Methods and complexes for sequentially translocating two non-covalently bound complementary nucleic acid strands through a nanopore

Abstract

Methods for characterizing analytes using nanopores. One aspect is characterized by using nanopores to characterize double-stranded polynucleotides, such as methods that do not use hairpins that connect the template and complementary sequence of the double-stranded polynucleotide. Another aspect is characterized by methods for characterizing analytes using tag-modified nanopores, which have increased sensitivity and / or higher throughput. Compositions and systems that can be used in the methods are also provided, including, for example, adapters for attachment to double-stranded polynucleotides and tag-modified nanopores.

Description

[0001] This application is a divisional application with the application date of November 29, 2017, application number 201780083105.X, and invention name “Method and system for characterizing analytes using nanopores”. Technical Field

[0002] Provided herein are methods for characterizing analytes using nanopores. Also provided are compositions and systems that can be used in the methods, including, for example, adaptors for attaching to analytes, such as double-stranded polynucleotides, and tag-modified nanopores. In some embodiments, provided herein are methods for sequencing one or more target polynucleotides using transmembrane pores. Background Art

[0003] There is currently a need for rapid and inexpensive polynucleotide (eg, DNA or RNA) sequencing and identification technologies for a wide range of applications.

[0004] Transmembrane pores (e.g., nanopores) have been used to identify small molecules or folded proteins and to monitor chemical or enzymatic reactions at the single molecule level. Transmembrane pores (e.g., nanopores) have great potential as direct, electrical biosensors for polymers and various small molecules. Specifically, nanopores are being recently focused on as potential DNA sequencing technologies and biomarker identification.

[0005] The ion flow through the nanopore can be measured under the potential difference applied across the nanopore. The interaction of the analyte with the nanopore can cause characteristic changes in the ion flow, and the measurement of the generated signal can be used to characterize the analyte. For example, the measured signal can be electric current, and can be used, for example, to determine the sequence of a polynucleotide. The polynucleotide chain can be translocated through the hole, and the identity of the nucleotide, such as the sequence, can be obtained from the measured signal. Such sequencing methods are disclosed in, for example, WO0142782, WO2016034591, WO2013041878, WO2014064443 and WO2013153359.

[0006] Methods for sequencing double-stranded polynucleotides have been developed, for example, involving the translocation of templates and complementary chains connected by hairpins. Chain sequencing generally involves the use of polynucleotide binding proteins (such as helicases) to control the movement of polynucleotides through nanopores. Such methods are disclosed in, for example, WO2013057495. The size of the nanopore can allow it to only allow single-stranded polynucleotide translocations. Double-stranded polynucleotides can be determined by separating the chains before translocation through the nanopore to provide single-stranded polynucleotides. Polynucleotide binding proteins such as helicases can be used to simultaneously separate double-stranded polynucleotides and control the rate at which the resulting single-stranded translocations pass through the nanopore. The two chains of the double-stranded polynucleotide can be connected by bridging parts such as hairpin loops, and the method for preparing such constructs is described in, for example, WO2013057495. This ensures that the reverse (complementary) chain translocation occurs after the forward (template) chain translocation. It is advantageous to measure the two chains in this way because the information from the two connected complementary chains can be combined and used to provide a higher confidence observation than that obtained by measuring only the template chain. However, the preparation of the polynucleotides connected by such hairpins can increase sample preparation time and cause the loss of valuable analytes. In addition, the template connected by hairpins and the translocation of complementary polynucleotide chains can cause the re-hybridization of the chain on the other (anti) side of the nanopore by the nanopore. This can change the translocation rate, thereby reducing the sequencing accuracy. In addition, due to the difference in the current-time data of the template strand and the complementary strand, two algorithms are used to calculate, which makes the calculation more complicated and intensive.

[0007] Therefore, there is a need for improved methods of characterizing analytes (eg, double-stranded polynucleotides) with increased precision and higher efficiency / throughput. Summary of the invention

[0008] The present disclosure generally relates to methods for characterizing analytes using nanopores and compositions that can be used in methods described herein, such as adapters and nanopores. The present disclosure is based in part on unexpected findings that both chains of double-stranded polynucleotides can be sequentially translocated through nanopores to provide sequence information without the need to covalently connect the two chains by a bridging portion (such as a hairpin loop). For example, in some embodiments, an adapter with a duplex stem can be provided to each end of a double-stranded polynucleotide, the adapter stem comprising a capture sequence complementary to a hole tag conjugated to a nanopore, wherein the capture sequence is revealed only when the chain is unwound. Therefore, when the first chain of a double-stranded polynucleotide passes through a tag-modified nanopore, it pulls open the duplex stem of the adapter to expose the capture sequence on the second chain of the double-stranded polynucleotide, which is then captured by the hole tag of the nanopore. Such methods not only keep the second chain close to the nanopore, but also shorten the time delay between reading the first chain and the second chain, thereby improving the overall accuracy and efficiency of the sequencing method. It is also found that capturing a variety of analytes that are subsequently translocated through the nanopore at the nanopore can enhance the sensitivity and / or flux of characterizing the analyte.

[0009] The present inventors have also discovered that when a polynucleotide binding protein is used to separate the two chains of a double-stranded polynucleotide while controlling the movement of one of the chains through a transmembrane pore, the second chain can remain near the pore and after the first chain translocates through the pore, the second chain can be captured by the pore, and the polynucleotide binding protein can be used to control the movement of the second chain through the pore.

[0010] Therefore, one aspect of the present invention provides a method for sequencing a target polynucleotide, comprising:

[0011] (a) Contacting the transmembrane pore:

[0012] (i) a double-stranded polynucleotide comprising a target polynucleotide and a polynucleotide complementary to the target polynucleotide, wherein the target polynucleotide and the polynucleotide complementary to the target polynucleotide each comprise a single-stranded leader sequence; and

[0013] (ii) a polynucleotide binding protein capable of separating the strands of a double-stranded polynucleotide and controlling the movement of the polynucleotide through a transmembrane pore;

[0014] (b) detecting a signal corresponding to ion flux through the pore to detect a polynucleotide translocated through the pore;

[0015] (c) identifying a signal corresponding to a translocation of the target polynucleotide and a continuous signal corresponding to a separate translocation of a polynucleotide complementary to the target polynucleotide;

[0016] (d) analyzing the signal identified in (c),

[0017] The target polynucleotide is thereby sequenced.

[0018] In this regard, the double-stranded barcode sequence can be attached to one or both ends of the target double-stranded polynucleotide, the leader sequence can be included in the adapter, the adapter can include a double-stranded region and at least one single-stranded region, the adapter can include a double-stranded barcode sequence, the adapter can include a membrane tether or a hole tether, the leader sequences attached to the two ends of the target double-stranded polynucleotide can be different, the double-stranded polynucleotide can have different adapters and / or polynucleotide binding proteins at each end thereof, such as helicases or polymerases, which can be combined with the leader sequence. When the polynucleotide binding protein is combined with the leader sequence, the activity of the polynucleotide binding protein can stagnate until the polynucleotide contacts the transmembrane hole. When the double-stranded barcode sequence is attached to one or both ends of the target double-stranded polynucleotide, a unique barcode sequence can be attached to each double-stranded polynucleotide in the sample. In this regard, the double-stranded polynucleotide can be attached to microparticles and / or can modify holes to enhance the capture of polynucleotides. For example, one or more molecules that attract or bind polynucleotides or adapters can be connected to holes. Such molecules may be selected from, for example, PNA tags, PEG linkers, short oligonucleotides, positively charged amino acids and aptamers. In this regard, the transmembrane pore may be, for example, a protein pore, such as a pore derived from or based on Msp, α-hemolysin (α-HL), lysin, CsgG, ClyA, Sp1 or FraC, or a solid-state pore and / or the membrane may be an amphiphilic layer or a solid-state layer.

[0019] The method is superior to known methods for sequencing double-stranded polynucleotides, in which the two chains are connected using a bridging portion such as a hairpin loop. The method is also superior to known methods that measure only the template polynucleotide strand. Specifically, the method of the present invention combines the advantages of the template strand-only method and the hairpin loop method without the disadvantages of the mentioned hairpin loop method.

[0020] For example, the method disclosed in WO2013 / 014451 uses multiple adapters, and only some double-stranded polynucleotides in the sample will have a Y adapter added to one end and an adapter containing a bridging portion added to the other end, discarding other polynucleotides in the sample. The method of the present invention can be performed using a single leader sequence or adapter that can be added to both ends of a double-stranded polynucleotide. When using such a single leader sequence / adapter system, fewer samples (if any) need to be discarded.

[0021] In this method, either end of the double stranded target polynucleotide can be captured by the pore. This improves sensitivity compared to the method disclosed in WO2013 / 014451, in which only the ends of the double stranded polynucleotide that do not contain a bridging moiety can be captured by the pore.

[0022] The present invention also provides a population of adaptors comprising a double-stranded barcode sequence, a single-stranded leader sequence, and a polynucleotide binding protein capable of separating the strands of a double-stranded polynucleotide and controlling the movement of the polynucleotide through a transmembrane pore, wherein the barcode sequence in each adaptor in the population is unique.

[0023] Another aspect provided herein relates to a method for characterizing a polynucleotide. The polynucleotide may comprise DNA or RNA. The method comprises:

[0024] (i) Combining in solution:

[0025] (a) a construct comprising a double-stranded polynucleotide having a template strand and a complementary strand, wherein the template strand and the complementary strand are not covalently linked,

[0026] (b) a nanopore, wherein one or more tags associated with a portion of the construct are conjugated to the nanopore,

[0027] wherein the construct and the nanopore are combined under conditions such that the construct binds to the nanopore;

[0028] (ii) providing conditions so as to allow the template strand of the construct to enter the nanopore so as to allow separation of the template strand and translocation of at least a portion of the template strand through the nanopore;

[0029] (iii) measuring a change in a property indicative of translocation of the template strand through the nanopore; and

[0030] (iv) characterizing the polynucleotide based on changes in properties measured upon translocation of the template strand through the nanopore.

[0031] In some embodiments, the solution is ionic and the property measured is ionic current through the nanopore.

[0032] In some embodiments, adaptors are attached to one or both of the two ends of the double-stranded polynucleotide, each adaptor comprising a duplex stem and a first single strand extending from the duplex stem, wherein the first single strand of one adaptor is adjacent to the template strand and the first single strand of the other adaptor is adjacent to the complementary strand.

[0033] In some embodiments, step (ii) comprises: applying a potential difference across the membrane so as to allow the first single strand adjacent to the template strand of the construct to enter the nanopore, maintaining the potential difference across the nanopore for a sufficient period of time to allow the template strand to separate and at least a portion of the template strand to translocate through the nanopore.

[0034] In some embodiments, a polynucleotide helicase is pre-bound to one or each of the two adaptors. A polynucleotide helicase is provided in the lumen of the nanopore.

[0035] In some embodiments, the adaptor portion having complementarity with the oligonucleotide can be within the duplex stem on the strand adjacent to the first single strand. The potential difference can be maintained for a sufficient period of time to allow the polynucleotide to melt to a certain extent so that the adaptor portion whose first single strand is adjacent to the complementary strand is available for hybridization with the tag.

[0036] In some embodiments, one or more tags are conjugated to the outer edge of the nanopore. In some embodiments, one or more tags that are bound to a portion of the adaptor are conjugated to the nanopore. In some embodiments, at least one of the one or more tags that are bound to a portion of the construct is a nucleic acid that has sequence complementarity to the construct portion. In some embodiments, at least one of the one or more tags that are bound to a portion of the construct is a nucleic acid that has sequence complementarity to the adaptor portion. Nucleic acids can be uncharged, including, for example, but not limited to, PNA or morpholino.

[0037] In some embodiments, the condition is a potential difference across the nanopore.

[0038] Any nanopore known in the art can be used in the methods described herein. In some embodiments, the nanopore also serves to unwind the polynucleotide. In some embodiments, the nanopore can be a motor protein nanopore, such as a phi29 motor protein nanopore. In some embodiments, the nanopore is placed in a membrane.

[0039] In some embodiments, step (iii) comprises measuring a change in ionic current through the nanopore as the template strand translocates through the nanopore. In some embodiments, step (iv) comprises characterizing the polynucleotide based on a change in ionic current through the nanopore measured as the template strand translocates through the nanopore.

[0040] In some embodiments of the methods described herein, a polynucleotide helicase is present in the solution on the cis-open side of the nanopore. In some embodiments, one or more polynucleotide helicases are pre-bound to the polynucleotide.

[0041] In some embodiments, for each adaptor, a polynucleotide helicase binds to the first single strand extending from the duplex stem. In some embodiments, melting of the template strand is facilitated by its correspondingly bound polynucleotide helicase.

[0042] In some embodiments of the methods described herein, melting of the polynucleotide exposes a portion of the complementary strand for hybridization to a tag.

[0043] In some embodiments of various aspects described herein, the method may further include maintaining the conditions for a sufficient period of time to allow the complementary strand to enter the nanopore and translocate the nanopore after the template strand is translocated through the nanopore. For example, the method may further include maintaining the potential difference for a sufficient period of time to allow the first single strand adjacent to the complementary strand to enter the nanopore and translocate the complementary strand after the template strand is translocated through the nanopore.

[0044] In some embodiments of various aspects described herein, the method may further include measuring a change in a property indicating that the complementary strand is translocated through a nanopore. The property may be an ionic current through the nanopore when the complementary strand is translocated through the nanopore. In some embodiments, the method may further include characterizing the polynucleotide based on a change in the property indicating that the complementary strand is translocated through the nanopore. In some embodiments, data indicating that the measured property indicating that the complementary strand and the template strand are translocated through the nanopore may be obtained and used to characterize the polynucleotide. The template strand data may be compared or combined with the complementary strand data to characterize the polynucleotide.

[0045] In some embodiments of the methods described herein, the nanopore may comprise a first tag and a second tag that are respectively bound to a portion of the first single strand of the adaptor adjacent to the template strand and a portion of the first single strand of the adaptor adjacent to the complementary strand.

[0046] In some embodiments of the methods described herein, each adaptor may include a second single strand extending from a duplex stem. The second single strand of one adaptor is adjacent to a complementary strand and / or the second single strand of another adaptor is adjacent to a template strand. In some embodiments, at least one of the one or more tags bound to a portion of the adaptor may be an oligonucleotide having sequence complementarity with a portion of the adaptor within the second single strand. In some embodiments, two or more of the one or more tags bound to a portion of the adaptor are oligonucleotides having sequence complementarity with a portion of the adaptor within the second single strand.

[0047] In some embodiments of the methods described herein, the methods may further comprise: determining the sequence of the template strand based on the measurement of the change in the measured property when the template strand is translocated through the pore; determining the sequence of the complementary strand based on the measurement of the change in the measured property when the complementary strand is translocated through the pore; and comparing the sequence of the template strand and the sequence of the complementary strand to establish the sequence of the polynucleotide.

[0048] Also provided are systems for characterizing polynucleotides, which can be used, for example, in any aspect of the methods described herein. The system includes: (i) a construct comprising a polynucleotide having a template strand and a complementary strand, and (ii) a nanopore disposed in a membrane, the nanopore comprising a rim conjugated to at least one nucleic acid having sequence complementarity with a portion of an adaptor.

[0049] In some embodiments, the template strand and the complementary strand are not covalently linked. An adaptor may be attached to each of the two ends of a polynucleotide, each adaptor comprising a duplex stem and a first single strand extending from the duplex stem. The first single strand of an adaptor may be adjacent to the template strand and the first single strand of another adaptor may be adjacent to the complementary strand. For each adaptor, a polynucleotide helicase may bind to the first single strand extending from the duplex stem. In some embodiments, the portion of the adaptor is within the duplex stem on the strand adjacent to the first single strand.

[0050] In some embodiments, each adaptor may comprise a second single strand extending from the duplex stem, wherein the second single strand of the one adaptor is adjacent to the complementary strand and the second single strand of the other adaptor is adjacent to the template strand. In some embodiments, the portion of the adaptor may be within the second single strand.

[0051] In some embodiments, at least one nucleic acid conjugated to the nanopore (a) has sequence complementarity to a portion of the adaptor within the double strand on the strand adjacent to the first single strand, and (b) also has sequence complementarity to a portion of the adaptor within the second single strand.

[0052] In some embodiments, at least two nucleic acids are conjugated to the nanopore, wherein one of the at least two nucleic acids has sequence complementarity with a portion of the adaptor within the duplex on the strand adjacent to the first single strand, and wherein another of the at least two nucleic acids has sequence complementarity with a portion of the adaptor within the second single strand. In some embodiments, at least two nucleic acids may be conjugated to the outer rim of the nanopore.

[0053] Another aspect relates to a method of preparing a system for characterizing a polynucleotide, the method comprising: (i) obtaining a construct comprising a polynucleotide having a template strand and a complementary strand, wherein the template strand and the complementary strand are not covalently linked, and (ii) combining the construct with a nanopore disposed in a membrane under conditions where the construct is exposed to an outer edge of the nanopore, wherein at least one nucleic acid having sequence complementarity to a portion of the adaptor is conjugated to the outer edge of the nanopore.

[0054] In some embodiments, an adaptor can be attached to each of the two ends of the polynucleotide, each adaptor comprising a duplex stem and a first single strand extending from the duplex stem, wherein the first single strand of one adaptor is adjacent to the template strand and the first single strand of the other adaptor is adjacent to the complementary strand. For each adaptor, a polynucleotide helicase can bind to the first single strand extending from the duplex stem.

[0055] Complexes comprising two or more components formed in any aspect of the methods described herein are also within the scope of the present disclosure. In some embodiments, the complex comprises: (i) a nanopore with a tag, (ii) a complementary polynucleotide chain bound to the nanopore via the tag, and (iii) a template polynucleotide chain hybridized to a portion of a complementary sequence polynucleotide chain, wherein the template polynucleotide chain portion is placed in the lumen of the nanopore. In other embodiments, the complex may comprise (i) a nanopore with two or more tags, and (ii) a double-stranded polynucleotide comprising a template chain and a complementary chain, wherein each chain is bound to one of the two or more tags. In any embodiment of the complex described herein, the tag may be located at the outer edge outside its lumen.

[0056] Also provided herein are methods and systems for determining characteristics of an analyte. In one aspect, the system comprises: (i) a nanopore disposed in a membrane, the nanopore comprising an outer edge where at least one common tag is present; and (ii) a plurality of different analytes, each different analyte being attached to a binding partner of the at least one tag. In some embodiments, each analyte can be a biopolymer. Examples of such biopolymers include, but are not limited to, polynucleotides, polypeptides, polysaccharides, and lipids.

[0057] In some embodiments, each analyte is a polynucleotide. In some embodiments where each analyte is a polynucleotide, the binding partner can be a nucleotide sequence of an adaptor attached to the polynucleotide, and at least one common tag can be a nucleic acid having sequence complementarity with the nucleotide sequence of the adaptor.

[0058] In another aspect, a method for determining a characteristic of an analyte using a nanopore comprises: (i) providing an analyte; (ii) allowing one or more analytes to bind to the nanopore, wherein an outer edge of the nanopore is outside an inner cavity of the nanopore, and (iii) obtaining a measurement of the analyte that has bound to the nanopore while moving the analyte relative to the nanopore, wherein the measurement is indicative of one or more characteristics of the analyte; and (iv) characterizing the analyte based on the measurement obtained in step (iii).

[0059] In some embodiments, the one or more analytes may be bound to the nanopore rim outside the nanopore lumen. In some embodiments, more than one analyte may be respectively bound to more than one tag conjugated to the nanopore. In some embodiments, the one or more tags may be conjugated to the nanopore rim outside the nanopore lumen.

[0060] In some embodiments, the first analyte can be a polynucleotide.

[0061] In some embodiments, the method may further include: obtaining a measurement of the second analyte that has bound to the nanopore while moving the second analyte relative to the nanopore, wherein the measurement of the second analyte obtained indicates one or more characteristics of the second analyte, and characterizing the second analyte based on the measurement of the second analyte obtained. The second analyte may be a polynucleotide.

[0062] In some embodiments, a second analyte may bind to the nanopore during movement of the first analyte relative to the nanopore.The second analyte may be a polynucleotide.

[0063] Also provided herein is a complex comprising a nanopore having a plurality of tags, wherein a first analyte and a second analyte partially located in the lumen of the nanopore are bound to one of the capture moieties.

[0064] In some embodiments, the plurality of tags may be on an outer rim outside of its inner cavity.In some embodiments, the first analyte and the second analyte are polynucleotides.

[0065] Methods for sequentially translocating two non-covalently bound molecules through a nanopore are also within the scope of the present disclosure. The method comprises contacting a pair of non-covalently bound molecules with the nanopore under conditions that promote translocation of a first member of the pair of non-covalently bound molecules through the nanopore, wherein a binding site on the second member of the pair is exposed during translocation of the first member through the nanopore, and wherein the binding site reversibly binds to a tag present on the nanopore.

[0066] In some embodiments, the non-covalently bound molecules are complementary nucleic acid strands. In some embodiments, the pair of non-covalently bound molecules can include a target nucleic acid attached to an adaptor, and the binding site can be present on the adaptor.

[0067] In some embodiments, the tag on the nanopore may be an oligonucleotide and the binding site on the second member may be a portion of a nucleic acid having a sequence complementary to the tag.

[0068] Also provided herein is a method of characterizing a polynucleotide, comprising: contacting a pair of non-covalently bound molecules with the nanopore under conditions that promote translocation of a first member of the pair of non-covalently bound molecules through the nanopore, followed by sequentially translocating a second member of the pair of non-covalently bound molecules; measuring a property indicative of translocation of the first and second members of the pair and obtaining data indicative of the measured property; and determining a characteristic based on the data obtained for the first and second members. BRIEF DESCRIPTION OF THE DRAWINGS

[0069] The following drawings constitute part of this specification and are included to further illustrate certain aspects of the present disclosure, which may be better understood by referring to one or more of these drawings in combination with the detailed description of specific embodiments presented herein.

[0070] For illustrative purposes only, the strands in the figures described herein are labeled "template" and "complementary sequence" according to their capture ends. The first strand that passes through the nanopore is labeled as the template, and the complementary strand that follows the first strand is labeled as the complementary sequence. After analyzing the sequence information obtained from the first strand and the second strand, the actual template and complementary sequences of the double-stranded polynucleotide are determined.

