEQ ID NO: 2; The FSE3 The gene encodes the FSE3 protein, the amino acid sequence of which is shown in SEQ ID NO: 3; The FSE4 The gene encodes the FSE4 protein, the amino acid sequence of which is shown in SEQ ID NO:

4.

9. The method for improving plant resistance to Fusarium graminearum infection according to claim 8, characterized in that, The FSE1 The nucleotide sequence of the gene is shown in SEQ ID NO: 5; The FSE2 The nucleotide sequence of the gene is shown in SEQ ID NO: 6; The FSE3 The nucleotide sequence of the gene is shown in SEQ ID NO: 7; The FSE4 The nucleotide sequence of the gene is shown in SEQ ID NO:

8.

10. The application of the Fusarium graminearum pathogenic factor gene combination according to any one of claims 1 or 2, or the recombinant vector according to any one of claims 3 to 5, or the recombinant Agrobacterium tumefaciens according to claim 6 in the breeding of disease-resistant wheat varieties.

Images