[0071] Figure 1A-1B A prior art method for sequencing a double-stranded polynucleotide (eg, DNA) construct using a transmembrane pore is described, wherein the template and complementary strands are linked by a hairpin loop and the template strand comprises a 5' leader sequence. Figure 1A Schematic diagram of a polynucleotide (e.g., DNA) construct translocated through a nanopore under the control of an enzyme. The template enters the nanopore and the same enzyme advances around the hairpin to control the movement of the complementary sequence behind the template. Once the hairpin region translocates through the nanopore, the hairpin can be reformed on the opposite side of the nanopore. Figure 1B Peaks representing the accuracy of sequence information obtained from template translocation, from complementary sequence translocation, and when sequence information obtained from template translocation and complementary sequence translocation are algorithmically combined are shown.

[0072] Figure 2A-2BA method for "follow-on" sequencing of a double-stranded polynucleotide (e.g., DNA) construct without the use of a hairpin according to one embodiment described herein is described. The template and complementary polynucleotide (e.g., DNA) strands contain an adapter at each end, the adapter comprising a leader sequence. Figure 2A It is a schematic diagram of a double-stranded polynucleotide (e.g., DNA) construct translocated through a nanopore under enzyme control. The template and complementary sequence of the double-stranded polynucleotide are not covalently linked, and each chain has an enzyme loaded on an adapter. After the template strand passes through the nanopore (and the enzyme dissociates), the complementary strand is captured and sequenced by the hole. In the absence of a hairpin connecting the template to the complementary sequence, there is almost no secondary hairpin structure formed on the reverse side of the nanopore. Figure 2B Peaks representing the accuracy of sequence information obtained from template translocation, from complementary sequence translocation, and when sequence information obtained from template translocation and complementary sequence translocation are algorithmically combined are shown.

[0073] Figure 3A-3B The structure of an enzyme-carrying adaptor according to one embodiment described herein is illustrated. Figure 3A Schematic diagram of an enzyme-carrying adapter. The labels represent the following: (1) spacer (e.g., leader sequence); (2) polynucleotide binding protein (e.g., polynucleotide helicase), such as helicase (e.g., Dda helicase); (3) spacer; (4) anchor, such as cholesterol anchor. Other solid lines represent polynucleotide sequences. Figure 3B Shown are adaptors attached to each end of a double-stranded polynucleotide (eg, a genomic DNA fragment), with a polynucleotide binding protein (eg, a polynucleotide helicase) loaded onto each adaptor.

[0074] Figure 4 is a schematic diagram of the current signal measured over time during translocation of a polynucleotide chain through a nanopore.

[0075] Figure 5 is a graphic representation of the separation of a double-stranded polynucleotide at a nanopore interface and the subsequent translocation of a single-stranded polynucleotide through the nanopore.

[0076] Figure 6 During polynucleotide sequencing Figure 4 Illustration of event detection on a portion of a current time signal.

[0077] Figure 7 is a schematic diagram of using a recurrent neural network (RNN) model to analyze signal measurements.

[0078] Figure 8 is a diagram of how the Viterbi algorithm is used to determine the path through the possible transitions with the highest likelihood.

[0079] Figures 9A-9B The structure of an enzyme-carrying adaptor according to one embodiment described herein is illustrated. Fig. 9A is a schematic diagram of an enzyme-carrying adapter. The labels represent the following: (1) a spacer (e.g., a leader sequence); (2) a polynucleotide binding protein (e.g., a polynucleotide helicase), such as a helicase (e.g., a Dda helicase); (3) a spacer; (4) an anchor, such as a cholesterol anchor, which is optional; and (5) a duplex stem disposed at the opposite end of (1) the spacer (e.g., the leader sequence), the duplex stem comprising a capture sequence on a strand aligned with the (1) spacer (e.g., the leader sequence), wherein the capture sequence is complementary to a tag (e.g., a capture polynucleotide) conjugated to the outer edge of the nanopore. Other solid lines represent polynucleotide sequences. Fig. 9B The construct is shown when an adaptor is attached to each end of a double-stranded polynucleotide, with a polynucleotide binding protein (eg, a polynucleotide helicase) loaded onto each adaptor.

[0080] Fig.10 (Figure AD) illustrates a schematic diagram of a method for sequencing a double-stranded polynucleotide using a nanopore according to one embodiment described herein. The method includes providing (i) each end is attached to an adapter (e.g., Fig. 9A As shown in FIG, there is a double-stranded polynucleotide without an anchor (iv) and loaded with a polynucleotide binding protein (e.g., a polynucleotide helicase) on an adaptor, and (ii) a nanopore with a capture polynucleotide conjugated to the outer edge of the nanopore. The second strand (complementary sequence) of the double-stranded polynucleotide is coupled to the nanopore by binding the capture sequence of the adaptor attached to the second strand to the tag (e.g., capture polynucleotide) conjugated to the outer edge of the nanopore.

[0081] Figures 11A-11B An example portion of chain data acquired using a method according to one embodiment described herein is shown. The chain data shows current (pA) versus time (seconds) for electrical data of a single channel. Fig.11A An example portion of the strand data is shown, showing that the pore opening level for strands that do not block the current is about 200 pA. When the strand is captured, the current drops to the 50-100 pA range, depending on the sequence composition. When the strand completely passes through the pore, the current returns to the pore opening level of 200 pA. For paired template and complementary strands, the individual strands are labeled T n (e.g., T1, T2, ...) and C n (e.g., C1, C2, ...), and for strands where T is not followed by its complementary pair, it is labeled T. The labels and data correspond to those in Table 4. Fig.11A This indicates that the second complementary strand in a pair usually follows the template closely, with very little time between strands. Fig. 11B An enlarged portion of the electrical trace is shown, highlighting one of the pairs followed, labeled Template 1 and Complementary Sequence 1.

[0082] Figures 12A-12D An example portion of strand data acquired using a method according to one embodiment described herein is shown. The strand data shows current (pA) versus time (seconds) of electrical data for a single channel on a MinION chip. Fig. 12A Another example electrical trace following a template-complementary sequence pair is shown. Fig. 12B , Fig. 12C and Fig.12D Shows Fig. 12A Magnified view of the trace in , where the star marks the sp18 spacer in the duplex stem (e.g., the complementary tag portion), which is added to the strand to enable coupling to a pore-tag (e.g., a capture polynucleotide conjugated to the outer rim of the nanopore). Fig. 12B sp18 at the beginning of the template strand is shown. Fig. 12C sp18 at the end of the template and the start of the complementary sequence are shown, and Fig.12D The complementary sequence ends are shown with sp18. These markers can be used to demonstrate that a dsDNA substrate has enzyme-adapters attached to both ends of the dsDNA and to measure the efficiency of attachment.

[0083] Fig.13 A histogram of the distribution of pore opening times between subsequent chains (x-axis) as a continuous chain passes through a hole (aggregated from all channels on the MinION chip) is shown. The upper figure, the control adapter (as described in Example 2), shows that when sequencing is performed without a capture sequence in a polynucleotide construct that can be coupled to a hole tag (e.g., a capture nucleotide), the time distribution between chains is approximately 3 seconds on average. The lower figure, following adapter 2 (as described in Example 4), shows that when the chain contains a capture sequence (e.g., a capture polynucleotide) that can be coupled to a hole tag in the complementary sequence, a new population of approximately 50 milliseconds is observed. The short population of 50ms comes from the complementary chain that is quickly captured shortly after its template pair. Capture is fast because the complementary chain is kept very close to the hole by the binding of the complementary sequence to the hole tag, so it is not allowed to diffuse.

[0084] Fig.14 A histogram showing the distribution of basecall accuracy for sequence information (randomly fragmented E. coli) obtained from template translocation, from complementary sequence translocation, and when sequence information obtained from template translocation and complementary sequence translocation are algorithmically combined. Fig.10 The method shown obtains sequence information.

[0085] Fig.15An exemplary embodiment of a nanopore with two or more types of tags is shown. For example, one tag can be provided to increase the sensitivity of the method for characterizing an analyte ("sensitivity tag"), while another tag can be provided to increase the possibility of sequencing the complementary chain after the template chain of a double-stranded polynucleotide ("follow-up tag"). The hole tag can be constructed in a variety of ways. For example, each monomer of an oligomeric hole can have the same type of tag configuration (e.g., with multiple binding sites, as shown in Tag-A and Tag-B). Tag-A and Tag-B can be combined to form a single tag, and each monomer contains a Tag-A / Tag-B combination tag. Alternatively, the oligomeric hole may contain mixed monomers with different tags attached, so that at least one monomer has a different tag configuration from other monomers. In another example, Tag-A and Tag-B can remain as separate tags, and each monomer can include two separate tags. If the sensitivity tag and the follow-up tag are complementary to the unique sequence used in the adapter, they can be combined separately, as shown in the figure below of the adapter schematic design.

[0086] Fig.16 Schematic diagram of how nanopores with two different tag types can be used to capture strands from solution (in order to increase sensitivity). An adaptor attached to the end of a double-stranded polynucleotide contains a capture sequence that can be used to couple to a first well tag (e.g., forming a non-complementary arm of a Y-adapter), while a separate capture sequence within the duplex stem that is only revealed when pulled apart allows the complementary sequence to bind to the second well tag, thus enabling complementary sequence capture for subsequent sequencing.

[0087] Fig.17A is a schematic diagram of how the same capture sequence can be used at two positions on the adaptor, one revealed allowing the strand to bind to the nanopore's pore tag from solution to increase sensitivity, and the other initially unrevealed and revealed as the template is pulled through the pore, becoming available to bind to another of the multiple tags on the pore (a pore with only one type of tag) to enable follow-up sequencing. Fig. 17B Some example sequences that can be used for this purpose are provided. The top construct shows a portion of an example Y adaptor. The "FO001 / FO002" and "FO003 / FO004" sequences are examples of duplex stems that can be attached to the example Y adaptors to produce a single adaptor construct that can implement methods according to one or more embodiments described herein. The same binding sequence site for a nanopore can be used more than once (e.g., twice) within the duplex stem of an adaptor.

[0088] Fig.18 A schematic diagram of the adapter design is shown, which enables follow-up sequencing and increased sensitivity. Fig.18The pore-binding site of the template strand (labeled "Hyb splint with morpholino pore tag") is exposed to the surrounding solution and initially available to bind the pore tag, thus increasing its sensitivity. When attached, the pore binding site is also adjacent to the complementary strand, so that when the template strand passes through the pore, the complementary strand remains bound to the pore. This process is repeated in situ. Fig.19 It is schematically shown in FIG.

[0089] Fig.19 is a schematic diagram showing a double-stranded polynucleotide, wherein Fig.18 The strand is coupled to the nanopore from solution through the exposed pore binding site, thereby increasing the sensitivity of subsequent capture of nearby template strands. The binding site is also adjacent to the complementary strand so that when the template has passed through the nanopore, the complementary sequence remains bound to the nanopore. The complementary sequence can enter many possible conformations before final capture and sequencing, as shown below, to achieve follow-up sequencing. Fig.19 In the method, the complementary segments attached to the two ends of the strand to be detected can be combined together to form a hairpin structure containing the strand, which facilitates the sequencing process by bringing the strand closer to the nanopore to increase the sequencing efficiency. This may be particularly beneficial when the strand to be detected is a long strand.

[0090] Fig. 20 A schematic diagram of an adaptor design is shown in which the same sequence within the duplex stem is repeated at different positions of the adaptor, as shown, to achieve Fig.21 Follow the method shown in .

[0091] Fig.21 is a schematic diagram showing a double-stranded polynucleotide, wherein Fig. 20 The adaptors are attached to each end. Fig. 20 As described, the dsDNA chain is bound to the hole through the binding site attached to the adapter on the side arm. When the template is captured in the hole, the side arm sequence is pulled apart and remains bound to the hole tag, as shown. Later, the template is pulled apart, and the second site with the same sequence is exposed to bind to the side arm (itself still bound to the hole tag). In this way, the single label on the hole can be used to improve the capture sensitivity and can be reused to follow the complementary sequence of the substrate later. Finally, the hole tag retains the side arm sequence, but the side arm itself is captured by the hole and stripped from the hole tag to release the hole tag for another cycle.

[0092] Fig. 22 Shows how the exposed sequence is exposed for coupling to the hole tag as the template-enzyme approaches the end of the template strand. The efficiency of the following process can be increased, for example, by including spacers (e.g., 4 sp18 spacers, such as hexaethylene glycol in the sequence shown) or similar features that allow the enzyme to stay for a short time (this allows more time for coupling), or features that optimize geometry or flexibility. Dual binding sites in the exposed portion also increase the chances of coupling to the hole tag.

[0093] Fig.23 Provides the ability to achieve Fig.21 Example adapters / sequences for the methods disclosed in .

[0094] Fig.24 Provides the ability to achieve Fig.21 The methods disclosed in , and other adapters / sequences that are more optimized in causing enzyme pauses.

[0095] Fig.25 Provides the ability to achieve Fig.19 Example adapters / sequences for the methods disclosed in .

[0096] Fig.26 Exemplary sequences of components that make up the adaptors depicted in the above figures are provided.

[0097] Fig.27A Shown is a SYPRO Ruby protein gel showing monomeric and oligomeric nanopores of CsgG modified with or without morpholino pore tag. Fig.27B Schematic diagram showing a pyridyl-dithiomorpholinyl-modified nanopore.

[0098] Fig.28 A Cy3 fluorescent gel is shown showing hybridization of analytes to pyridyl-dithiomorpholinyl modified wells.

[0099] Fig.29 SYBR Gold nucleic acid gel stain is shown, which shows hybridization of analytes to pyridyl-dithiomorpholinyl modified wells.

[0100] Fig.30 A SYPRO Ruby protein gel is shown showing hybridization of analytes to pyridyl-dithiomorpholinyl modified wells.

[0101] Fig.31 A computer rendered diagram showing a nanopore (e.g., a CsgG nanopore) is illustrated, highlighting the location where cysteines can be added for conjugation to a pore tag. When the nanopore is placed in a membrane, the pore tag can be conjugated to the outer surface of the nanopore, e.g., on the cis or trans side of the membrane.

[0102] Fig.32A An embodiment of a Y adaptor design is shown that includes two hybridization sites, one for the pore tether and the other for the membrane or bead tether. In this design, the pore tether is immediately adjacent to the leader sequence. Fig.32B Ligated analytes are shown, such as double-stranded polynucleotides with Y adaptors at either end.

[0103] Fig.33 Yes Display Fig.32ASchematic diagram of example sequences of Y adaptor designs illustrated in .

[0104] Fig.34A A different embodiment of the Y adaptor design is shown, which includes two hybridization sites, one for the pore tether and the other for the membrane or bead tether. In this design, the membrane tether is immediately adjacent to the leader sequence. Fig.34B Ligated analytes are shown, such as double-stranded polynucleotides with Y adaptors at either end.

[0105] Fig.35 Yes Display Fig.34A Schematic diagram of example sequences of Y adaptor designs illustrated in .

[0106] Fig.36 is a schematic diagram showing an alternative embodiment of the Y adaptor design, which includes two hybridization sites, one for bead tethering and the other for membrane tethering. In this design, the bead has two different tethers, one attached to the analyte and the other to the well.

[0107] Fig.37 Yes Display Fig.36 An example sequence of a Y-shaped adaptor design is illustrated in and a schematic diagram showing indirect attachment of the analyte to the well.

[0108] Fig.38 Example traces of continuous strands translocating through a nanopore without a pore tag to which the strands could bind to allow follow-up sequencing are shown. In these examples, the strand separation times ranged from 2-5 seconds.

[0109] Fig.39 Shown are example traces of continuous chains translocating a modified pore according to one embodiment described herein. In these examples, the chain separation time ranged from 0.02-3 seconds.

[0110] Fig.40 Histograms illustrating the interval time between consecutive strands on a logarithmic scale are shown. The left panel shows a nanopore (e.g., a CsgG pore) with a single distribution where the interstrand time is greater than 1 second. The right panel shows the interstrand time for strands translocating through a tethered pore. This shows two populations, the fast-capturing population, and the interstrand time is below 0.1 seconds.

[0111] Fig.41 Depicted is a graph showing the number of bases sequenced per chip within 6 hours from an input of 20 ng DNA. Fig.42 A data table from an E. coli run is shown, which shows an increase in the number of follower strands with tethered holes. Fig.43 Methods that can be used to ligate single-stranded and double-stranded nucleic acids are shown.

[0112] Fig.44A method for characterizing and stringing together a number of double-stranded target polynucleotides is shown, wherein the complementary strand of a first double-stranded target polynucleotide recruits many other double-stranded target polynucleotides and brings them to a local concentration in a well. This provides a higher local concentration around the well than in a general bulk solution, so that the double-stranded target polynucleotides follow each other through the open well with minimal inter-strand time. This is particularly useful when the concentration of double-stranded target polynucleotides is low. A tether consisting of an oligonucleotide coupled to a single-stranded binding protein is used. When the template strand of the first double-stranded target polynucleotide is sequenced, the complementary strand is released into the solution as ssDNA. The single-stranded binding proteins of other double-stranded target polynucleotides are able to bind to the ssDNA. When the complementary strand is sequenced, the 3' of the complementary strand is pulled back into the well. The single-stranded binding protein on the ssDNA complementary strand is displaced from the complementary strand when it encounters the motor protein, and is therefore deposited around the well, increasing the local concentration. DETAILED DESCRIPTION

[0113] Although transmembrane pores (e.g., protein nanopores or solid-state nanopores) can be used as sensors for detecting or characterizing biopolymers, there is still a challenge of using transmembrane pores to improve the accuracy and / or efficiency of detection methods. For example, there are various disadvantages in the translocation of the template strand and complementary strand of the double-stranded polynucleotide connected by hairpins through nanopores. Although it is advantageous to measure two chains in this way, because the information from the two connected complementary strands can be combined and used to provide a higher accuracy than that which can be obtained by measuring only the template strand, the preparation of the polynucleotide connected by such hairpins is more complicated and more time-consuming and can cause the loss of valuable analytes. In addition, the translocation of the template and complementary polynucleotide strands connected by hairpins can cause the re-hybridization of the strand on the other (anti) side of the nanopore through the nanopore. This can change the translocation rate, thereby reducing the sequencing accuracy. The chain with a hairpin structure is also more difficult to translocate quickly like a linear single strand. In addition, due to the difference in the current-time data of the template strand and the complementary strand, two algorithms are used for calculation, which makes the calculation more complicated and intensive.

[0114] For analyte detection, there is typically a time delay between the translocation of one analyte and the translocation of the next analyte. This delay can be on the order of seconds to minutes, which can result in slower characterization, higher pore opening currents (faster depletion of the reference electrode), and / or an increased likelihood that the nanopore will be blocked when the pore is open. Therefore, there is a need to develop methods and compositions that improve the accuracy and / or efficiency or throughput of characterizing analytes using nanopores.

[0115] The present disclosure is based in part on the unexpected discovery that both chains of a double-stranded polynucleotide can be sequentially translocated through a nanopore to provide sequence information without the need to covalently link the two chains through a bridging moiety (e.g., a hairpin loop). For example, in one aspect, the inventors have discovered that when a polynucleotide binding protein (e.g., a polynucleotide helicase) is used to separate the two chains of a double-stranded polynucleotide while controlling the movement of one of the chains through a transmembrane pore, the second chain can remain near the pore and after the first chain translocates through the pore, the second chain can be captured by the pore, and the polynucleotide binding protein can be used to control the movement of the second chain through the pore.

[0116] On the other hand, the inventors have found that an adaptor with a duplex stem can be provided to each end of a double-stranded polynucleotide, the adaptor stem comprising a capture sequence complementary to a hole tag conjugated to a nanopore, wherein the capture sequence is revealed only when the chain is separated or unzipped. Therefore, when the first chain of a double-stranded polynucleotide passes through a tag-modified nanopore, it pulls open the duplex stem of the adaptor to expose the capture sequence on the second chain of the double-stranded polynucleotide, which is then captured by the hole tag of the nanopore. This method keeps the second chain (which would normally diffuse) close to the nanopore for sequencing after sequencing the template. Specifically, the method described herein can significantly increase the likelihood that a complementary sequence will follow the translocation after the template translocation, reaching at least about 60% of the time, compared to the 0.1%-1% of time typically observed in typical nanopore sequencing.

[0117] It has also been found that the modification of the nanopore comprises multiple binding sites for multiple analytes, so that one or more analytes can bind to the nanopore through the binding sites, and the analytes are characterized through the nanopore, which can enhance the sensitivity and / or flux of characterizing the analytes. Without wishing to be bound by theory, coupling or capturing analytes at the outer edge of the nanopore can enhance the local concentration of the analyte at the pore. In addition, at least one or more analytes near the nanopore can easily enter the nanopore one by one for characterization, thereby reducing the time delay and thus reducing the open pore current time of each analyte characterization interval.

[0118] Thus, various aspects of the present invention relate to methods for characterizing one or more analytes using nanopores, and compositions and systems that can be used in the methods described herein, including, for example, adapters and nanopores. Some aspects feature methods and compositions for characterizing double-stranded polynucleotides using nanopores, such as methods and compositions that do not use hairpins that connect the template and complementary sequence of the double-stranded polynucleotide. Other aspects feature methods and compositions for characterizing analytes using tag-modified nanopores with increased sensitivity and / or higher throughput.

[0119] Methods for characterizing analytes (eg, double-stranded polynucleotides)

[0120] In one aspect, the present disclosure provides a method for sequencing a target polynucleotide, comprising:

[0121] (a) Contacting the transmembrane pore:

[0122] (i) a double-stranded polynucleotide comprising a target polynucleotide and a polynucleotide complementary to the target polynucleotide, wherein the target polynucleotide and the polynucleotide complementary to the target polynucleotide each comprise a single-stranded leader sequence; and

[0123] (ii) a polynucleotide binding protein (e.g., a polynucleotide helicase) capable of separating the strands of a double-stranded polynucleotide and controlling the movement of the polynucleotide through the transmembrane pore;

[0124] (b) detecting a signal corresponding to ion flux through the pore to detect a polynucleotide translocated through the pore;

[0125] (c) identifying a signal corresponding to a translocation of the target polynucleotide and a continuous signal corresponding to a separate translocation of a polynucleotide complementary to the target polynucleotide;

[0126] (d) analyzing the signal identified in (c),

[0127] The target polynucleotide is thereby sequenced.

[0128] The method may further include the step of attaching a single-stranded leader sequence to the target polynucleotide and the complementary polynucleotide before step (a). The method may further include the step of digesting one end of the target polynucleotide to produce a leader sequence on the complementary strand and / or digesting one end of the complementary polynucleotide to produce a leader sequence on the target strand before step (a). The method may further include binding a polynucleotide binding protein (e.g., a polynucleotide helicase) to the leader sequence. The polynucleotide binding protein (e.g., a polynucleotide helicase) in (a)(ii) may bind to the leader sequence in (a)(i).

[0129] In this regard, the first polynucleotide binding protein (e.g., polynucleotide helicase) separates the target strand and complementary strand of a double-stranded polynucleotide, and controls the movement of the target polynucleotide or complementary polynucleotide through a transmembrane hole. The second polynucleotide binding protein (e.g., polynucleotide helicase), which can be another protein of the same type as the first polynucleotide binding protein (e.g., polynucleotide helicase), or can be a different type of polynucleotide binding protein (e.g., polynucleotide helicase), controls the movement of a target polynucleotide (wherein the complementary polynucleotide has been translocated through the hole) or a complementary polynucleotide (wherein the target polynucleotide has been translocated through the hole) through a transmembrane hole. The second polynucleotide binding protein (e.g., polynucleotide helicase) does not need to separate the target polynucleotide and the complementary polynucleotide, because the separation of the two chains of the double-stranded polynucleotide has occurred (the first polynucleotide binding protein (e.g., polynucleotide helicase) has separated the two chains, while allowing one of the chains to pass through the hole). The first polynucleotide binding protein (e.g., polynucleotide helicase) is typically a polynucleotide binding protein that processes a double-stranded polynucleotide. The second polynucleotide binding protein (e.g., a polynucleotide helicase) is typically a polynucleotide binding protein that processes a single-stranded polynucleotide. The first and / or second polynucleotide binding protein (e.g., a polynucleotide helicase) may be capable of processing double-stranded polynucleotides and single-stranded polynucleotides.

[0130] Another aspect described herein is characterized by a method for sequentially translocating two non-covalently bound molecules through a nanopore. The method includes: contacting a pair of non-covalently bound molecules with the nanopore under conditions that promote translocation of a first member of the pair of non-covalently bound molecules through the nanopore, wherein a binding site on the second member of the pair is exposed during translocation of the first member through the nanopore, and wherein the exposed binding site binds to a tag or tether present on the nanopore. Before the first member translocates through the nanopore, the binding site on the second member is not exposed (or shielded).

[0131] As used herein, the term "non-covalently bound molecule" refers to a molecule comprising a first member and a second member, wherein the first member and the second member are associated with each other by non-covalent attachment and can be separated from each other as separate entities. The separation and binding process between the first member and the second member is reversible. Examples of non-covalent attachment include, but are not limited to, complementary base pairing, ionic interactions, hydrophobic interactions, and / or Van der Waals interactions.

[0132] In some embodiments, the non-covalently bound molecules comprise complementary polynucleotide chains.

[0133] In some embodiments, the tag on the nanopore is an oligonucleotide and the binding site on the second member is a portion of a nucleic acid having a sequence complementary to the tag.

[0134] In some embodiments, the pair of non-covalently bound molecules comprises a target nucleic acid (e.g., a target double-stranded polynucleotide) attached to an adaptor nucleic acid, and wherein the binding site is present on the adaptor.

[0135] Just as an example, Fig. 9B Non-covalently bound molecules are shown, comprising complementary polynucleotide strands (e.g., a template strand and a complementary strand) and an adaptor (e.g., an adaptor nucleic acid) attached to each end. Fig. 9A As shown, the adaptor comprises a duplex stem (5) and a first single-stranded polynucleotide (1) extending from the template strand of the duplex stem. The duplex stem (5) comprises a capture sequence on a strand aligned with the first single-stranded polynucleotide (1), wherein the capture sequence is complementary to a tag (e.g., a capture polynucleotide) conjugated to the outer edge of the nanopore. In some embodiments, the first single-stranded polynucleotide (1) may also comprise a leader sequence. Although Fig. 9A A second single-stranded polynucleotide extending from the complementary strand (e.g., complementary sequence strand) of the duplex stem is shown, but is not required. However, in some embodiments, it may be desirable to have one or more second single-stranded polynucleotides comprising one or more tethers for a solid substrate, such as a membrane or bead and / or nanopore. When the second single-stranded polynucleotide is not complementary to the first single-stranded polynucleotide, a Y-adapter is formed, e.g., Fig. 9A as shown in .

[0136] Fig. 9A An exemplary adaptor comprising at least one anchor for a solid substrate (e.g., a membrane or a bead) is shown, and Fig.15 An example adaptor comprising at least two anchors is shown, wherein a first anchor is capable of tethering to a solid substrate, e.g., a membrane or bead, and a second anchor is capable of tethering to a nanopore. The second anchor of the nanopore can be configured to bind to a tag conjugated to the nanopore. In some embodiments, the second anchor of the nanopore can be configured to bind directly to a tag conjugated to the nanopore. For example, the second anchor of the nanopore can comprise a sequence complementary to a capture polynucleotide tag conjugated to the nanopore. In alternative embodiments, the second tether for the nanopore can be configured to bind indirectly to a tag conjugated to the nanopore. For example, Fig.36 An adaptor shown to be attached to an analyte can be coupled to a tag on a nanopore via a microparticle, which will be described in further detail in the "Microparticle" section below.

[0137] It should be noted that the adaptors described herein can be attached to either or both ends of a double-stranded polynucleotide. In some embodiments, the same adaptor is attached to both ends of a double-stranded polynucleotide. In some embodiments, different adaptors can be attached to the ends of a double-stranded polynucleotide. For example, by mixing two or more different adaptor populations with double-stranded polynucleotides, it is possible to achieve the attachment of different adaptors to the ends of double-stranded polynucleotides. Typically, a mixture of double-stranded polynucleotides attached to different adaptors is formed, but there is also a method for obtaining a desired hetero-adaptor mixture (e.g., by purification or by controlling the attachment of adaptors to the ends of double-stranded polynucleotides).

[0138] In some embodiments, a double-stranded polynucleotide can have an adaptor attached to its 3' end or 5' end.

[0139] A blunt-ended double-stranded polynucleotide can be captured into a nanopore and pulled apart. Thus, in some embodiments, a blunt-ended construct without an adaptor (e.g., one as described herein) can be used in any aspect of the methods described herein. Although not required, in some embodiments, it is desirable to have a leader sequence coupled to at least one end of a double-stranded polynucleotide, for example, to improve capture efficiency of the nanopore.

[0140] In some embodiments where adaptors are attached to both ends of a double-stranded polynucleotide, one of ordinary skill in the art will readily recognize that when a first single-stranded polynucleotide of an adaptor is coupled to the template strand at one end of the double-stranded polynucleotide, a first single-stranded polynucleotide of the other adaptor is coupled to the complementary strand at the opposite end of the double-stranded polynucleotide.

[0141] In some embodiments, the adapter may have a pre-bound polynucleotide binding protein (e.g., a polynucleotide helicase) at each end of the target polynucleotide. In some embodiments, the method may further include adding a polynucleotide binding protein (e.g., a polynucleotide helicase) to the solution so that it binds to the adapter at each end of the target polynucleotide. Fig.10 As shown, each end of the double-stranded polynucleotide is attached to an adaptor as described herein, and a polynucleotide binding protein (e.g., a polynucleotide helicase) is loaded on the adaptor, wherein the adaptor comprises a duplex stem having a capture sequence complementary to a tag conjugated to the nanopore (see, e.g., Fig. 9AAs an example adapter). A single-stranded polynucleotide (which may optionally include a leader sequence) extending from a construct comprising a double-stranded polynucleotide enters a nanopore (Figure A). The first strand entering the nanopore is labeled as a template (T), and the reverse complementary sequence of the captured first strand is labeled as a complementary sequence (C). When the first template strand passes through the hole under the control of a polynucleotide binding protein (e.g., a polynucleotide helicase, such as a helicase motor), the complementary sequence is gradually pulled apart. Figure B shows that at the end of the template strand, the capture sequence in the duplex stem on the complementary sequence is exposed by pulling apart, and is therefore coupled to a tag (e.g., a capture polynucleotide) on the nanopore. In Figure C, when the template strand eventually passes through the nanopore and the enzyme dissociates, the complementary strand remains coupled to the nanopore by binding to a tag (e.g., a capture polynucleotide) on the nanopore. After a certain period of time, the complementary strand is captured by its leader sequence. In Figure D, the complementary strand passes through the nanopore under the control of a second polynucleotide binding protein, such as a polynucleotide helicase such as a helicase motor, on a load. When the complementary strand passes through the nanopore, the capture sequence will be pulled away from the tag (e.g., capture polynucleotide) of the nanopore at a certain moment, thereby releasing the tag (e.g., capture polynucleotide) of the nanopore so that it can be used for the next chain. In this embodiment, both polynucleotide binding proteins (e.g., polynucleotide helicases) are capable of processing double-stranded polynucleotides. In some embodiments, the polynucleotide binding proteins (e.g., polynucleotide helicases) loaded at both ends can be the same or different.

[0142] Although Fig.10 (B) illustrates that exposure of the capture sequence within the duplex (for binding to a tag on the nanopore) occurs near the end of template strand translocation (e.g., capturing a distal adapter, thereby keeping it local to the pore) but more generally, the strands can be designed so that binding of the double-stranded polynucleotide (e.g., via a terminus or tail) to the nanopore can occur just at the beginning of the unzipping process. In this case, the capture sequence can be positioned in the adapter (e.g., as a non-complementary arm of a Y-adapter portion) so that it is exposed for binding to the nanopore throughout the duration of unzipping or even prior to the unzipping process.

[0143] In some embodiments, rather than having a polynucleotide binding protein (e.g., a polynucleotide helicase) bind to an adaptor attached to a target polynucleotide, the polynucleotide binding protein (e.g., a polynucleotide helicase) can be immobilized within the lumen of the nanopore such that a single polynucleotide binding protein (e.g., a polynucleotide helicase) can be used to control the movement of both chains through the nanopore.

[0144] In some embodiments, when a chain is translocated through a nanopore, the chain is unzipped or separated by a polynucleotide binding protein (e.g., a polynucleotide unzipping enzyme). In some embodiments, when a chain is translocated through a nanopore, the chain is unzipped or separated in the absence of a polynucleotide binding protein (e.g., a polynucleotide unzipping enzyme). This enzyme-free method for controlling the movement and / or separation of the two chains of a polynucleotide is known in the art. For example, some nanopores themselves can provide a force that unzips a polynucleotide such as a motor protein nanopore, including, for example, a phi29 motor protein nanopore, for example, as described in Wendell et al. "Translocation of double-stranded DNA through membrane-adapted phi29 motor protein nanopores" Nat Nanotechnol, 4 (2009), pp. 765-772, and / or the nanopore described in U.S. Pat. No. 8,986,528, each of which is incorporated herein by reference in its entirety.

[0145] As used herein, the term "translocation" refers to movement along at least a portion of a nanopore. In some embodiments, the translocation moves from the cis side of the nanopore to the trans side of the nanopore.

[0146] The target polynucleotide is usually present in a sample comprising multiple copies of the target polynucleotide and / or in a sample comprising a variety of different polynucleotides. In some embodiments, the method of any aspect described herein may include determining the sequence of one or more target polynucleotides in the sample. The method may include contacting a hole with two or more double-stranded polynucleotides. For example, the method may include contacting a hole with a sample, wherein substantially all double-stranded polynucleotides have a single-stranded leader sequence on each of its two chains. In some embodiments, the double-stranded polynucleotides are coupled to each other only by complementary base pairing. In these embodiments, the double-stranded polynucleotide may have four free ends, wherein the free end is the end of the polynucleotide chain. The end of the polynucleotide chain may be a single strand, such as a single stranded overhang, or base pairing with another polynucleotide chain. In some embodiments, the two chains of the double-stranded polynucleotide sequenced are not covalently attached (e.g., without a hairpin or other covalent attachment). However, the part that does not bridge the template and the complementary polynucleotide may be added to one or more free ends.

[0147] In some embodiments of various aspects described herein, the method may further include a step of generating a single-stranded leader sequence or attaching it to both strands of substantially all double-stranded polynucleotides in the sample prior to contacting with the nanopore. The added leader sequence may have one or more polynucleotide binding proteins (e.g., polynucleotide helicases) attached thereto, such that the double-stranded polynucleotide population each comprises a leader sequence to which a polynucleotide binding protein (e.g., polynucleotide helicase) is attached at one end of each of its two strands.

[0148] The double-stranded polynucleotide comprising a target polynucleotide (e.g., template) and a polynucleotide complementary to the target polynucleotide (e.g., complementary sequence) can have an adaptor, and the adaptor comprises a single-stranded leader sequence attached to each of its ends. In some embodiments of the method in various aspects, the method may include contacting a hole with two or more polynucleotides that may be identical or different (e.g., polynucleotides helicases). Different polynucleotides binding proteins (e.g., polynucleotides helicases) may be combined with a single leader sequence, which may be identical or different. For example, a polynucleotide binding protein (e.g., polynucleotides helicases) that works in 5' to 3' directions may be combined with a leader sequence at the 5' end of a target polynucleotide and / or the 5' end of a complementary polynucleotide. A polynucleotide binding protein (e.g., polynucleotides helicases) that works in 3' to 5' directions may be combined with a leader sequence at the 3' end of a target polynucleotide and / or the 3' end of a complementary polynucleotide.

[0149] The adapters used in the methods of various aspects described herein can be further configured to allow an analyte (e.g., a target polynucleotide or a non-covalently bound molecule) to bind to the nanopore to increase the sensitivity and / or throughput of the characterization method. This is different from the purpose of embodiments that expose the capture sequence within the duplex of the adapter to allow the second member of the non-covalently bound molecule (e.g., the complementary strand of the double-stranded polynucleotide) to bind, for example, Fig.10 As shown in the figure, it is to increase the possibility of complementary sequence translocation after template translocation, thereby improving the accuracy of sequencing information. Fig.16 As shown in , the adapter is further configured to include a tether for binding to the nanopore, for example, to facilitate capture of the analyte. Thus, before the first member of the analyte (e.g., the template strand of a double-stranded polynucleotide) enters the nanopore, the analyte binds to a first tag conjugated to the nanopore. As the first member translocates through the pore and pulls open the duplex stem to expose the capture sequence on the second member, the second member binds to a second tag conjugated to the nanopore, such that the second member remains close to the nanopore for subsequent characterization after the first member. The first tag and the second tag on the nanopore can be different (e.g., Fig.16), or they may be the same (e.g., as shown in Fig.17A ), which depends on the design of the adaptor.

[0150] Thus, another aspect provided herein relates to a method for determining an analyte characteristic using a nanopore, the method comprising: (a) providing a nanopore modified to comprise at least two or more tags outside the lumen of the nanopore, wherein the tags provide binding sites for at least two or more analytes; (b) contacting a plurality of analytes with the nanopore under conditions such that at least one or more (e.g., at least one, at least two, at least three, at least four, at least five, at least six, at least seven, at least eight, at least nine or more) analytes bind to the tags on the nanopore, while analytes from the plurality translocate through the nanopore.

[0151] Unlike nanopores that are modified, for example, by changing the charge and / or hydrophobicity of amino acids within the nanopore lumen to improve the interaction of the nanopore with the target analyte, the nanopores described herein are modified to provide multiple tags to capture multiple analytes for characterization when the analytes are translocated through the nanopore. This reduces the hole open time for each analyte characterization interval and also increases the local concentration of the analyte, thereby increasing the sensitivity of the method. In some embodiments, a tag-modified nanopore as described in the "Tag or tether-modified nanopore (e.g., for enhancing analyte capture such as polynucleotide capture)" section below can be used to achieve this purpose.

[0152] In some embodiments, the analyte can be modified to bind to a tag on a nanopore. In some embodiments, the analyte comprises an adaptor as described herein, for example, an adaptor comprising an anchor for a nanopore.

[0153] The interaction between the tag on the nanopore and the binding site on the analyte (e.g., a binding site present in an adapter attached to the analyte, wherein the binding site may be provided by an anchor or leader sequence of the adapter or by a capture sequence within the duplex of the adapter) may be reversible. For example, the analyte may bind to the tag on the nanopore, for example, via its adapter, and release at a certain moment, for example, during characterization of the analyte by the nanopore. Strong non-covalent bonds (e.g., biotin / avidin) are still reversible and can be used in some embodiments of the methods described herein. For example, in order to ensure that the complementary sequence of a double-stranded polynucleotide is translocated after template translocation, it may be necessary to design a pair of pore tags and analyte adapters to provide sufficient interaction between the complementary sequence of the double-stranded polynucleotide (or a portion of the adapter attached to the complementary sequence) and the nanopore so that the complementary sequence remains close to the nanopore (without detaching and diffusing from the nanopore during template translocation) but can be released from the nanopore when it is translocated through the nanopore.

[0154] Thus, in some embodiments, a pair of pore tags and analyte adapters used in the methods described herein can be configured such that the binding strength or affinity of a binding site on the analyte (e.g., a binding site present in an adapter attached to the analyte, where the binding site can be provided by an anchor or leader sequence of the adapter or by a capture sequence within the duplex stem of the adapter) to the tag on the nanopore is sufficient to maintain the coupling between the nanopore and the analyte for a period of time until an applied force is exerted thereon to release the bound analyte from the nanopore. In some embodiments where the analyte is a double-stranded polynucleotide, the applied force can be the translocation of the complementary strand end through the nanopore.

[0155] In some embodiments of various aspects described herein, the method may also include, when applying a transmembrane potential, in response to an analyte (e.g., a polynucleotide) passing through a nanopore detection signal. In some embodiments, the potential difference can be driven by providing an osmotic imbalance of ion flow. In some embodiments, a potential difference can be applied across the nanopore between two electrodes located on both sides of the nanopore. The signal can be an electrical measurement and / or an optical measurement. Possible electrical measurements include: current measurement, impedance measurement, tunneling measurement, or electron tunneling measurement (Ivanov AP et al., Nano Lett. January 12, 2011; 11(1): 279-85) and FET measurement (International Application WO 2005 / 124888), such as voltage FET measurement. In some embodiments, the signal can be an electron tunneling across a solid-state nanopore or a voltage FET measurement across a solid-state nanopore. Optical measurement can be combined with electrical measurement (Soni GV et al., Scientific Instrument Review (Rev Sci Instrum.) January 2010; 81(1): 014301). The measurement may be a transmembrane current measurement, such as a measurement of ionic current flowing through a pore. Figures 11A-11B Shown are typical current signals measured over time during sequencing of a double-stranded polynucleotide through a nanopore under the control of a polynucleotide binding protein (eg, a polynucleotide helicase) using the methods described herein.

[0156] Alternatively, the measurement can be a fluorescence measurement indicating the ion flow through the channel, such as by Heron et al., Journal of the American Chemical Society (J.Am.Chem.Soc.) 2009, 131 (5), 1652-1653 disclosed or using a FET to measure the voltage across the membrane. In some embodiments, the method may also include, when a transmembrane potential is applied, detecting the ionic current flowing through the nanopore when the polynucleotide interacts and / or moves through the nanopore. In some embodiments, the method can be performed using a patch clamp or a voltage clamp. In some embodiments, the method can be performed using a voltage clamp. Electrical measurements can be performed using standard signal channel recording equipment, such as Stoddart D et al., Proc Natl Acad Sci, 12; 106(19):7702-7; Lieberman KR et al., J Am Chem Soc. 2010; 132(50):17961-72; and International Application WO 2000 / 28312. Alternatively, electrical measurements can be performed using a multi-channel system, such as described in International Application WO 2009 / 077734 and International Application WO 2011 / 067559.

[0157] A series of nanopores may be provided to increase the throughput and thus increase the measurement of polynucleotide chains, such as disclosed in International Application WO2014 / 064443, the contents of which are incorporated herein by reference.

[0158] Signal measurement analysis

[0159] In some embodiments, the method includes detecting an ion flow corresponding to a hole, indicating an interaction, such as a signal of a polynucleotide translocation through a hole. In some embodiments, the potential difference can be driven by providing an osmotic imbalance of ion flow. In some embodiments, a potential difference can be applied to a transmembrane pore between two electrodes located on both sides of the hole. Alternatively, the measurement can be a fluorescence measurement indicating an ion flow through a channel, such as disclosed in Heron et al., Journal of the American Chemical Society (J.Am.Chem.Soc.) 2009, 131 (5), 1652-1653. A series of nanopores can be provided to increase flux and therefore increase the measurement of polynucleotide chains, such as disclosed in WO2014064443. Figure 4A typical current signal measured over time during translocation of a polynucleotide through a nanopore under enzyme control is shown. When the polynucleotide to be translocated is attached by a hairpin, a non-nucleotide or a modified nucleotide can be provided in the hairpin to provide a signal indicative of the hairpin. The current signal reflects the sequence of the polynucleotide as it translocates through the nanopore. Thus, it can be determined which parts of the signal are indicative of the template and complementary sequence. Typically, the enzyme loosens the polynucleotide through the nanopore, generating a characteristic current level. The magnitude of the signal over time depends on the properties of the nanopore, and more than one nucleotide can affect the current at any particular time.

[0160] In some embodiments, the number of nucleotides affecting the current at any particular time may depend on a set of k nucleotide units, where k is a plural integer, hereinafter referred to as a "k-mer". This can be conceptually thought of as a nanopore with a "blunt-ended reading head" that is larger than the polymer unit being measured. In this case, the number of different k-mers to be solved increases to the power of k. For example, if there are n possible polymer units, the number of different k-mers to be solved is n. k With a high number of k-mers, it may become difficult to resolve the measurements resulting from different k-mers, hindering the estimation of the underlying sequence of the polymer units.

[0161] The current and time sampled data points can be correlated into consecutive groups by performing known analysis techniques such as running a 't-test' which attempts to find changes in the local mean of the signal. These groups are called events. An event indicative of a particular k-mer can be Figure 6 The events are represented by some summary characteristics (the average current and the standard deviation of the average current for the data points in the associated group).

[0162] In order to determine the polynucleotide sequence, in some embodiments, a model can be referenced that takes into account the number of possible transitions between k-mers and also takes into account the current level. Such analysis techniques are disclosed in WO2013041878, which is hereby incorporated by reference, which mentions the use of probabilistic analysis techniques such as hidden Markov models (HMMs) to determine the total number of possible transitions, and wherein the most likely transition is then determined by analysis techniques such as the Viterbi algorithm. Recurrent neural networks (RNNs) can be used as an alternative to HMMs, and provide greater mathematical expression freedom than HMMs in, for example, describing the potential relationship between an event and the number of nucleotides that produced the event. Such methods using RNNs are Figure 7 This is illustrated by an example in , where features are derived from events that contain information from other neighboring events. This provides additional information for RNNs, which are mathematical models whose output depends on previous computations on a sequence of data. Figure 8An example of how the Viterbi algorithm may be employed to determine the path through the possible transitions having the highest likelihood is schematically and simply shown in .

[0163] The most likely transitions between k-mers can be used to determine the k-mer sequence, and thus the nucleotide sequence of the nucleotide chain.Due to the nature of the mathematical methods employed, nucleotide sequences are often expressed in terms of % accuracy.

[0164] In methods involving only measuring template strands, the above methods can be used to determine the template sequence. However, in the case of measuring a template and its reverse complement, the pairing relationship between the template and its complement can provide additional power for sequencing measurements. Examples of specific techniques that exploit this relationship are disclosed in WO2013041878, whereby the template event t i For possible k-mer states sk and complementary sequence events c j The combination of the two matrices for possible k-mer states forms a three-dimensional matrix (2D) model. The 2D model finds the most likely alignment of two series of events, and the k-mers that explain these observations. The model takes into account the combination of template and complementary sequences.

[0165] In principle, a 2D base caller must check (t i ,c j ,s k ) and the possible number of associations between template events, complementary sequence paths, and k specifics. In practice, full 2D calculations become computationally impractical at long read lengths, so a useful approximation constrains a 2D model, as disclosed in WO201514035.

[0166] Alternatively, the determination of the nucleotide sequence can be performed by comparing the template and complementary sequence event data or nucleotide sequence and determining the best association between the template and the complementary sequence. However, this method does not provide a higher 2D model accuracy because it does not consider the highest probability of the combination between the template and the complementary strand. An example of a consensus method for comparing template and complementary sequence base calls is disclosed.

[0167] Unlike the case where the template and the complementary strand are connected by a hairpin, the complementary strand may not always follow the template strand in order to enter the nanopore. For example, after the template strand of the double-stranded construct is translocated, there is a possibility that the template strand from the second double-stranded construct may translocate the nanopore. In addition, after the template (first) strand is translocated, there is a possibility that the complementary (second) strand may not be captured by the binding site of the nanopore. This may be due to, for example, that one or more binding sites of the nanopore have been occupied by one or more complementary strands, so the binding site is not available for the complementary strand. Any complementary strand not captured by the nanopore will likely diffuse from the nanopore without being captured by the nanopore. Therefore, in order to utilize the additional efficacy of the template strand and the complementary strand, it is first necessary to determine whether the signal measurement corresponds to the template and its corresponding complementary sequence.

[0168] In some embodiments of various aspects described herein, the method may also include identifying a signal corresponding to a translocation of the target polynucleotide and a continuous signal corresponding to a separate translocation of a polynucleotide complementary to the target polynucleotide, and analyzing the signals identified in this way. For those signals identified in this way, the nucleotide sequence of the target can be determined using the above-mentioned mathematical method, wherein the method utilizes information of the target (template) and complementary sequence and its related advantages.

[0169] In order to identify whether a signal (e.g., a continuous signal) corresponds to a target and its complementary sequence, events can be compared to each other to determine the degree of alignment. According to the degree of alignment, it can be determined whether the signal actually corresponds to the target and its complementary sequence. The alignment % for generating a positive correlation can be arbitrarily selected and can be, for example, greater than 95%. Known pairwise alignment methods can be used, such as Smith-Waterman or Needleman-Wunsch algorithms. Suitable examples of alignment methods that can be used are disclosed in WO2015 / 140535 or WO 2016 / 059427.

[0170] It has been observed that, in general, the complementary strand follows its template strand into the nanopore or diffuses from the nanopore in a continuous order. After another strand unrelated to the particular complementary strand enters the nanopore, the probability that the complementary strand follows its template strand is much lower. Template and complementary sequence pairs have unique features. For example, template / complementary sequence pairs generally tend to have nucleotides of the same length (number of events). In addition, the follower strand of the pair can enter the nanopore much faster than the new strand, and / or the sequencing of the complementary sequence tends to be faster, etc. One or more of these features can be used to identify template / complementary sequence pairs without complex computational analysis.

[0171] In some embodiments, in order to reduce the computational requirements, the comparison can be limited to adjacent chain measurements. Once the template-complementary sequence relationship between chains has been established, the determination of sequence can utilize the measurement of template or complementary chain or the measurement of template and complementary chain. For example, the sequence of template chain can be determined, wherein it can be considered that the sequencing accuracy is not high enough. In this case, the method can be selected to determine the sequence by considering template and complementary sequence data, so as to provide a sequence accuracy higher than that only obtained by determining the template sequence. Alternatively, it can be considered that the sequence accuracy of the template chain is good enough, so that it is not necessary to consider template and complementary sequence data. Determine whether to use template sequence data or whether to use the factor of template and complementary sequence data can be such as whether the basic sequence has a base or base group that is difficult to accurately identify, or such as whether a specific base is a single nucleotide polymorphism variant.

[0172] In the case where the sequence relationship is not determined, the sequence of the specific strand can be determined in the same manner as that performed for measurements of the template strand alone. In the case where the sequence relationship is determined, the sequence of the specific strand can be determined in the same manner as that performed for measurements of the template and complementary strands. This information can be combined to provide an overall sequence determination.

[0173] In some embodiments, the methods described herein further include analyzing the signal generated when the first strand (e.g., target polynucleotide) translocates through the transmembrane pore and the signal generated when the second strand complementary to the first strand translocates through the same nanopore. The first strand (e.g., target polynucleotide) and its complementary sequence (the second strand) are connected by base pairing. Thus, once the first polynucleotide binding protein (e.g., polynucleotide helicase) moves along the length of the double-stranded polynucleotide, the first strand and the second strand are no longer connected. See, e.g., Fig.10 Thus, translocation of the second strand through the nanopore is a separate event from translocation of the first strand through the nanopore, as shown, for example, in FIG. 11 , where an open pore current of about 200 pA is observed between translocation of the first and second strands (without the strand blocking the current). Although not required, it is desirable that translocation of the second strand occurs as soon as possible, e.g., immediately (e.g., in less than 1 second), after translocation of the first strand. See, e.g., Fig.13 .

[0174] The method includes the step of identifying the signal of the continuous translocation corresponding to the target polynucleotide and the polynucleotide complementary to the target polynucleotide.Continuous translocation includes the situation that the complementary polynucleotide translocation passes through the hole identical with the target polynucleotide.The target polynucleotide and the complementary polynucleotide can be translocated through the hole in any order.Other polynucleotides, such as 1,2,3,4 or 5 to about 10 polynucleotides can pass through the hole between the target polynucleotide and the complementary polynucleotide.Preferably, the target polynucleotide and the complementary polynucleotide pass through the hole continuously in any order.The hole preferably recovers the open state between the first target polynucleotide and the complementary polynucleotide translocation through the hole and the second target polynucleotide and the complementary polynucleotide translocation through the hole.

[0175] By tethering the target polynucleotide and / or complementary polynucleotide to the membrane and / or pore, the continuous passage of the target polynucleotide and complementary polynucleotide through the pore can be promoted. Other methods of promoting continuous translocation of the two strands of a double-stranded polynucleotide include attaching the target polynucleotide and / or complementary polynucleotide to microparticles and / or modifying the pore to increase / enhance polynucleotide capture.

[0176] Barcodes can be used to promote the identification of continuous signals corresponding to the signal of target polynucleotide translocation and the single translocation of the polynucleotide complementary to the target polynucleotide. Typically, double-stranded barcodes are included in or attached to double-stranded polynucleotides. When the target polynucleotide and the complementary polynucleotide are separated (by polynucleotide binding protein (e.g., polynucleotide helicase)), the barcode is retained in both the target polynucleotide and the complementary polynucleotide. The barcode translocation will produce a signal unique to the barcode by a transmembrane hole. The second and subsequent detection of the barcode translocation through the hole can be used to determine that the target polynucleotide and its complementary sequence have been translocated successively through the hole. Thus, the translocation corresponding to the target polynucleotide and the signal corresponding to the single translocation of the polynucleotide complementary to the target polynucleotide can be identified.

[0177] Nanopores modified with tags or tethers (e.g., for enhanced analyte capture, such as polynucleotide capture)

[0178] The nanopore used in the methods described herein is modified to include one or more binding sites for binding one or more analytes. In some embodiments, the nanopore can be modified to include one or more binding sites for binding an adaptor attached to the analyte. For example, in some embodiments, the nanopore can bind to a leader sequence of an adaptor attached to the analyte. In some embodiments, the nanopore can bind to a single-stranded sequence in an adaptor attached to the analyte. In some embodiments, the nanopore can bind to a capture sequence within a duplex of an adaptor attached to the analyte, wherein the capture sequence is revealed only when the duplex stem is unzipped.

[0179] In some embodiments, the nanopore can be modified to include one or more binding sites for binding an adaptor attached to the first or second strand of a double-stranded oligonucleotide, for example, to facilitate sequential translocation of the first and second strands through the transmembrane pore.

[0180] In some embodiments, the nanopore is modified to include one or more tags or tethers, each tag or tether comprising a binding site for an analyte.

[0181] In some embodiments, the nanopore is modified to include two or more tags or tethers. For example, one tag or tether can be provided to increase the sensitivity of a method for characterizing an analyte such as a polynucleotide (a "sensitivity tag"), while another tag or tether can be provided to increase the likelihood of sequencing the complementary strand following the template strand of the polynucleotide (a "follow-up tag"). Fig.15 As shown, the hole tag can be constructed in a variety of ways. Just by way of example, in some embodiments, each monomer of the oligomeric hole can have the same type of tag configuration (e.g., having multiple binding sites, as shown in Tag-A and Tag-B). Tag-A and Tag-B can be combined to form a single tag, and at least one or more monomers contain a Tag-A / Tag-B combination tag. Alternatively, the oligomeric hole may contain mixed monomers with different tags attached, so that at least one monomer has a different tag configuration from other monomers. In another example, Tag-A and Tag-B can remain as separate tags, and at least one or more monomers can include two separate tags. If the sensitivity tag and the follow-up tag are complementary to the unique sequence used in the adapter as described herein, they can be combined separately.

[0182] Fig.16 Schematic diagram of how nanopores with two different tag types can be used to capture strands from solution (in order to increase sensitivity). An adaptor attached to the end of a double-stranded polynucleotide contains a capture sequence that can be used to couple to a first well tag (e.g., forming a non-complementary arm of a Y-adapter), while a separate capture sequence within the duplex stem that is only revealed when pulled apart allows the complementary sequence to bind to the second well tag, thus enabling complementary sequence capture for subsequent sequencing.

[0183] The interaction between the tag on the nanopore and the binding site on the analyte (e.g., a binding site present in an adapter attached to the analyte, wherein the binding site may be provided by an anchor or leader sequence of the adapter or by a capture sequence within the duplex of the adapter) may be reversible. For example, the analyte may bind to the tag on the nanopore, for example, via its adapter, and release at a certain moment, for example, during characterization of the analyte by the nanopore. Strong non-covalent bonds (e.g., biotin / avidin) are still reversible and can be used in some embodiments of the methods described herein. For example, in order to ensure that the complementary sequence of a double-stranded polynucleotide is translocated after template translocation, it may be necessary to design a pair of pore tags and analyte adapters to provide sufficient interaction between the complementary sequence of the double-stranded polynucleotide (or a portion of the adapter attached to the complementary sequence) and the nanopore so that the complementary sequence remains close to the nanopore (without detaching and diffusing from the nanopore during template translocation) but can be released from the nanopore when it is translocated through the nanopore.

[0184] Thus, in some embodiments of various aspects described herein, a pair of pore tags and analyte adapters can be configured such that the binding strength or affinity of a binding site on the analyte (e.g., a binding site present in an adapter attached to the analyte, where the binding site can be provided by an anchor or leader sequence of the adapter or by a capture sequence within the duplex stem of the adapter) to the tag on the nanopore is sufficient to maintain the coupling between the nanopore and the analyte until an applied force is exerted thereon to release the bound analyte from the nanopore. In some embodiments where the analyte is a double-stranded polynucleotide, the applied force can be the translocation of the complementary strand end through the nanopore.

[0185] In some embodiments, the tag or tether is uncharged. This can ensure that the tag or tether is not drawn into the nanopore under the influence of the potential difference.

[0186] One or more molecules that attract or bind polynucleotides or adapters can be connected to the hole. Any molecule that hybridizes with adapters and / or target polynucleotides can be used. The molecules attached to the hole can be selected from PNA tags, PEG linkers, short oligonucleotides, positively charged amino acids and aptamers. Holes with such molecules connected to them are known in the art. For example, Howarka et al. (2001) Nature Biotech.19:636-639 and WO 2010 / 086620 disclose holes with short oligonucleotides attached thereto, and Howarka et al. (2000) J.Am.Chem.Soc.122 (11):2411-2416 disclose holes comprising PEG attached to the inner cavity of the hole.

[0187] A short oligonucleotide attached to a transmembrane pore, the oligonucleotide comprising a sequence complementary to a sequence in a leader sequence or another single-stranded sequence in an adaptor, can be used to enhance capture of a target polynucleotide and / or a complementary polynucleotide in the methods of any aspect described herein.

[0188] In some embodiments, the tag or tether may include or be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino). The oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino) may have a length of about 10-30 nucleotides or a length of about 10-20 nucleotides. Exemplary oligonucleotides (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino) may include the sequence shown in SEQ ID NO:8. In some embodiments, the oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino) used in the tag or tether may have at least one end (e.g., 3'- or 5'-end) modified for conjugation to other modifications or solid substrate surfaces (including, for example, beads). The end modifier may add reactive functional groups that can be used for conjugation. Examples of functional groups that can be added include, but are not limited to, amino, carboxyl, thiol, maleimide, aminooxy, and any combination thereof. Functional groups can be combined with spacers of different lengths (e.g., C3, C9, C12, spacers 9 and 18) to increase the physical distance between the functional group and the end of the oligonucleotide sequence. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA or morpholino) having a sequence with a 5'-maleamide modification as shown in SEQ ID NO:8. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA or morpholino) having a sequence with a 3'-maleamide modification as shown in SEQ ID NO:8. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, or PNA) having a sequence with a 5'-C9-thiol modification as shown in SEQ ID NO:8. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA or morpholino) having a sequence with a 3'-C9-thiol modification as shown in SEQ ID NO:8. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino) having a sequence with a 5'-thiol modification as shown in SEQ ID NO: 8. In some embodiments, the tag or tether can be an oligonucleotide (e.g., DNA, RNA, LNA, BNA, PNA, or morpholino) having a sequence with a 3'-thiol modification as shown in SEQ ID NO: 8.

[0189] In some embodiments, the tag or tether may include or be a morpholino oligonucleotide. The morpholino oligonucleotide may have a length of about 10-30 nucleotides or a length of about 10-20 nucleotides. An exemplary morpholino oligonucleotide may include the sequence shown in SEQ ID NO:8. The morpholino oligonucleotide may be modified or unmodified. For example, in some embodiments, the morpholino oligonucleotide may be modified at the 3' and / or 5' ends of the oligonucleotide. Examples of modifications on the 3' and / or 5' ends of the morpholino oligonucleotide include, but are not limited to, 3' affinity tags and functional groups for chemical attachment (including, for example, 3'-biotin, 3'-primary amines, 3'-disulfide amides, 3'-pyridyl disulfide groups, and any combination thereof); 5' end modifications (including, for example, 5'-primary amines and / or 5'-dabcyl), modifications for click chemistry (including, for example, 3'-azides, 3'-alkynes, 5'-azides, 5'-alkynes) and any combination thereof. In some embodiments, the tag or tether can be a morpholino oligonucleotide having a sequence with a 5'-azide modification as shown in SEQ ID NO: 8. In some embodiments, the tag or tether can be a morpholino oligonucleotide having a sequence with a 3'-azide modification as shown in SEQ ID NO: 8. In some embodiments, the tag or tether can be a morpholino oligonucleotide having a sequence with a 5'-alkyne modification as shown in SEQ ID NO: 8. In some embodiments, the tag or tether can be a morpholino oligonucleotide having a sequence with a 3'-alkyne modification as shown in SEQ ID NO: 8. In some embodiments, the tag or tether can be a morpholino oligonucleotide having a sequence with a 3'-pyridyldisulfide modification as shown in SEQ ID NO: 8.

[0190] In some embodiments, the tag or tether may also include a polymer joint, for example, to promote coupling with a nanopore. Exemplary polymer joints include, but are not limited to, polyethylene glycol (PEG). The polymer joint may have a molecular weight of about 500Da to about 10kDa (including end values), or about 1kDa to about 5kDa (including end values). The polymer joint (e.g., PEG) can be functionalized with different functional groups, including, for example, but not limited to maleimide, NHS ester, dibenzocyclooctyne (DBCO), azide, biotin, amine, alkyne, aldehyde, and any combination thereof. In some embodiments, the tag or tether may also include a 1kDa PEG with a 5'-maleimide group and a 3'-DBCO group. In some embodiments, the tag or tether may also include a 2kDa PEG with a 5'-maleimide group and a 3'-DBCO group. In some embodiments, the tag or tether may also include a 3kDa PEG with a 5'-maleimide group and a 3'-DBCO group. In some embodiments, the tag or tether may also comprise a 5 kDa PEG having a 5'-maleimide group and a 3'-DBCO group.

[0191] Other examples of tags or tethers include, but are not limited to, a His tag, biotin or streptavidin, an antibody that binds the analyte, an adaptor that binds the analyte, an analyte binding domain such as a DNA binding domain (including, for example, peptide zippers such as leucine zippers, single-stranded DNA binding proteins (SSBs)), and any combination thereof.

[0192] The label or tether can be attached to the outer surface of the nanopore using any method known in the art, for example, on the cis side of the film. For example, one or more labels or tethers can be attached to the nanopore by one or more cysteines (cysteine ​​bonds), one or more primary amines such as lysine, one or more non-natural amino acids, one or more histidines (His tags), one or more biotins or streptavidin, one or more antibody-based labels, one or more enzyme modifications of epitopes (including, for example, acetyltransferases) and any combination thereof. Suitable methods for performing such modifications are well known in the art. Suitable non-natural amino acids include, but are not limited to, 4-azido-L-phenylalanine (Faz), and Liu CC and Schultz PG, Annu.Rev.Biochem., 2010, 79, any of the amino acids numbered 1-71 in Figure 1 of 413-444.

[0193] In some embodiments where one or more tags or tethers are attached to the nanopore via cysteine ​​linkages, the one or more cysteines can be introduced into one or more monomers forming the nanopore by substitution. In some embodiments, the nanopore can be chemically modified by attaching: (i) maleimides, including dibromomaleimides such as: 4-phenylazomaleinanil, 1.N-(2-hydroxyethyl)maleimide, N-cyclohexylmaleimide, 1.3-maleimidopropionic acid, 1.1-4-aminophenyl-1H-pyrrole, 2,5, dione, 1.1-4-hydroxyphenyl-1H-pyrrole, 2,5, dione, N-ethylmaleimide, N-methoxycarbonylmaleimide, N-tert-butylmaleimide, N-(2-aminoethyl)maleimide, 3-maleimido-PROXYL, N-(4-chlorophenyl)maleimide, 1-[4-(dimethylamino)-3,5-dinitrophenyl]-1H-pyrrole-2,5-dione, N-[4-(2-benzimidazolyl)phenyl]maleimide, N-[4-(2-benzoxazolyl)phenyl] ] maleimide, N-(1-naphthyl) maleimide, N-(2,4-dimethylphenyl) maleimide, N-(2,4-difluorophenyl) maleimide, N-(3-chloro-p-methylphenyl) maleimide, 1-(2-amino-ethyl)-pyrrole-2,5-dione hydrochloride, 1-cyclopentyl-3-methyl-2,5-dihydro-1H-pyrrole-2,5-dione, 1-(3-aminopropyl)-2,5-dihydro-1H-pyrrole-2,5-dione salt Hydrochloride, 3-methyl-1-[2-oxo-2-(piperazin-1-yl)ethyl]-2,5-dihydro-1H-pyrrole-2,5-dione hydrochloride, 1-benzyl-2,5-dihydro-1H-pyrrole-2,5-dione, 3-methyl-1-(3,3,3-trifluoropropyl)-2,5-dihydro-1H-pyrrole-2,5-dione, 1-[4-(methylamino)cyclohexyl]-2,5-dihydro-1H-pyrrole-2,5-dione trifluoroacetic acid, SMILES O=C1C=CC(=O)N1CC=2C=CN=CC2, SMILES O=C1C=CC(=O)N1CN2CCNCC2, 1-benzyl-3-methyl-2,5-dihydro-1H-pyrrole-2,5-dione, 1-(2-fluorophenyl)-3-methyl-2,5-dihydro-1H-pyrrole-2,5-dione, N-(4-phenoxyphenyl)maleimide, N-(4-nitrophenyl)maleimide;(ii) iodoacetamides, such as 3-(2-iodoacetylamino)-PROXYL, N-(cyclopropylmethyl)-2-iodoacetamide, 2-iodo-N-(2-phenylethyl)acetamide, 2-iodo-N-(2,2,2-trifluoroethyl)acetamide, N-(4-acetylphenyl)-2-iodoacetamide, N-(4-(aminosulfonyl)phenyl)-2-iodoacetamide, N-(1,3-benzothiazol-2-yl)-2-iodoacetamide, N-(2,6-diethyl)acetamide (iii) bromoacetamides such as N-(4-(acetylamino)phenyl)-2-bromoacetamide, N-(2-acetylphenyl)-2-bromoacetamide, 2-bromo-N-(2-cyanophenyl)acetamide, 2-bromo-N-(3-(trifluoromethyl)phenyl)acetamide, N-(2-benzoylphenyl)-2-bromoacetamide, 2-bromo-N-(4-fluorophenyl)acetamide )-3-methylbutanamide, N-benzyl 2-bromo-N-phenylpropionamide, N-(2-bromo-butyryl)-4-chloro-benzenesulfonamide, 2-bromo-N-methyl-N-phenylacetamide, 2-bromo-N-phenethyl-acetamide, 2-adamantan-1-yl-2-bromo-N-cyclohexyl-acetamide, 2-bromo-N-(2-methylphenyl)butanamide, acetyl-p-bromoaniline; (iv) disulfides, such as ALDRITHIOL-2, ALDRITHIOL-4, isobutylenesulfonamide, Propyl disulfide, 1-(isobutyldisulfanyl)-2-methylpropane, dibenzyl disulfide, 4-aminophenyl disulfide, 3-(2-pyridyldithio)propionic acid, 3-(2-pyridyldithio)propionic acid hydrazide, 3-(2-pyridyldithio)propionic acid N-succinimidyl ester, am6amPDP1-βCD; and (v) thiols, such as: 4-phenylthiazole-2-thiol, Pulpald, 5,6,7,8-tetrahydro-quinazoline-2-thiol. ;

[0194] In some embodiments, the tag or tether can be attached directly to the nanopore or through one or more linkers. The tag or tether can be connected to the nanopore using a hybrid linker described in WO 2010 / 086602. Alternatively, a peptide linker can be used. A peptide linker is an amino acid sequence. The length, flexibility and hydrophilicity of the peptide linker are generally designed so that it does not interfere with the function of the monomer and the pore. Preferred flexible peptide linkers are stretches of 2 to 20, such as 4, 6, 8, 10 or 16 serines and / or glycines. More preferred flexible linkers include (SG)1, (SG)2, (SG)3, (SG)4, (SG)5 and (SG)8, wherein S is serine and G is glycine. Preferred rigid linkers are stretches of 2 to 30, such as 4, 6, 8, 16 or 24 prolines. More preferred rigid linkers include (P) 12 , where P is proline.

[0195] The transmembrane pore can be modified to enhance capture of polynucleotides. For example, the pore can be modified to increase the positive charge within the entrance to the pore and / or within the barrel of the pore. Such modifications are known in the art. For example, WO 2010 / 055307 discloses mutations in α-hemolysin that increase the positive charge within the barrel of the pore.

[0196] Modified MspA, lysenin and CsgG pores comprising mutations that enhance polynucleotide capture are disclosed in WO 2012 / 107778, WO 2013 / 153359 and WO 2016 / 034591, respectively. Any modified pore disclosed in these publications may be used herein.

[0197] In some embodiments, the CsgG nanopore can be modified to include one or more tags or tethers as described herein. One or more tags or tethers can be attached to one or more monomers (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or more) of the CsgG nanopore by amino acid modification at the following positions: T3, K7, R11, Q19, K22, A29, T31, R76, N102, G103, N108, R110, Q114, E170, C215, L216, D238, A243, D248, and H255 of SEQ ID NO:7. In some embodiments, one or more tags or tethers can be attached to one or more monomers (e.g., 1, 2, 3, 4, 5, 6, 7, 8, 9 or more) of a CsgG nanopore by amino acid substitutions at the following positions: T3C, K7C, R11C, Q19C, K22C, A29C, T31C, R76C, E170C, D238C, A243C, D248C, H255C, C215A / T / S / M / G / I / L, L216V of SEQ ID NO:7.

[0198] In some embodiments, the CsgG nanopore may be further modified to improve capture and / or translocation of analytes through the nanopore, to improve analyte (e.g., polynucleotide) recognition or discrimination, to improve interaction with polynucleotide helicases, and / or to improve signal-to-noise ratios. For example, in some embodiments, at least one monomer forming the CsgG nanopore may comprise one or more mutations as disclosed in WO2016 / 034591.

[0199] In some embodiments, the CsgG nanopore may comprise one of the following combinations of amino acid substitutions (relative to SEQ ID NO: 7): (T3C); (K7C); (R11C); (Q19C); (K22C); (A29C); (T31C); (R76C); (E170C); (D238C); (A243C); (D248C); (H255C); (C215A); (C215T); (C215S); (C215M); (C215G); (C215I); (C215L); (C215A, L216V); (A29C, C215T); (T31C, C215T); (R76C, C215T); (T3C, C215A); ( (R76C, C215A); (E170C, C215A); (C215A, D238C); (C215A, A243C); (C215A, D248C); (C215A, H255C); (R76C, N91R, C215A); (R76C, N91R, C215A); (R76C, C215A); and (R76C, C215T).

[0200] Polynucleotide

[0201] Polynucleotides can be nucleic acids, such as deoxyribonucleic acid (DNA) or ribonucleic acid (RNA). Polynucleotides can include an RNA chain hybridized with a DNA chain. Polynucleotides can be any synthetic nucleic acid known in the art, such as peptide nucleic acid (PNA), glycerol nucleic acid (GNA), threose nucleic acid (TNA), locked nucleic acid (LNA) or other synthetic polymers with nucleotide side chains. The PNA backbone is composed of repeated N-(2-aminoethyl)-glycine units connected by peptide bonds. The GNA backbone is composed of repeated diol units connected by phosphodiester bonds. The TNA backbone is composed of repeated threose linked together by phosphodiester bonds. LNA is formed by ribonucleotides with additional bridges connecting 2' oxygen and 4' carbon in the ribose moiety as discussed above.

[0202] The polynucleotide is preferably DNA, RNA or a DNA or RNA hybrid, most preferably DNA. The target polynucleotide can be double-stranded. The target polynucleotide can include a single-stranded region and a region with other structures, such as a hairpin loop, a triplex and / or a quadruplex. The DNA / RNA hybrid can include DNA and RNA on the same chain. Preferably, the DNA / RNA hybrid includes a DNA chain hybridized with an RNA chain.

[0203] In some embodiments, the target polynucleotide does not contain a hairpin structure or any covalent connection connecting the template and the complementary sequence. In some embodiments, the target polynucleotide (e.g., template) and the polynucleotide complementary to the target polynucleotide (e.g., complementary sequence) are not connected by a bridging portion such as a hairpin loop. However, in some embodiments, when a single strand (e.g., template or complementary sequence) is translocated through a nanopore, the strand itself can form a hairpin structure due to the interaction of the adapter at both ends. See, for example, Fig.19 This adaptor design can be beneficial for characterizing long polynucleotides, for example, by keeping the other end of the strand close to the nanopore.

[0204] The target polynucleotide can be any length. For example, the length of the polynucleotide can be at least 10, at least 50, at least 100, at least 150, at least 200, at least 250, at least 300, at least 400 or at least 500 nucleotides or nucleotide pairs. The target polynucleotide can be 1000 or more nucleotides or nucleotide pairs, a length of 5000 or more nucleotides or nucleotide pairs, a length of 100000 or more nucleotides or nucleotide pairs, or a length of 500,000 or more nucleotides or nucleotide pairs, or a length of 1,000,000 or more nucleotides or nucleotide pairs, a length of 10,000,000 or more nucleotides or nucleotide pairs, or a length of 100,000,000 or more nucleotides or nucleotide pairs, or a length of 200,000,000 or more nucleotides or nucleotide pairs, or the entire length of a chromosome. The target polynucleotide can be an oligonucleotide. Oligonucleotide is a short nucleotide polymer, which has 50 or less nucleotides conventionally, such as 40 or less, 30 or less, 20 or less, 10 or less or 5 or less nucleotides. The length of the target oligonucleotide is preferably about 15 to about 30 nucleotides, and for example a length is about 20 to about 25 nucleotides. For example, the length of the oligonucleotide can be about 15, about 16, about 17, about 18, about 19, about 20, about 21, about 22, about 23, about 24, about 25, about 26, about 27, about 28, about 29 or about 30 nucleotides.

[0205] The target polynucleotide can be a fragment of a longer target polynucleotide. In this embodiment, the longer target polynucleotide is usually fragmented into a plurality of, for example, two or more shorter target polynucleotides. The method of the present invention can be used for sequencing one or more, for example, 2, 3, 4, 5 or more of those shorter target polynucleotides.

[0206] In some embodiments, the methods of various aspects described herein can be used to sample multiple target polynucleotides within a sample, such as 2, 3, 4, or 5 to 10, 15, 20 or more polynucleotides.

[0207] In some embodiments, various aspects of the methods described herein can be used to sequence polynucleotides present in double-stranded form in a sample.

[0208] In some embodiments, the methods of various aspects described herein can be used to sequence a single-stranded polynucleotide by first synthesizing the complementary sequence of the single-stranded polynucleotide to produce a double-stranded polynucleotide. For example, the single-stranded polynucleotide can be RNA, such as mRNA, and a complementary cDNA strand can be synthesized to produce a double-stranded polynucleotide for sequencing in the methods of the present invention. For example, the single-stranded polynucleotide can be DNA, and a complementary strand can be synthesized to produce a double-stranded DNA polynucleotide for sequencing in the methods of the present invention.

[0209] In some embodiments, the polynucleotide can be a polynucleotide connected in series. The method of connecting polynucleotides in series is described in PCT / GB2017 / 051493. In one embodiment, the attachment method for connecting polynucleotides together is click chemistry. In this embodiment, when the template and the complementary sequence are not covalently linked, the template (the first strand captured) and the complementary sequence (the reverse complementary sequence of the first strand) of the first double-stranded polynucleotide are characterized using a nanopore. When the template and the complementary sequence are separated, the sequence complementary to the hole tether in the follow-up adapter connected to the first double-stranded polynucleotide is exposed in the complementary sequence, and the complementary sequence is attached to the hole tether of the nanopore. In this embodiment, the tandem adapter is also connected to the first double-stranded polynucleotide so that the complementary chain can be connected to the second double-stranded polynucleotide.

[0210] A tandem adapter complex containing a motor protein and a release protein is prepared. The tandem adapter can be connected to both ends of the target polynucleotide. Both the motor protein and the release protein can be stalled on the connected adapter complex until the polynucleotide is captured by the hole. Once the first polynucleotide is captured, the blocking chemical is overcome by the two proteins, and the motor protein controls the interaction of the polynucleotide with the hole as described above. The release protein, which can translocate faster than the motor protein, reaches the 3' of the first polynucleotide to release a hybridization site complementary to the 5' nucleic acid sequence of the leading strand of the tandem adapter complex. By revealing the hybridization site, the second polynucleotide can then hybridize with the revealed site, and covalent coupling of the 3' end of the first polynucleotide to the 5' of the second polynucleotide can occur ( Fig.43 ). The process is then repeated to further connect target polynucleotides.

[0211] In one embodiment, a method for characterizing and concatenating double-stranded target polynucleotides is provided, wherein the attachment method is non-covalent. In this embodiment, the complementary chain of the first double-stranded target polynucleotide recruits the second double-stranded target polynucleotide and makes it reach the local concentration of the hole. In turn, when the first complementary chain is sequenced, the second double-stranded target polynucleotide recruited becomes dehybridized from the complementary chain, but hybridizes with the hole tether. This enables the first and second (and subsequently, the third, fourth, fifth, etc.) double-stranded target polynucleotides to follow each other through the hole, with the shortest chain interval time. When the concentration of double-stranded target polynucleotides is low, this is particularly useful because the second target polynucleotide can be recruited when sequencing the first target polynucleotide.

[0212] In another embodiment, methods of characterizing and concatenating double-stranded target polynucleotides (e.g., where the attachment method is non-covalent) can be performed using a two-component fishing tether that provides a second hybridization site for the follower sequence and the hole tether to increase the proportion of events seen.

[0213] In one embodiment, a method for characterizing and concatenating a plurality of double-stranded target polynucleotides (e.g., wherein the attachment method is non-covalent) can be used to bring a plurality, e.g., 2 to 20, e.g., 4, 5, 6, 8, 10, 12, or 15 double-stranded target polynucleotides to a hole. The complementary chain of the first double-stranded target polynucleotide can recruit other double-stranded target polynucleotides and concentrate them near the hole. This provides a higher local concentration around the hole than in a general bulk solution, so the double-stranded target polynucleotides follow each other through the opening, with the shortest chain interval time. This is particularly useful when the concentration of the double-stranded target polynucleotide is low. In this embodiment, a tether consisting of an oligonucleotide coupled to a single-stranded binding protein can be used. When the template chain of the first double-stranded target polynucleotide is sequenced, the complementary chain is released into the solution as ssDNA. The single-stranded binding proteins of other double-stranded target polynucleotides can bind to ssDNA. As part of the following process, when the complementary chain is sequenced, the 3' of the complementary chain is pulled back into the hole. The single-stranded binding protein on the complementary strand of the ssDNA is displaced from the complementary strand upon encountering the motor protein that controls the movement of the complementary sequence through the pore, and thus deposits around the pore, increasing the local concentration. Fig.44 This analyte trawling can be performed if the sequence of the target polynucleotide is known, but it is also possible to add complementary sequence to the 3' of the pore tether, which can be used to tile segments of the complementary strand.

[0214] sample

[0215] Analytes (including, for example, proteins, peptides, molecules, polypeptides, polynucleotides) can be present in a sample. The sample can be any suitable sample. The sample can be a biological sample. Any embodiment of the methods described herein can be performed in vitro on a sample obtained or extracted from any organism or microorganism. The organism or microorganism is typically an archaebacterium, a prokaryotic or eukaryotic microorganism, and typically belongs to one of the following five kingdoms: plant kingdom, animal kingdom, fungi kingdom, prokaryotes kingdom, and protist kingdom. In some embodiments, the methods of various aspects described herein can be performed in vitro on a sample obtained or extracted from any virus.

[0216] The sample is preferably a fluid sample. The sample generally comprises a body fluid. The body fluid may be obtained from a human or an animal. The human or animal may be suffering from a disease, suspected of suffering from a disease or at risk of disease. The sample may be urine, lymph, saliva, mucus, semen or amniotic fluid, but preferably whole blood, plasma or serum. Typically, the sample is derived from a human, but it may alternatively be from another mammal, such as from a commercially raised animal, such as a horse, cow, sheep or pig, or may alternatively be a pet, such as a cat or dog.

[0217] Alternatively, plant-derived samples are typically obtained from cash crops such as cereals, legumes, fruits or vegetables, for example wheat, barley, oats, rapeseed, corn, soybeans, rice, bananas, apples, tomatoes, potatoes, grapes, tobacco, beans, lentils, sugar cane, cocoa, cotton, tea or coffee.

[0218] The sample may be a non-biological sample. The non-biological sample is preferably a fluid sample. Examples of non-biological samples include surgical fluids; water, such as drinking water, sea water or river water; and reagents for laboratory testing.

[0219] The sample may be processed prior to analysis, for example by centrifugation or passing through a membrane that filters out unwanted molecules or cells, such as red blood cells. The sample may be measured immediately after acquisition. The sample may also be stored, preferably below -70°C, prior to analysis.

[0220] In some embodiments, the sample may include genomic DNA. The genomic DNA may be fragmented, or any method described herein may further include fragmenting the genomic DNA. The DNA may be fragmented by any suitable method. For example, methods for fragmenting DNA are known in the art. Such methods may use a transposase, such as a MuA transposase.

[0221] Preamble sequence

[0222] The leader sequence typically comprises a polymer. The polymer is preferably negatively charged. The polymer is preferably a polynucleotide, such as DNA or RNA; a modified polynucleotide (such as abasic DNA); PNA; LNA; polyethylene glycol (PEG) or a polypeptide. The leader sequence preferably comprises a polynucleotide, and more preferably comprises a single-stranded polynucleotide. The single-stranded leader sequence most preferably comprises a single strand of DNA, such as a poly dT segment. The leader sequence preferably comprises one or more spacers.

[0223] The leader sequence may be of any length, but is typically 10 to 150 nucleotides in length, for example 20 to 150 nucleotides in length. The length of the leader sequence will typically depend on the transmembrane pore used in the method.

[0224] The leader sequence preferentially threads into the transmembrane pore and thereby facilitates movement of the polynucleotide through the pore.The leader sequence may also be used to link the polynucleotide to one or more anchors as discussed herein.

[0225] Generally, the leader sequence is present in one end of the target polynucleotide and one end of the polynucleotide complementary to the target polynucleotide. The leader sequence may be present in the 5' end of the target polynucleotide and the 5' end of the complementary sequence of the target polynucleotide. Alternatively, the leader sequence may be present in the 3' end of the target polynucleotide and the 3' end of the complementary sequence of the target polynucleotide. The leader sequence may be present in the 5' end of the target polynucleotide and the 3' end of the complementary sequence of the target polynucleotide, or vice versa. In these embodiments below, two different polynucleotide binding proteins (e.g., polynucleotide helicases) are generally used, wherein the first polynucleotide binding protein (e.g., polynucleotide helicases) moves along the polynucleotide with 5' to 3' directions and the second polynucleotide binding protein (e.g., polynucleotide helicases) moves along the polynucleotide with 3' to 5' directions.

[0226] The leader sequence can be attached to the double-stranded polynucleotide by any suitable method. For example, the leader sequence can be connected to the target polynucleotide and / or its complementary sequence. Alternatively, the leader sequence can be generated by digesting one strand of the double-stranded polynucleotide to produce a single-stranded overhang on the other strand.

[0227] The polynucleotide binding protein (e.g., a polynucleotide helicase) can bind to the leader sequence before attaching to the target polynucleotide or its complementary sequence. The polynucleotide binding protein (e.g., a polynucleotide helicase) can bind to the leader sequence present in the double-stranded polynucleotide. The activity of the polynucleotide binding protein (e.g., a polynucleotide helicase) bound to the leader sequence can stagnate until the polynucleotide contacts the transmembrane pore. Methods for stagnating polynucleotide binding proteins (e.g., polynucleotide helicases) are known in the art, such as in WO 2014 / 135838.

[0228] Adaptor

[0229] The leader sequence may be present in an adaptor, wherein the adaptor comprises a double-stranded region (e.g., a duplex stem) and at least one single-stranded region. At least one of the single-stranded regions may be a leader sequence. The adaptor may comprise at least one non-polynucleotide region. The adaptors attached to the two ends of the target double-stranded polynucleotide may be the same or different. Preferably, the adaptors in the pair are the same.

[0230] The leader sequence is preferably present in the first single-stranded region at the 5' end (or 3' end) of one strand of the adaptor. The second single-stranded region may be present at the 3' end (or 5' end) of the other strand of the adaptor. The first and second single-stranded regions are not complementary. In this embodiment, the adaptor may be referred to as a Y adaptor.

[0231] A Y adaptor typically comprises (a) a double-stranded region (e.g., a duplex stem) and (b) a single-stranded region or a region that is non-complementary at one end. If a Y adaptor comprises a single-stranded region, it can be described as having an overhang. The presence of the non-complementary region in a Y adaptor gives the adaptor a Y shape because the two strands generally do not hybridize to each other, unlike the double-stranded portion. A Y adaptor can comprise one or more anchors.

[0232] In some embodiments, the adaptor can include one or more (e.g., at least one, at least two, at least three, or more) binding sites for one or more (e.g., at least one, at least two, at least three, or more) tags on the nanopore. In some embodiments, the binding site for the tag on the nanopore can be within the double-stranded region (e.g., the duplex stem), such that the binding site is exposed when the two strands of the double-stranded region separate. See, e.g., Fig.10 Additionally or alternatively, the binding site for the tag on the nanopore may be on the single stranded portion of the adaptor. By way of example only, Fig. 9A An exemplary adaptor comprising at least one anchor for a solid substrate (e.g., a membrane or a bead) is shown, and Fig.15 An example adaptor comprising at least two anchors is shown, wherein a first anchor is capable of coupling to a solid substrate, e.g., a membrane or bead, and a second anchor is capable of coupling to a nanopore. The second anchor of the nanopore can be configured to bind to a tag conjugated to the nanopore.

[0233] The Y adaptor contains a leader sequence that preferentially threads into the pore.

[0234] The Y adaptor is attached to the polynucleotide using methods known in the art. For example, one or both of the adaptors can be ligated using a ligase such as T4 DNA ligase, E. coli DNA ligase, Taq DNA ligase, Tma DNA ligase, and 9°N DNA ligase.

[0235] In a preferred embodiment, double-stranded polynucleotides, such as double-stranded polynucleotides in a sample, are modified so that they contain Y adapters at both ends. Any modification can be used. The method may include modifying a double-stranded target polynucleotide by adding an adapter.

[0236] By contacting the polynucleotide with a MuA transposase and a population of double-stranded MuA substrates, an adaptor, such as a Y adaptor or anchor, can be provided to the double-stranded polynucleotide. The transposase fragments the double-stranded polynucleotide and connects the MuA substrate to one or both ends of the fragment. This generates a plurality of modified double-stranded polynucleotides that include adaptors or anchors. The modified double-stranded polynucleotides can then be studied using the methods of the present invention.

[0237] These MuA-based methods are disclosed in WO 2015 / 022544 and WO 2016 / 059363. These methods are also discussed in detail in WO 2015 / 150786.

[0238] The adaptor may further comprise an anchor to tether the double-stranded polynucleotide comprising the target polynucleotide and / or its complementary sequence to the transmembrane pore or a membrane comprising the pore, i.e. the adaptor may further comprise a membrane-tether or a pore-tether. The anchor is preferably attached to a single-stranded region that is not a leader sequence.

[0239] The polynucleotide binding protein (e.g., a polynucleotide helicase) can bind to the leader sequence in the adaptor, or can be added after the adaptor is attached to the double-stranded polynucleotide. The activity of the polynucleotide binding protein (e.g., a polynucleotide helicase) bound to the leader sequence can be arrested until the polynucleotide contacts the transmembrane pore.

[0240] The leader sequence or adapter can be attached to the double-stranded polynucleotide by any suitable method. For example, the leader sequence can be connected to the target polynucleotide and / or its complementary sequence, or the adapter can be connected to the double-stranded polynucleotide.

[0241] In some embodiments, the double-stranded barcode sequence can be attached to one or both ends of the target double-stranded polynucleotide. The barcode sequence can be added to the double-stranded polynucleotide before adding a leader sequence or an adapter. For example, the barcode sequence can be located between the end of the target double-stranded polynucleotide and the adapter. Preferably, the barcode sequence is contained in the adapter.

[0242] A unique barcode sequence can be attached, e.g., linked, to each double-stranded polynucleotide in the sample. The barcode sequence can be used to identify signals corresponding to the sequential translocation of a target polynucleotide and a polynucleotide complementary to the target polynucleotide through the pore.

[0243] In some embodiments, the adapter described herein may include one or more spacers to prevent pre-bound polynucleotide binding proteins (e.g., polynucleotide helicases) from moving along double-stranded polynucleotides and unwinding double-stranded polynucleotides. These spacers prevent further movement of polynucleotide binding proteins (e.g., polynucleotide helicases) until the polynucleotide binding proteins (e.g., polynucleotide helicases) are located at the hole and a potential difference is applied to the hole. The additional force provided by the potential difference pushes the polynucleotide binding proteins (e.g., polynucleotide helicases) through the spacers and unwinds them and controls the movement of the polynucleotides through the nanopore. Therefore, the movement of the polynucleotide binding proteins (e.g., polynucleotide helicases) usually only occurs when the polynucleotides are located in the nanopore rather than before. The examples of the spacers and methods for preventing pre-bound polynucleotide binding proteins (e.g., polynucleotide helicases) from moving along double-stranded polynucleotides and unwinding double-stranded polynucleotides until the polynucleotides are in the nanopore are described in, for example, WO2015 / 110813, the contents of which are incorporated herein by reference as a whole.

[0244] Barcode

[0245] Polynucleotide barcodes are well known in the art (Kozarewa, I. et al., (2011), Methods Mol. Biol. 733, pp. 279-298). A barcode is a specific sequence of polynucleotides that affects the current flowing through the pore in a specific and known manner.

[0246] The barcode may comprise a nucleotide sequence. Nucleotides typically contain a nucleobase, a sugar, and at least one phosphate group. Nucleobases are typically heterocyclic. Nucleobases include, but are not limited to, purines and pyrimidines, and more specifically, adenine, guanine, thymine, uracil, and cytosine. Sugars are typically pentoses. Nucleotide sugars include, but are not limited to, ribose and deoxyribose. Nucleotides are typically ribonucleotides or deoxyribonucleotides. Nucleotides typically contain monophosphate, diphosphate, or triphosphate. The phosphate may be attached to the 5' or 3' side of the nucleotide.

[0247] Nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), 5-methylcytidine monophosphate, 5-methylcytidine diphosphate, 5-methylcytidine triphosphate, 5-hydroxymethylcytidine monophosphate, 5-hydroxymethylcytidine diphosphate, 5-hydroxymethylcytidine triphosphate, cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyadenosine monophosphate (dAMP), deoxyadenosine diphosphate (d deoxycytidine triphosphate (dCTP), 5-methyl-2'-deoxycytidine monophosphate, 5-methyl-2'-deoxycytidine diphosphate, 5-methyl-2'-deoxycytidine triphosphate, 5-hydroxymethyl-2'-deoxycytidine monophosphate, 5-hydroxymethyl-2'-deoxycytidine diphosphate, and 5-hydroxymethyl-2'-deoxycytidine triphosphate. The nucleotides in the adaptor are preferably selected from AMP, TMP, GMP, UMP, dAMP, dTMP, dGMP or dCMP. The nucleotides may be abasic (ie lacking a nucleobase). The nucleotides may contain additional modifications. Specifically, suitable modified nucleotides include, but are not limited to, 2'aminopyrimidines (such as 2'-aminocytidine and 2'-aminouridine), 2'-hydroxypurines (such as 2'-fluoropyrimidines (such as 2'-fluorocytidine and 2'-fluorouridine), hydroxypyrimidines (such as 5'-α-P-borane uridine), 2'-O-methyl nucleotides (such as 2'-O-methyladenosine, 2'-O-methylguanosine, 2'-O-methylcytidine and 2'-O-methyluridine), 4'-thiopyrimidines (such as 4'-thiouridine and 4'-thiocytidine), and nucleotides having modifications to the nucleobases (such as 5-pentynyl-2'-deoxyuridine, 5-(3-aminopropyl)-uridine and 1,6-diaminohexyl-N-5-carbamoylmethyluridine).

[0248] The barcode may comprise one or more different nucleotide species. For example, T k-mers (i.e., k-mers in which the central nucleotide is thymine-based, such as TTA, GTC, GTG, and CTA) typically have the lowest current state. Modified versions of the T nucleotides may be introduced into the modified polynucleotide to further reduce the current state and thereby increase the overall current range seen when the barcode moves through the pore.

[0249] G k-mers (i.e., k-mers whose central nucleotide is guanine-based, such as TGA, GGC, TGT, and CGA) tend to be strongly influenced by other nucleotides in the k-mer, and therefore modifying the G nucleotides in the modified polynucleotides can help them have a more independent current position.

[0250] Including three copies of the same nucleotide species rather than three different species can facilitate characterization because then only, for example, 3-nucleotide k-mers need to be located in the modified polynucleotide. However, such modifications do reduce the information provided by the barcode.

[0251] One or more abasic nucleotides may be included in the barcode. The use of one or more abasic nucleotides results in a characteristic current spike. This allows the position of one or more nucleotide species in the barcode to be clearly highlighted.

[0252] The nucleotide species in the barcode may contain a chemical atom or group, such as a propargyl, thiol, oxo, methyl, hydroxymethyl, formyl, carboxyl, carbonyl, benzyl, propargyl, or propargylamine. The chemical group or atom may be or may contain a fluorescent molecule, biotin, digoxigenin, dinitrophenol (DNP), a photolabile group, alkyne, DBCO, azide, free amino group, redox dye, mercury atom, or selenium atom.

[0253] The barcode may comprise a nucleotide species containing a halogen atom. The halogen atom may be attached to different nucleotide species, such as any position on a nucleobase and / or sugar. The halogen atom is preferably fluorine (F), chlorine (Cl), bromine (Br) or iodine (I). The halogen atom is most preferably F or I.

[0254] anchor

[0255] The target polynucleotide can be coupled to the membrane using an anchor (membrane-tether). One or more anchors can be used to couple the target polynucleotide to the membrane. Typically, one or more anchors are attached to each strand of the target polynucleotide. The anchor can be part of an adaptor.

[0256] If the membrane is an amphiphilic layer such as a triblock copolymer membrane, the one or more anchors preferably comprise a polypeptide anchor and / or a hydrophobic anchor that can be inserted into the membrane. The hydrophobic anchor is preferably a lipid, a fatty acid, a sterol, a carbon nanotube, a polypeptide, a protein or an amino acid, such as cholesterol, palmitate or tocopherol. In a preferred embodiment, the one or more anchors are not pores.

[0257] Membrane components, such as amphiphilic molecules, copolymers or lipids, can be chemically modified or functionalized to form the one or more anchors. Examples of suitable chemical modifications and suitable ways to functionalize membrane components are discussed in more detail below. Any proportion of the membrane components can be functionalized, for example, at least 0.01%, at least 0.1%, at least 1%, at least 10%, at least 25%, at least 50% or 100%.

[0258] The one or more anchors preferably comprise a linker.The one or more anchors may comprise one or more, such as 2, 3, 4 or more linkers.

[0259] Preferred joints include, but are not limited to, polymers such as polynucleotides, polyethylene glycol (PEG), polysaccharides, and polypeptides. These joints can be linear, branched, or cyclic. For example, the joint can be a cyclic polynucleotide. The polynucleotide can hybridize with a complementary sequence on a cyclic polynucleotide joint.

[0260] One or more anchors or one or more linkers may comprise a component that can be cleaved or degraded, such as a restriction site or a photolabile group.

[0261] Functionalized linkers and their coupling to molecules are known in the art. For example, a linker functionalized with a maleimide group will react with and attach to a cysteine ​​residue in a protein.

[0262] A "lock and key" arrangement can be used to avoid cross-linking of polynucleotides. Only one end of each joint can react together to form a longer joint, and the other end of the joint is each reacted with a polynucleotide or a membrane separately. Such joints are described in WO2010 / 086602.

[0263] The use of adapters in the sequencing methods of the present invention is preferred. If the polynucleotide is permanently coupled directly to the membrane in the sense that it will not uncouple upon interaction with the pore, some sequence data will be lost because the round of sequencing cannot continue to the end of the polynucleotide due to the distance between the membrane and the pore. If adapters are used, the polynucleotide can be fully processed.

[0264] The coupling may be permanent or stable. In other words, the coupling may enable the polynucleotide to remain coupled to the membrane while interacting with the pore.

[0265] The coupling can be temporary. In other words, the coupling can make the polynucleotide decoupled from the membrane when interacting with the hole. For polynucleotide sequencing, coupling of temporary nature is preferred. If a permanent or stable joint is directly connected to the 5' or 3' end of the polynucleotide and the joint is shorter than the distance between the membrane and the channel of the transmembrane hole, then because this round of sequencing cannot continue to the end of the polynucleotide, some sequence data will be lost. If the coupling is temporary, then when the end of the coupling is randomly freed from the membrane, the polynucleotide can be completely processed. The chemical groups that form permanent / stable or temporary connections are discussed in more detail below. Cholesterol or fatty acyl chains can be used to temporarily couple the target polynucleotide and / or its complementary sequence to membrane, such as amphiphilic layers, for example triblock copolymer membranes or lipid membranes. Any fatty acyl chains with a length of 6 to 30 carbon atoms, such as hexadecanoic acid, can be used.

[0266] In a preferred embodiment, the anchor couples the target polynucleotide and / or its complementary sequence to an amphiphilic layer, such as a triblock copolymer membrane or a lipid bilayer. A variety of tethering strategies have been used previously to couple nucleic acids to synthetic lipid bilayers. These are summarized in Table 1 below.

[0267] Table 1

[0268]

[0269] Synthetic polynucleotides and / or joints can be functionalized using modified phosphoramidites in building-up reactions that are easily compatible with suitable anchoring groups that directly add, such as cholesterol, tocopherol, palmitate, thiol, lipid, and biotin groups. These different connection chemistries provide a set of selections for the connection of polynucleotides. Each different modifying group couples polynucleotides in slightly different ways, and couplings may not always be permanent, thereby giving polynucleotides different residence times on the film.

[0270] Coupling of a polynucleotide to a linker or to a functionalized membrane can also be achieved by a variety of other means, provided that a complementary reactive group or anchoring group can be added to the polynucleotide. Adding reactive groups to either end of a polynucleotide has been previously reported. T4 polynucleotide kinase and ATPγS can be used to add thiol groups to the 5' terminus of ssDNA or dsDNA (Grant, GP and PZ Qin (2007). "A facile method for attaching nitroxide spin labels at the 5' terminus of nucleic acids." Nucleic Acids Research 35(10): e77). T4 polynucleotide kinase and γ-[2-azidoethyl]-ATP or γ-[6-azidohexyl]-ATP can be used to add azido groups to the 5'-phosphate of ssDNA or dsDNA. Using thiol or click chemistry, tethers containing any of thiol, iodoacetamide OPSS or maleimide groups (reactive to thiols) or dibenzocyclooctyne (DIBO) or alkynyl groups (reactive to azides) can be covalently attached to polynucleotides. Terminal transferases can be used to increase the selection of more diverse chemical groups, such as biotin, thiols and fluorophores, to incorporate modified oligonucleotides into the 3' of ssDNA (Kumar, A., P. Tchen et al. (1988). "Nonradioactive labeling of synthetic oligonucleotide probes with terminal deoxynucleotidyl transferase." Analytical Biochemistry ( AnalBiochem ) 169 (2): 376-82). Streptavidin / biotin and / or streptavidin / dethiobiotin coupling can be used for any other polynucleotide. It is also possible to use terminal transferase with appropriately modified nucleotides (e.g., cholesterol or palmitate) to add anchors directly to polynucleotides.

[0271] The one or more anchors can couple the target polynucleotide and / or its complementary sequence to the membrane by hybridization. Hybridization can be between one or more anchors and the target polynucleotide and / or its complementary sequence, within one or more anchors or between one or more anchors and the membrane. As discussed above, hybridization in one or more anchors allows coupling in a temporary manner. For example, a joint can include two or more polynucleotides hybridized together, such as 3, 4 or 5 polynucleotides. The one or more anchors can hybridize with a target polynucleotide or a polynucleotide complementary to the target polynucleotide. The one or more anchors can directly hybridize with a Y adapter and / or a leader sequence attached to a target polynucleotide and / or its complementary sequence. Alternatively, the one or more anchors can hybridize with one or more, such as 2 or 3 intermediate polynucleotides (or "splints"), and the intermediate polynucleotides and polynucleotides hybridize with a Y adapter and / or a leader sequence attached to a target polynucleotide and / or its complementary sequence.

[0272] The one or more anchors may comprise single-stranded or double-stranded polynucleotides. A portion of the anchor may be attached to a single-stranded or double-stranded polynucleotide analyte. It has been reported that short pieces of ssDNA were attached using T4 RNA ligase I (Troutt, AB, MG McHeyzer-Williams et al. (1992). "Ligation-anchored PCR: a simple amplification technique with single-sided specificity." Proc Natl Acad Sci USA 89(20):9823-5). Alternatively, a single-stranded or double-stranded polynucleotide may be attached to a double-stranded polynucleotide, and then the two chains may be separated by heat or chemical denaturation. For double-stranded polynucleotides, a piece of single-stranded polynucleotide may be added to one or both ends of the duplex, or a double-stranded polynucleotide may be added to one or both ends. In order to add a single-stranded polynucleotide to a double-stranded polynucleotide, T4 RNA ligase I may be used to achieve attachment to other regions of the single-stranded polynucleotide. To join a double-stranded polynucleotide to a double-stranded polynucleotide, the ligation can be "blunt-ended", with complementary 3'dA / dT tails on the polynucleotide and the joined polynucleotide, respectively (this is a common practice in many sample preparation applications to prevent concatemer or dimer formation), or use "sticky ends" generated by restriction digestion of the polynucleotide and ligation-compatible adapters. Then, when the duplex is melted, each single strand will have a 5' or 3' end modification if a single-stranded polynucleotide is used for ligation; or each single strand will have a modification at the 5' end, 3' end, or both ends if a double-stranded polynucleotide is used for ligation.

[0273] If the adaptor or complementary sequence of the target polynucleotide is a synthetic strand, the one or more anchors may be incorporated during chemical synthesis of the adaptor or complementary sequence. For example, the adaptor or complementary sequence may be synthesized using a primer having a reactive group attached thereto.

[0274] Adenylated polynucleotides are intermediates in the ligation reaction, where adenosine monophosphate is attached to the 5'-phosphate of the polynucleotide. Various kits are available for generating such intermediates, such as the 5' DNA Adenylation Kit from NEB. Reactive groups (such as thiols, amines, biotin, azides, etc.) can be added to the 5' of the polynucleotide by replacing the modified nucleotide triphosphates with ATP in the reaction. Anchors can also be added directly to the polynucleotide using a 5' DNA Adenylation Kit with appropriately modified nucleotides (such as cholesterol or palmitate).

[0275] A common technique for amplifying genomic DNA segments is to use polymerase chain reaction (PCR). Here, using two synthetic oligonucleotide primers, many copies of the same DNA segment can be generated, wherein for each copy, the 5' of each chain in the duplex will be a synthetic polynucleotide. Single or multiple nucleotides can be added to the 3' end of single-stranded or double-stranded DNA by using a polymerase. Examples of polymerases that can be used include, but are not limited to, terminal transferase, Klenow, and E. coli Poly (A) polymerase. By replacing the modified triphosphate nucleotides with ATP in the reaction, anchors, such as cholesterol, thiols, amines, azides, biotin, or lipids, can be incorporated into the double-stranded polynucleotides. Therefore, each copy of the amplified polynucleotide will contain an anchor.

[0276] Ideally, the polynucleotide is coupled to the membrane without having to functionalize the polynucleotide. This can be achieved by coupling one or more anchors, such as polynucleotide binding proteins (e.g., polynucleotide helicases) or chemical groups, to the membrane and interacting the one or more anchors with the polynucleotide or by functionalizing the membrane. The one or more anchors can be coupled to the membrane by any method described herein. Specifically, the one or more anchors can include one or more joints, such as maleimide functionalized joints. In this embodiment, the polynucleotide is typically RNA, DNA, PNA, TNA or LNA, and can be double-stranded or single-stranded. This embodiment is particularly suitable for genomic DNA polynucleotides.

[0277] The one or more anchors may comprise any group that couples, binds or interacts with a single-stranded or double-stranded polynucleotide, a specific nucleotide sequence within a polynucleotide, or a pattern of modified nucleotides within a polynucleotide, or any other ligand present on a polynucleotide.

[0278] Binding proteins suitable for use in anchors include, but are not limited to, E. coli single-stranded binding protein, P5 single-stranded binding protein, T4 gp32 single-stranded binding protein, TOPO V dsDNA binding region, human histone protein, E. coli HU DNA binding protein, and other archaeal, prokaryotic or eukaryotic single-stranded or double-stranded polynucleotide (or nucleic acid) binding proteins, including those listed below.

[0279] The specific nucleotide sequence may be a sequence recognized by a transcription factor, a ribosome, an endonuclease, a topoisomerase, or a replication initiation factor. The pattern of the modified nucleotide may be a methylation pattern or a damage pattern.

[0280] The one or more anchors may include any group coupled, combined, inserted or interacted with a polynucleotide. The group may be inserted into a polynucleotide or interact with a polynucleotide by electrostatic, hydrogen bond or Van der Waals interactions. Such groups include lysine monomers, polylysine (which will interact with ssDNA or dsDNA), ethidium bromide (which inserts into dsDNA), universal bases or universal nucleotides (which can be hybridized with any polynucleotide) and osmium complexes (which can react with methylated bases). Therefore, polynucleotides may be coupled to the membrane using one or more universal nucleotides connected to the membrane. Each universal nucleotide may be coupled to the membrane using one or more joints. Universal nucleotides preferably include one of the following nucleobases: hypoxanthine, 4-nitroindole, 5-nitroindole, 6-nitroindole, formyl indole, 3-nitropyrrole, nitroimidazole, 4-nitropyrazole, 4-nitrobenzimidazole, 5-nitroindazole, 4-aminobenzimidazole or phenyl (C6 aromatic ring). The universal nucleotide more preferably comprises one of the following nucleosides: 2'-deoxyinosine, inosine, 7-deaza-2'-deoxyinosine, 7-deaza-inosine, 2-aza-deoxyinosine, 2-aza-inosine, 2-O'-methylinosine, 4-nitroindole 2'-deoxynucleoside, 4-nitroindole nucleoside, 5-nitroindole 2'-deoxynucleoside, 5-nitroindole nucleoside, 6-nitroindole 2'-deoxynucleoside, 6-nitroindole nucleoside, 3-nitropyrrole 2'-deoxynucleoside, 3-nitropyrrole nucleoside, acyclic sugar analogs of hypoxanthine, nitroimidazole 2'-deoxynucleoside, nitroimidazole nucleoside, 4-nitropyrazole 2'-deoxynucleoside. '-deoxynucleoside, 4-nitropyrazole nucleoside, 4-nitrobenzimidazole 2'-deoxynucleoside, 4-nitrobenzimidazole nucleoside, 5-nitroindazole 2'-deoxynucleoside, 5-nitroindazole nucleoside, 4-aminobenzimidazole 2'-deoxynucleoside, 4-aminobenzimidazole nucleoside, 5-nitroindazole 2'-deoxynucleoside, 5-nitroindazole nucleoside, 4-aminobenzimidazole 2'-deoxynucleoside, 4-aminobenzimidazole nucleoside, phenyl C-nucleoside, phenyl C-2'-deoxyribosyl nucleoside, 2'-deoxyfumocylindole, 2'-deoxyisoguanosine, K-2'-deoxynucleoside, P-2'-deoxyribose and pyrrolidine. Universal nucleotides more preferably include 2'-deoxyinosine. Universal nucleotides are more preferably IMP or dIMP. The universal nucleotide is most preferably dPMP (2'-deoxy-P-nucleoside monophosphate) or dKMP (N6-methoxy-2,6-diaminopurine monophosphate).

[0281] One or more anchors can be coupled (or combined) to a polynucleotide via Hoogsteen hydrogen bonding (wherein two nucleobases are held together by hydrogen bonding) or reverse Hoogsteen hydrogen bonding (wherein one nucleobase is rotated 180° relative to another nucleobase). For example, one or more anchors can comprise one or more nucleotides, one or more oligonucleotides, or one or more polynucleotides that form Hoogsteen hydrogen bonding or reverse Hoogsteen hydrogen bonding with a polynucleotide. These types of hydrogen bonding allow a third polynucleotide strand to wrap around a double-stranded helix and form a triplex. One or more anchors can be coupled (or combined) to a double-stranded polynucleotide by forming a triplex with a double-stranded duplex.

[0282] In this embodiment, at least 1%, at least 10%, at least 25%, at least 50%, or 100% of the membrane components may be functionalized.

[0283] When the one or more anchors comprise proteins, the one or more anchors may be able to be directly anchored to the membrane without further functionalization, for example when it already has an external hydrophobic region that is compatible with the membrane. Examples of such proteins include, but are not limited to, transmembrane proteins, intrinsic membrane proteins, and membrane proteins. Alternatively, the protein may be expressed with a hydrophobic region genetically fused to a membrane that is compatible. Such hydrophobic protein regions are known in the art.

[0284] The one or more anchors are preferably mixed with the polynucleotide prior to delivery to the membrane, but the one or more anchors may be contacted with the membrane and subsequently contacted with the polynucleotide.

[0285] On the other hand, the polynucleotides can be functionalized using the methods described above so that they can be recognized by specific binding groups. Specifically, the polynucleotides can be functionalized with ligands such as biotin (for binding to streptavidin), amylose (for binding to maltose binding protein or fusion protein), Ni-NTA (for binding to polyhistidine or polyhistidine-tagged proteins) or peptides (such as antigens).

[0286] According to a preferred embodiment, one or more anchors can be used to couple the polynucleotide to the membrane when the polynucleotide is connected to a leader sequence, which is preferably screwed into the hole. Preferably, the polynucleotide is attached (attach) (such as connecting (ligate)) to the leader sequence that is preferentially screwed into the hole. Such a leader sequence can comprise a homopolymeric polynucleotide or an abasic region. The leader sequence is usually designed to hybridize directly with one or more anchors, or to hybridize with the one or more anchors through one or more intermediate polynucleotides (or splints). In these cases, one or more anchors usually comprise a polynucleotide sequence complementary to a sequence in the leader sequence or a sequence in one or more intermediate polynucleotides (or splints). In these cases, one or more splints usually comprise a polynucleotide sequence complementary to a sequence in the leader sequence.

[0287] Any method for making polynucleotide and the film coupling of for example amphiphilic layer discussed above can certainly be applied to other polynucleotide and film combination.In certain embodiments, amino acid, peptide, polypeptide or protein is coupled with the amphiphilic layer of for example triblock copolymer layer or lipid bilayer.Various methods for chemical connection of such polynucleotide can be obtained.The example of the molecule used in chemical connection is EDC (1-ethyl-3-[3-dimethylaminopropyl] carbodiimide hydrochloride).Reactive groups can also be added to the 5' of polynucleotide using commercially available kit (Thermo Pierce, product number 22980).Suitable method includes but is not limited to the temporary affinity attachment using histidine residues and Ni-NTA, and the more robust covalent attachment by reactive cysteine, lysine or non-natural amino acid.

[0288] particle

[0289] Microparticles (usually beads) can be used to deliver analytes (e.g., polynucleotides or polypeptides) to transmembrane pores. This is described in WO 2016 / 059375, the contents of which are incorporated herein by reference in their entirety. Any number of microparticles can be used in the method of the present invention. For example, the method of the present invention can use a single microparticle or 2, 3, 4, 5, 6, 7, 8, 9, 10, 20, 30, 50, 100, 1,000, 5,000, 10,000, 100,000, 500,000 or 1,000,000 or more microparticles. If two or more microparticles are used, the microparticles can be identical. Alternatively, a mixture of different microparticles can be used.

[0290] Each microparticle can be attached with an analyte (e.g., a polynucleotide or a polypeptide). Alternatively, each microparticle can be attached with two or more analytes (e.g., polynucleotides or polypeptides), such as 3 or more, 4 or more, 5 or more, 6 or more, 7 or more, 8 or more, 9 or more, 10 or more, 20 or more, 30 or more, 50 or more, 100 or more, 500 or more, 1,000 or more, 5,000 or more, 10,000 or more, 100,000 or more, 1000,000 or more, or 5000,000 or more analytes (e.g., polynucleotides or polypeptides). Microparticles can be coated or covered with analytes (e.g., polynucleotides or polypeptides) substantially or completely. Microparticles can be attached with analytes (e.g., polynucleotides or polypeptides) on substantially all or all of their surfaces. The microparticle can be attached to the analyte (e.g., a polynucleotide or polypeptide) via an adaptor. The adaptor can be a Y adaptor, e.g., Fig.36 shown.

[0291] Examples of suitable binding moieties include: protein binding tags (streptavidin tag, flag tag, etc.), conjugate attachments (polynucleotides, polymers, biotin, peptides), and amino acids (cysteine, Faz, etc.).

[0292] In some embodiments, a polynucleotide may be attached to two or more microparticles.

[0293] Microparticles are microscopic particles whose size is usually measured in micrometers (μm). Microparticles may also be referred to as microspheres or microbeads. Microparticles may be nanoparticles. Nanoparticles are microscopic particles whose size is usually measured in nanometers (nm).

[0294] Microparticles typically have a particle size of about 0.001 μm to about 500 μm. For example, nanoparticles can have a particle size of about 0.01 μm to about 200 μm or about 0.1 μm to about 100 μm. More commonly, microparticles have a particle size of about 0.5 μm to about 100 μm, or, for example, about 1 μm to about 50 μm. Microparticles can have a particle size of about 1 nm to about 1000 nm, such as about 10 nm to about 500 nm, about 20 nm to about 200 nm, or about 30 nm to about 100 nm.

[0295] Microparticles can be spherical or non-spherical. Spherical microparticles can be referred to as microspheres. Non-spherical particles can be, for example, plate-shaped, needle-shaped, irregular or tubular. The term "particle size" as used herein means the diameter of a particle if the particle is spherical, or if the particle is non-spherical, means the particle size based on volume. The particle size based on volume is the diameter of a sphere having the same volume as the non-spherical particle in question.

[0296] If two or more microparticles are used in the method, the average particle size of the microparticles can be any size discussed above, such as about 0.5 μm to about 500 μm. The population of two or more microparticles preferably has a coefficient of variation (ratio of standard deviation to mean) of 10% or less, such as 5% or less or 2% or less.

[0297] Any method can be used to determine the size of the microparticles. Suitable methods include, but are not limited to, flow cytometry (see, e.g., Chandler et al., J Thromb Haemost. 2011 Jun;9(6):1216-24).

[0298] The microparticles may be formed from any material. The microparticles are preferably formed from ceramics, glass, silica, polymers or metals. The polymer may be a natural polymer such as polyhydroxyalkanoate, dextran, polylactide, agarose, cellulose, starch or chitosan, or a synthetic polymer such as polyurethane, polystyrene, poly(vinyl chloride), silane or methacrylate. Suitable microparticles are known in the art and are commercially available. Ceramic and glass microspheres can be purchased from Silica and polymer microparticles are available from EPRUI Nanoparticles & Microspheres Co. Ltd. Microparticles are also available from Polysciences Inc., Bangs Laboratories Inc., and Life Technologies.

[0299] The microparticles may be solid. The microparticles may be hollow. The microparticles may be formed from polymer fibers.

[0300] Microparticles may be derived from kits for extracting and isolating polynucleotides.

[0301] The microparticle surface can interact with and attach an analyte. The surface can naturally interact with an analyte such as a polynucleotide or polypeptide and does not require functionalization. The microparticle surface is typically functionalized to facilitate attachment of the analyte. Suitable functionalizations are known in the art. For example, the microparticle surface can be functionalized with a polyhistidine tag (hexahistidine tag, 6xHis-tag, His6 tag or ), Ni-NTA, streptavidin, biotin, oligonucleotides, polynucleotides (such as DNA, RNA, PNA, GNA, TNA or LNA), carboxyl groups, quaternary amine groups, thiol groups, azide groups, alkyne groups, DIBO, lipids, FLAG-tags (FLAG octapeptide, polynucleotide binding proteins (e.g., polynucleotide helicases) (including any of those discussed below), peptides, proteins, antibodies or antibody fragments. The microparticles can also be functionalized with any linker or group discussed below.

[0302] The microparticles can be functionalized with molecules or groups that specifically bind to polynucleotides. In this case, the polynucleotide to be attached to the microparticle and delivered to the transmembrane pore can be referred to as the target polynucleotide. This allows the microparticle to select or capture the target polynucleotide from a sample containing other polynucleotides. If the molecule or group binds preferentially or with high affinity to the target polynucleotide, but does not bind to other polynucleotides or different polynucleotides or binds only with low affinity, the molecule or group specifically binds to the target polynucleotide. If the molecule or group binds to the target polynucleotide with 1×10 -6 M or less, more preferably 1×10 -7 M or smaller, 5×10 -8 M or less, more preferably 1×10 -8 M or less or more preferably 5×10 -9 M or less, then the molecule or group binds preferentially or with high affinity. -6 M or more, more preferably 1×10 -5 M or more, more preferably 1×10 -4 M or more, more preferably 1×10 -3 M or more, even more preferably 1×10 -2 If a molecule or group binds with a Kd of M or greater, then the molecule or group binds with low affinity.

[0303] Preferably, the affinity of the molecule or group to bind to the target polynucleotide is at least 10 times, such as at least 50 times, at least 100 times, at least 200 times, at least 300 times, at least 400 times, at least 500 times, at least 1000 times or at least 10,000 times, as compared to its affinity for other polynucleotides. Affinity can be measured using known binding assays, such as binding assays using fluorescence and radioisotopes. Competitive binding assays are also known in the art. The binding strength between a peptide or protein and a polynucleotide can be measured using nanopore force spectroscopy, as described in Hornblower et al., Nature Methods. 4: 315-317. (2007).

[0304] Microparticles can be functionalized with oligonucleotides or polynucleotides that specifically hybridize to or contain a portion or region that is complementary to a portion or region of a target polynucleotide or adaptor. This allows the microparticles to select or capture a target polynucleotide from a sample containing other polynucleotides.

[0305] When an oligonucleotide or polynucleotide preferentially or with high affinity hybridizes to a target polynucleotide, but does not substantially hybridize, does not hybridize, or hybridizes only with low affinity to other polynucleotides, the oligonucleotide or polynucleotide specifically hybridizes to a target polynucleotide. m ) than its T for other sequences m The oligonucleotide or polynucleotide will specifically hybridize if the temperature is at least 2°C higher, such as at least 3°C, at least 4°C, at least 5°C, at least 6°C, at least 7°C, at least 8°C, at least 9°C or at least 10°C higher. More preferably, the oligonucleotide or polynucleotide is at a temperature of 1°C higher than the target polynucleotide. m T m Preferably, the oligonucleotide or polynucleotide hybridizes to the target polynucleotide at a temperature of at least 2°C, such as at least 3°C, at least 4°C, at least 5°C, at least 6°C, at least 7°C, at least 8°C, at least 9°C, at least 10°C, at least 20°C, at least 30°C or at least 40°C. m T of a sequence that differs from the target polynucleotide by one or more nucleotides, such as 1, 2, 3, 4 or 5 or more nucleotides. m The oligonucleotide or polynucleotide will hybridize to the target polynucleotide at a T of at least 90°C, such as at least 92°C or at least 95°C. m Hybridization. m This can be measured experimentally using known techniques, including the use of DNA microarrays, or can be measured using publicly available T m Calculator calculations, such as those available on the Internet.

[0306] Conditions that allow hybridization are well known in the art (e.g., Sambrook et al., 2001, Molecular Cloning: a laboratory manual, 3rd edition, Cold Spring Harbor Laboratory Press; and Current Protocols in Molecular Biology, Chapter 2, Ausubel et al., eds., Greene Publishing and Wiley-lnterscience, New York (1995)). Hybridization can be performed under low stringency conditions, such as at 37°C in the presence of a buffer solution of 30% to 35% formamide, 1M NaCl, and 1% sodium dodecyl sulfate (SDS), followed by 1X (0.1650M Na) at 50°C. + ) to 2X(0.33M Na + ) standard sodium citrate (SSC) washing 20 times. Hybridization can be carried out under moderate stringency conditions, for example, at 37°C in the presence of a buffer solution of 40% to 45% formamide, 1M NaCl and 1% SDS, and then at 55°C in 0.5X (0.0825M Na + ) to 1X(0.1650MNa + ) SSC. Hybridization can be performed under high stringency conditions, for example, at 37°C in the presence of a buffer solution of 50% formamide, 1 M NaCl, and 1% SDS, followed by washing at 60°C in 0.1X (0.0165 M Na + )SSC washing.

[0307] The polynucleotide may include a portion or region that is substantially complementary to a portion or region of the target polynucleotide. Thus, a region or portion of a polynucleotide may have 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more mismatches over a region of 5, 10, 15, 20, 21, 22, 30, 40 or 50 nucleotides compared to a portion or region in the target polynucleotide.

[0308] A portion of a region is typically 50 nucleotides or less, such as 40 nucleotides or less, 30 nucleotides or less, 20 nucleotides or less, 10 nucleotides or less, or 5 nucleotides or less.

[0309] The microparticles are preferably paramagnetic or magnetic. The microparticles preferably comprise paramagnetic or superparamagnetic materials or paramagnetic or superparamagnetic metals, such as iron. Any suitable magnetic microparticles may be used. For example, magnetic beads available from, for example, Clontech, Promega, Invitrogen ThermoFisher Scientific, and NEB may be used. In some embodiments, the microparticles comprise magnetic particles to which organic groups are attached, such as metal chelating groups, such as nitrilotriacetic acid (NTA). The organic component may, for example, comprise a group selected from the group consisting of -C(=O)O-, -COC-, -C(=O)-, -NH-, -C(=O)-NH, -C(=O)-CH2-I, -S(=O)2-, and -S-. The organic component may comprise a metal chelating group, such as nitrilotriacetic acid (NTA). Typically, metals such as gold, iron, nickel, or cobalt are also attached to the metal chelating group. Such magnetic beads are typically used to capture His-tagged proteins, but are also suitable for use in the present invention.

[0310] The microparticles are most preferably His-Tag microparticles available from Life Technologies. MagStrep beads from IBA, Streptavidin magnetic beads from NEB, Solid Phase Reversible Immobilization (SPRI) beads from Beckman Coulter, or Agencourt AMPure XP beads or MyOne TM Streptavidin C1 (ThermoFisher Scientific).

[0311] Polynucleotide binding proteins (e.g., polynucleotide helicases)

[0312] The polynucleotide binding protein (e.g., polynucleotide helicase) can be any protein that can bind to the polynucleotide and control its movement through the hole. It is very simple to determine whether a protein binds to a polynucleotide in the art. Proteins usually interact with polynucleotides and modify at least one of their properties. Proteins can modify polynucleotides by cleaving polynucleotides to form a single nucleotide or a shorter nucleotide chain such as a dinucleotide or trinucleotide. The part can modify polynucleotides by positioning or moving the polynucleotides to a specific position (i.e., controlling their movement).

[0313] The polynucleotide binding protein (e.g., polynucleotide helicase) is preferably derived from a polynucleotide handling enzyme. A polynucleotide handling enzyme is a polypeptide that can interact with a polynucleotide and modify at least one of its properties. The enzyme can modify a polynucleotide by cleaving the polynucleotide to form a single nucleotide or a shorter nucleotide chain such as a dinucleotide or trinucleotide. The enzyme can modify a polynucleotide by directing or moving the polynucleotide to a specific position. The polynucleotide handling enzyme does not need to exhibit enzymatic activity, as long as it can bind to the polynucleotide and control its movement through the hole. For example, the enzyme can be modified to remove its enzymatic activity or can be used under conditions that prevent it from acting as an enzyme. This condition is discussed in more detail below.

[0314] The polynucleotide handling enzyme is preferably derived from a nucleolytic enzyme. The polynucleotide handling enzyme used in the enzyme's construct is more preferably derived from a member of any of the following Enzyme Classification (EC) groups: 3.1.11, 3.1.13, 3.1.14, 3.1.15, 3.1.16, 3.1.21, 3.1.22, 3.1.25, 3.1.26, 3.1.27, 3.1.30 and 3.1.31. The enzyme may be any enzyme disclosed in WO 2010 / 086603.

[0315] Preferred enzymes are polymerases, helicases, translocases, and topoisomerases, such as gyrase. The polymerase may be 3173 DNA polymerase (which can be purchased from Company), SD polymerase (available from ) or a variant thereof. The polymerase is preferably a Phi29 DNA polymerase or a variant thereof. The topoisomerase is preferably a member of any of the partial classification (EC) groups 5.99.1.2 and 5.99.1.3.

[0316] The enzyme is most preferably derived from a helicase. The helicase may be or be derived from a Hel308 helicase; a RecD helicase, such as a TraI helicase or a TrwC helicase; an XPD helicase or a Dda helicase. The helicase may be or be derived from Hel308 Mbu, Hel308 Csy Hel308 Tga, Hel308 Mhu, TraI Eco, XPD Mbu or a variant thereof.

[0317] The helicase may be any helicase, modified helicase or helicase construct disclosed in WO 2013 / 057495, WO 2013 / 098562, WO 2013098561, WO 2014 / 013260, WO 2014 / 013259, WO 2014 / 013262 and WO / 2015 / 055981.

[0318] The Dda helicase preferably comprises any of the modifications disclosed in WO / 2015 / 055981 and WO 2016 / 055777.

[0319] Any number of helicases can be used according to the present invention. For example, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10 or more helicases can be used. In certain embodiments, different numbers of helicases can be used. Any combination of two or more of the above-mentioned helicases can be used. The two or more helicases can be two or more Dda helicases. The two or more helicases can be one or more Dda helicases and one or more TrwC helicases. The two or more helicases can be different variants of the same helicase.

[0320] Two or more helicases are preferably attached to each other. Two or more helicases are more preferably covalently attached to each other. The helicases can be attached in any order and using any method. Preferred helicase constructs for use in the present invention are described in WO2014 / 013260, WO 2014 / 013259, WO 2014 / 013262 and WO2015 / 055981.

[0321] In some embodiments, the polynucleotide binding protein is a polynucleotide helicase. A polynucleotide helicase is an enzyme that can melt a double-stranded polynucleotide into a single strand. In some embodiments, a polynucleotide helicase can melt a double-stranded DNA into a single strand. In some embodiments, a polynucleotide helicase is an enzyme with helicase activity. Examples of polynucleotide helicases include, for example, helicases as described herein.

[0322] Polynucleotide binding ability can be measured using any method known in the art. For example, a protein can be contacted with a polynucleotide and the ability of the protein to bind to and move along the polynucleotide can be measured. The protein can include modifications that facilitate polynucleotide binding and / or facilitate its activity at high salt concentrations and / or room temperature. The protein can be modified so that it binds to the polynucleotide (i.e., retains polynucleotide binding ability) but does not act as a depolymerase (i.e., when all the necessary components for movement (e.g., ATP and Mg) are present. 2+ ) does not move along the polynucleotide). Such modifications are known in the art. For example, Mg in helicase 2+ Modification of the binding domain often results in variants that do not function as helicases. These types of variants can act as molecular brakes.

[0323] The enzyme may be covalently attached to the pore.Any method may be used to covalently attach the enzyme to the pore.

[0324] In chain sequencing, polynucleotides are translocated through holes along or against an applied potential. Exonucleases that gradually or stepwise work on double-stranded polynucleotides can be used on the cis side of the hole to supply the remaining single strands under an applied potential, or on the trans side to supply the remaining single strands under a reverse potential. Similarly, helicases that unwind double-stranded DNA can also be used in a similar manner. Polymerases can also be used. Sequencing applications that require chain translocation against an applied potential are also possible, but DNA must first be "captured" by enzymes at opposite potentials or without potential. As the potential is subsequently converted after binding, the chain will pass through the hole in a cis-to-trans manner and be maintained in an extended configuration by current. Single-stranded DNA exonucleases or single-stranded DNA-dependent polymerases can serve as molecular motors to pull the recently translocated single strands back from the hole in a controlled, stepwise manner against an applied potential from trans to cis.

[0325] Any helicase can be used in the present invention. The helicase can act on the hole in two modes. First, the method is preferably carried out using a helicase so that the helicase moves the polynucleotide through the hole under the action of the field caused by the applied voltage. In this mode, the 5' end of the polynucleotide is first captured in the hole, and the helicase moves the polynucleotide into the hole so that it passes through the hole under the action of the field until it finally translocates and passes through, reaching the reverse side of the membrane. Alternatively, the method is preferably carried out in this way, and the helicase moves the polynucleotide through the hole against the field caused by the applied voltage. In this mode, the 3' end of the polynucleotide is first captured in the hole, and the helicase moves the polynucleotide through the hole so that it is pulled out of the hole against the applied field until it is finally pushed back to the cis side of the membrane.

[0326] The method can also be performed in the reverse direction. The 3' end of the polynucleotide can first be captured in the pore and the helicase can move the polynucleotide into the pore so that it is moved through the pore by the field until it eventually translocates through to the opposite side of the membrane.

[0327] When the helicase does not possess the essential component that is convenient to move or is modified to stop or prevent it from moving, the helicase can be combined with the polynucleotide and serve as a brake to slow down the movement of the polynucleotide when the polynucleotide is pulled into the hole by the external field. In the inactive mode, it is not important whether the 3' or 5' of the polynucleotide is captured, and it is the external field that pulls the polynucleotide into the hole towards the opposite side under the effect of the enzyme that serves as the brake. When in the inactive mode, the control of the movement of the helicase to the polynucleotide can be described in a variety of ways, including toothing, sliding and braking. The helicase variant lacking helicase activity can also be used in this way.

[0328] The polynucleotide may be contacted with the polynucleotide binding protein (e.g., polynucleotide helicase) and the pore in any order. Preferably, when the polynucleotide is contacted with a polynucleotide binding protein (e.g., polynucleotide helicase) such as a helicase and the pore, the polynucleotide first forms a complex with the polynucleotide binding protein (e.g., polynucleotide helicase). When a voltage is applied across the pore, the polynucleotide / polynucleotide binding protein (e.g., polynucleotide helicase) complex will form a complex with the pore and control the movement of the polynucleotide through the pore.

[0329] Any step in the method using a polynucleotide binding protein (e.g., a polynucleotide helicase) is typically performed in the presence of free nucleotides or free nucleotide analogs and an enzyme cofactor that promotes the action of the polynucleotide binding protein (e.g., a polynucleotide helicase). The free nucleotides can be one or more of any of the individual nucleotides discussed above. Free nucleotides include, but are not limited to, adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyguanosine monophosphate (DAMP), deoxyguanosine monophosphate (DTP ... The free nucleotide is preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP or dCMP. The free nucleotide is preferably adenosine triphosphate (ATP). The enzyme cofactor is a factor that allows the construct to function. The enzyme cofactor is preferably a divalent metal cation. The divalent metal cation is preferably Mg. 2+ , Mn 2+ , Ca 2+ or Co 2+ The enzyme cofactor is most preferably Mg 2+ .

[0330] The molecular brake can be any compound or molecule that binds to the polynucleotide and slows down the movement of the polynucleotide through the pore. The molecular brake can be any of the ones discussed above. The molecular brake preferably comprises a compound that binds to the polynucleotide. The compound is preferably a macrocycle. Suitable macrocycles include, but are not limited to, cyclodextrins, calixarene, cyclopeptides, crown ethers, cucurbiturils, pillararene, derivatives thereof, or combinations thereof. The cyclodextrin or its derivative can be any cyclodextrin or its derivative disclosed in Eliseev, AV and Schneider, HJ. (1994) Journal of the American Chemical Society 116, 6081-6088. The cyclodextrin is more preferably heptadecan-6-amino-β-cyclodextrin (am7-βCD), 6-monodeoxy-6-monoamino-β-cyclodextrin (am1-βCD) or heptadecan-(6-deoxy-6-guanidino)-cyclodextrin (gu7-βCD).

[0331] membrane

[0332] Any membrane may be used in accordance with the various aspects described herein. Suitable membranes are well known in the art. The membrane is preferably an amphiphilic layer or a solid state layer.

[0333] An amphiphilic layer is a layer formed by amphiphilic molecules, such as phospholipids, which have two properties of hydrophilicity and lipophilicity. Amphiphilic molecules can be synthetic or naturally occurring. Non-naturally occurring amphiphiles and amphiphiles forming a monolayer are known in the art, and include, for example, block copolymers (Gonzalez-Perez et al., Langmuir, 2009, 25, 10447-10450). Block copolymers are polymeric materials in which two or more monomer subunits are polymerized together to produce a single polymer chain. Block copolymers generally have properties contributed by each monomer subunit. However, block copolymers can have unique properties that are not possessed by polymers formed by separate subunits. Block copolymers can be engineered so that one of the monomer subunits is hydrophobic (i.e., lipophilic) in an aqueous medium, while one or more other subunits are hydrophilic. In this case, block copolymers can have amphiphilic properties and can form a structure that simulates a biofilm. The block copolymers may be diblock (composed of two monomer subunits), but may also be built up from more than two monomer subunits to form more complex arrangements that behave as amphiphiles. The copolymers may be triblock, tetrablock or pentablock copolymers. The membrane is preferably a triblock copolymer membrane.

[0334] Archaeal bipolar tetraether lipids are naturally occurring lipids that are constructed so that lipids form monolayer membranes. These lipids are generally found in extremophiles, thermophiles, halophiles, and acidophiles that survive in harsh biological environments. It is believed that their stability is derived from the fusogenic properties of the final bilayer. It is straightforward to construct block copolymer materials that mimic these biological entities by producing triblock polymers with the general motif hydrophilicity-hydrophobicity-hydrophilicity. This material can form a monomeric membrane that behaves similarly to a lipid bilayer and covers a series of stage performances from vesicles to lamellar membranes. The membranes formed by these triblock copolymers maintain several advantages relative to biological lipid membranes. Because the triblock copolymers are synthetic, the accurate construction can be carefully controlled to provide the correct chain length and characteristics required to form a membrane and interact with holes and other proteins.

[0335] Block copolymers can also be constructed from subunits that are not classified as lipid submaterials, for example, hydrophobic polymers can be made from siloxanes or other non-hydrocarbon-based monomers. The hydrophilic subsections of the block copolymers can also have low protein binding properties, which allows the production of membranes that are highly resistant when exposed to raw biological samples. Such head group units can also be derived from non-classical lipid head groups.

[0336] Compared to biological lipid membranes, triblock copolymer membranes also have increased mechanical and environmental stability, such as much higher operating temperature or pH ranges.The synthetic nature of block copolymers provides a platform for tailoring polymer-based membranes for a wide range of applications.

[0337] Most preferably the membrane is one of the membranes disclosed in WO2014 / 064443 or WO2014 / 064444.

[0338] The amphiphilic molecules can be chemically modified or functionalized to facilitate coupling to polynucleotides.

[0339] The amphiphilic layer can be a single layer or a double layer. The amphiphilic layer is typically planar. The amphiphilic layer can be curved. The amphiphilic layer can be supported. The amphiphilic layer can be concave. The amphiphilic layer can be suspended from raised posts so that the peripheral area of ​​the amphiphilic layer (which is connected to the posts) is higher than the area of ​​the amphiphilic layer. This can allow the microparticles to travel, move, slide or roll along the membrane as described above.

[0340] Amphiphilic membranes are usually naturally fluid, flowing at a rate of approximately 10 -8 cm s -1 The lipid diffusion rate is 2.0, which acts as a two-dimensional liquid. This means that the pore and the coupled polynucleotide can move generally within the amphiphilic membrane.

[0341] The membrane can be a lipid bilayer. The lipid bilayer is a model of a cell membrane and is used as an excellent platform for a range of experimental studies. For example, a lipid bilayer can be used to study membrane proteins in vitro by single channel recording. Alternatively, a lipid bilayer can be used as a biosensor to detect the presence of a range of substances. The lipid bilayer can be any lipid bilayer. Suitable lipid bilayers include, but are not limited to, planar lipid bilayers, supported bilayers or liposomes. The lipid bilayer is preferably a planar lipid bilayer. Suitable lipid bilayers are disclosed in WO 2008 / 102121, WO 2009 / 077734 and WO 2006 / 100484.

[0342] Methods for forming lipid bilayers are known in the art. Lipid bilayers are typically formed by the method of Montal and Mueller (Proceedings of the National Academy of Sciences of the United States of America, 1972; 69: 3561-3566), wherein a lipid monolayer is carried on an aqueous solution / air interface on either side of a perforation perpendicular to the interface. Lipids are typically added to the surface of an aqueous electrolyte solution by first dissolving the lipids in an organic solvent and then evaporating a drop of solvent on the surface of an aqueous solution on either side of the perforation. Once the organic solvent has evaporated, the solution / air interface on either side of the perforation physically moves up and down through the perforation until a bilayer is formed. A planar lipid bilayer can be formed by passing through a perforation in a membrane or through an opening in a groove.

[0343] The method of Montal and Mueller is popular because it is a cost-effective and relatively simple method for forming good quality lipid bilayers suitable for protein pore insertion. Other common methods for bilayer formation include tip dipping of liposomal bilayers, brushing of bilayers, and patch clamping.

[0344] Tip dip bilayer formation requires contacting the surface of the opening (e.g., pipette tip) to the surface of the test solution carrying the lipid monolayer. Again, a lipid monolayer is first generated at the solution / air interface by evaporating a drop of lipid dissolved in an organic solvent on the surface of the solution. The bilayer is then formed by the Langmuir-Schaefer process, and the bilayer requires mechanical automation to move the opening relative to the solution surface.

[0345] For the double layer of brushing, a drop of lipid dissolved in an organic solvent is directly applied to the perforation, which is immersed in an aqueous test solution. The lipid solution is thinly spread on the hole using a paintbrush or equivalent. The thinning of the solvent causes the formation of a lipid bilayer. However, it is difficult to completely remove the solvent from the double layer, and therefore the double layer formed by this method is not too stable and more prone to noise during electrochemical measurements.

[0346] Patch clamping is commonly used in the study of biological cell membranes. The cell membrane is clamped to the end of a pipette by suction and the patch is applied over the opening. The method has been adapted to produce lipid bilayers by clamping liposomes, which then rupture to leave the lipid bilayer sealed over the opening of the pipette. The method requires stable, giant and unilamellar liposomes and the creation of small openings in materials with glass surfaces.

[0347] Liposomes can be formed by sonication, extrusion, or the Mozafari method (Colas et al. (2007) Micron 38:841-847).

[0348] In a preferred embodiment, the lipid bilayer is formed as described in WO 2009 / 077734. Advantageously, the lipid bilayer is formed by dried lipids. In a most preferred embodiment, the lipid bilayer is formed across an opening as described in WO 2009 / 077734.

[0349] The lipid bilayer is formed by two layers of relative lipids. Two lipid layers are arranged so that their hydrophobic tail groups face each other to form a hydrophobic interior. The hydrophilic head group of lipid is outward toward the water environment on each side of the bilayer. The bilayer can be present in many lipid phases, including but not limited to liquid disordered phase (fluid lamellar), liquid ordered phase, solid ordered phase (lamellar gel phase, cross gel phase) and planar bilayer crystal (lamellar subgel phase, lamellar crystalline phase).

[0350] Any lipid composition that forms a lipid bilayer can be used. The lipid composition is selected so as to form a lipid bilayer with a desired characteristic, such as surface charge, the ability to support membrane proteins, bulk density or mechanical properties. The lipid composition can comprise one or more different lipids. For example, the lipid composition can contain up to 100 kinds of lipids. The lipid composition preferably contains 1 to 10 kinds of lipids. The lipid composition can comprise naturally occurring lipids and / or artificial lipids.

[0351] Lipids generally comprise a head group, an interface portion, and two hydrophobic tail groups that may be the same or different. Suitable head groups include, but are not limited to, neutral head groups such as diacylglycerides (DG) and ceramides (CM); zwitterionic head groups such as phosphatidylcholine (PC), phosphatidylethanolamine (PE), and sphingomyelin (SM); negatively charged head groups such as phosphatidylglycerol (PG); phosphatidylserine (PS), phosphatidylinositol (PI), phosphatidic acid (PA), and cardiolipin (CA); and positively charged head groups such as trimethylammonium-propane (TAP). Suitable interface portions include, but are not limited to, naturally occurring interface portions such as glycerol-based or ceramide-based portions. Suitable hydrophobic tail groups include, but are not limited to, saturated hydrocarbon chains such as lauric acid (n-dodecanoic acid), myristic acid (n-tetradecanoic acid), palmitic acid (n-hexadecanoic acid), stearic acid (n-octadecanoic acid) and arachidic acid (n-eicosanoic acid); unsaturated hydrocarbon chains such as oleic acid (cis-9-octadecanoic acid); and branched hydrocarbon chains such as phytanoyl. The length of the chain and the position and number of double bonds in the unsaturated hydrocarbon chain can vary. The length of the chain and the position and number of branches, such as methyl groups, in the branched hydrocarbon chain can vary. The hydrophobic tail group can be attached to the interface portion as an ether or ester. The lipid can be a mycolic acid.

[0352] The lipids can also be chemically modified. The head group or tail group of the lipid can be chemically modified. Suitable lipids whose head groups have been chemically modified include, but are not limited to, PEG-modified lipids, such as 1,2-diacyl-sn-glycero-3-phosphoethanolamine-N-[methoxy(polyethylene glycol)-2000]; functionalized PEG lipids, such as 1,2-distearoyl-sn-glycero-3-phosphoethanolamine-N-[biotinyl(polyethylene glycol)2000]; and lipids modified for conjugation, such as 1,2-dioleoyl-sn-glycero-3-phosphoethanolamine-N-(succinyl) and 1,2-dipalmitoyl-sn-glycero-3-phosphoethanolamine-N-(biotinyl). Suitable lipids whose tail groups have been chemically modified include, but are not limited to, polymerizable lipids such as 1,2-bis(10,12-tricosadiynyl)-sn-glycero-3-phosphocholine; fluorinated lipids such as 1-palmitoyl-2-(16-fluoropalmitoyl)-sn-glycero-3-phosphocholine; deuterated lipids such as 1,2-dipalmitoyl-D62-sn-glycero-3-phosphocholine; and ether-linked lipids such as 1,2-di-O-phytyl-sn-glycero-3-phosphocholine. The lipids may be chemically modified or functionalized to facilitate coupling to polynucleotides.

[0353] The amphiphilic layer, such as a lipid composition, typically includes one or more additives that will affect the properties of the layer. Suitable additives include, but are not limited to: fatty acids, such as palmitic acid, myristic acid, and oleic acid; fatty alcohols, such as palmityl alcohol, myristyl alcohol, and oleyl alcohol; sterols, such as cholesterol, ergosterol, lanosterol, sitosterol, and stigmasterol; lysophospholipids, such as 1-acyl-2-hydroxy-sn-glycero-3-phosphocholine; and ceramides.

[0354] The solid layer can be formed of organic and inorganic materials, including but not limited to: microelectronic materials; insulating materials, such as Si3N4, A12O3 and SiO; organic and inorganic polymers, such as polyamide; plastics, such as or elastomers, such as two-component addition-cured silicone rubber; and glass. The solid layer may be formed of graphene. Suitable graphene layers are disclosed in WO2009 / 035647. Yusko et al., Nature Nanotechnology, 2011; 6: 253-260 and U.S. Patent Application No. 2013 / 0048499 describe the delivery of proteins to transmembrane pores in a solid layer without the use of microparticles. The methods of the present invention can be used to improve the delivery of the methods disclosed in these documents.

[0355] The method is typically performed using: (i) an artificial amphiphilic layer comprising a pore; (ii) an isolated naturally occurring lipid bilayer comprising a pore; or (iii) a cell inserted with a pore. The method is typically performed using an artificial amphiphilic layer, such as an artificial triblock copolymer layer. The layer may comprise other transmembrane proteins and / or intramembrane proteins as well as other molecules in addition to the pore. Suitable equipment and conditions are discussed below. The method of the invention is typically performed in vitro.

[0356] The membrane to which the polynucleotide is delivered according to the methods of the invention is contained in a liquid. The liquid keeps the membrane "wet" and prevents it from drying out. The liquid is typically an aqueous solution. The aqueous solution typically has the same density as water. The density of the aqueous solution is typically about 1 g / cm 3 The density of a solution can vary depending on the temperature and the exact composition of the solution. The density of an aqueous solution is usually between about 0.97 and about 1.03 g / cm 3 between.

[0357] The membrane typically separates two volumes of aqueous solution. The membrane resists the flow of electric current between the volumes. Transmembrane pores inserted into the membrane selectively allow ions to pass through the membrane, which can be recorded as an electrical signal detected by electrodes in the two volumes of aqueous solution. The presence of a complex comprising a target polynucleotide can modulate the flow of ions and is detected by observing the resulting change in the electrical signal.

[0358] Array

[0359] The membrane is typically part of a membrane array, wherein each membrane preferably comprises a transmembrane pore.Accordingly, the present invention provides a method for detecting a target polynucleotide using a membrane array.

[0360] The membrane can be included in a device having an array of electrically isolated membranes, each membrane being individually addressed using its own electrode, such that the array is equivalent to many individual sensors measuring in parallel from a test sample. The membrane can be relatively densely packed, allowing a large number of membranes to be used for a given volume of test sample. Suitable membrane arrays and devices are described in the art, for example, in WO 2009 / 077734 and WO2012 / 042226. For example, WO 2009 / 077734 discloses a plurality of individually addressable lipid bilayers formed on an array of micropore orifices, each micropore containing an electrode and an aqueous medium in contact with the lipid bilayer.

[0361] The device is usually provided to the end user in a 'ready to use' state, wherein the membrane and transmembrane pores are pre-inserted. A typical device provided in a 'ready to use' state comprises an array of amphiphilic membranes, each membrane comprising transmembrane pores and arranged across the pores containing the liquid. WO2014 / 064443 discloses such a device and a method for making the same. The test liquid to be analyzed is applied to the upper surface of the amphiphilic membrane.

[0362] However, devices provided in a 'ready to use' state also require additional considerations, namely that the sensor does not dry out, i.e. liquid is not lost from the pores through the amphiphilic membrane, which would result in loss of performance or damage to the sensor. One solution to the problem of sensor drying out is to provide a buffer containing device on the surface of the amphiphilic membrane so that any evaporation through the membrane surface is minimized, and the liquid provided on either side of the membrane can have the same ionic strength to reduce any osmotic effects. In use, the buffer can be removed from the amphiphilic membrane surface and the test liquid to be analyzed introduced to contact the surface.

[0363] Some applications can use measurements of transmembrane electrical properties, such as ionic currents. To provide such measurements, the device can further include corresponding electrodes in each compartment, making them in electrical contact with the volume containing the polar medium. Other types of measurements can be performed, such as optical measurements, such as fluorescence measurements and FET measurements. Optical measurements and electrical measurements can be performed simultaneously (Heron AJ et al., Journal of the American Chemical Society 2009; 131(5): 1652-3).

[0364] The device may further comprise a common electrode. The device may further comprise a circuit connected between the common electrode and the corresponding electrodes in each compartment, the circuit being arranged to perform electrical measurements. Such electrical measurements may depend on a process occurring at or through the membrane.

[0365] The device may comprise an array of FETs to measure the nanopore array.

[0366] Transmembrane pore

[0367] A transmembrane pore is a structure that penetrates the membrane to some extent. It allows hydrated ions to flow through or into the membrane, driven by an applied potential. A transmembrane pore usually passes through the entire membrane, allowing hydrated ions to flow from one side of the membrane to the other side of the membrane. However, a transmembrane pore does not necessarily have to pass through the membrane. One end of it can be closed. For example, a pore can be a well, gap, channel, groove or slit in the membrane, along which hydrated ions can flow or into which they can flow.

[0368] Any transmembrane pore can be used in the present invention. The pore can be biological or artificial. Suitable pores include, but are not limited to, protein pores, polynucleotide pores, and solid-state pores. The pore can be a DNA origami pore (Langecker et al., Science, 2012; 338: 932-936). The pore can be a motor protein nanopore, for example, a nanopore that allows translocation of double-stranded polynucleotides. In some embodiments, the motor protein nanopore is capable of unwinding double-stranded polynucleotides. Exemplary motor protein nanopores include, but are not limited to, phi29 motor protein nanopores, for example, as described in Wendell et al. "Translocation of double-stranded DNA through membrane-adapted phi29 motor protein nanopores" Nat Nanotechnol, 4 (2009), pp. 765-772. In some embodiments, any nanopore described or referenced in Feng et al., "Nanopore-based fourth-generation DNA sequencing technology," Genomics, Proteomics & Bioinformatics (2015), Vol. 13, No. 1, pp. 4-16, can be used in various aspects described herein.

[0369] The transmembrane pore is preferably a transmembrane protein pore. A transmembrane protein pore is a polypeptide or a collection of polypeptides that allows hydrated ions such as polynucleotides to flow from one side of the membrane to the other side of the membrane. In the present invention, the transmembrane protein pore is capable of forming a hole that allows hydrated ions driven by an applied potential to flow from one side of the membrane to the other side. The transmembrane protein pore preferably allows polynucleotides to flow from one side of a membrane, such as a triblock copolymer membrane, to the other side. The transmembrane protein pore allows polynucleotides such as DNA or RNA to move through the hole.

[0370] The transmembrane protein pore may be a monomer or an oligomer. The pore preferably consists of several repeating subunits, such as at least 6, at least 7, at least 8, at least 9, at least 10, at least 11, at least 12, at least 13, at least 14, at least 15 or at least 16 subunits. The pore is preferably a hexamer, heptamer, octamer or nonamer pore. The pore may be a homo-oligomer or a hetero-oligomer.

[0371] Transmembrane protein pores typically comprise a barrel or channel through which ions can flow. The subunits of the pore typically surround a central axis and provide strands for the transmembrane barrel or channel or for a transmembrane α-helical bundle or channel.

[0372] The barrel or passage of the transmembrane protein hole usually comprise an amino acid that promotes interaction with nucleotides, polynucleotides or nucleic acids. These amino acids are preferably located near the contraction of the barrel or passage. The transmembrane protein hole usually comprises one or more positively charged amino acids, such as arginine, lysine or histidine, or aromatic amino acids, such as tyrosine or tryptophan. These amino acids usually promote the interaction between the hole and nucleotides, polynucleotides or nucleic acids.

[0373] The transmembrane protein pore used according to the present invention can be derived from a β-barrel pore or an α-helical bundle pore. The β-barrel pore includes a barrel or channel formed by a β-strand. Suitable β-barrel pores include, but are not limited to, β-toxins, such as α-hemolysin, anthrax toxin and leukocidin, and bacterial outer membrane proteins / porins, such as Mycobacterium smegmatis porins (Msp), such as MspA, MspB, MspC or MspD, CsgG, outer membrane porins F (OmpF), outer membrane porins G (OmpG), outer membrane phospholipase A and Neisseria autotransporter lipoprotein (NalP) and other pores, such as lysenin. The α-helical bundle pore includes a barrel or channel formed by an α-helix. Suitable α-helical bundle pores include, but are not limited to, inner membrane proteins and α outer membrane proteins, such as WZA and ClyA toxins.

[0374] The transmembrane pore may be derived from or based on Msp, α-hemolysin (α-HL), lysin, CsgG, ClyA, Sp1 and the hemolytic protein fragaceatoxin C (FraC). The transmembrane protein pore is preferably derived from CsgG, more preferably derived from CsgG of Escherichia coli strain K-12 substrain MC4100. Suitable pores derived from CsgG are disclosed in WO 2016 / 034591. The transmembrane pore may be derived from lysin. Suitable pores derived from lysin are disclosed in WO 2013 / 153359.

[0375] The wild-type α-hemolysin pore is formed by 7 identical monomers or subunits (ie, it is a heptamer). The sequence of one monomer or subunit of α-hemolysin-NN is disclosed, for example, in WO2016 / 059375.

[0376] The transmembrane protein pore is preferably derived from Msp, more preferably derived from MspA. Suitable pores derived from MspA are disclosed in WO 2012 / 107778.

[0377] Any protein described herein, such as a transmembrane protein pore, can be modified, for example, by adding histidine residues (his tags), aspartic acid residues (asp tags), streptavidin tags, flag tags, SUMO tags, GST tags or MBP tags, or by adding signal sequences to promote secretion from cells in the case where the polypeptide does not naturally contain such sequences, to aid in its identification or purification. An alternative to introducing a genetic tag is to chemically react the tag to a native or engineered position on the pore or construct. An example of such a manipulation is to react a gel shift reagent with an engineered cysteine ​​outside the pore. This has been shown to be a method for separating hemolysin isooligomers (Chem Biol. 1997 July; 4(7): 497-505).

[0378] The wells may be labeled with a revealing label. The revealing label may be any suitable label that allows the wells to be detected. Suitable labels include, but are not limited to, fluorescent molecules; radioactive isotopes, such as 125 I. 35 S; enzyme; antibody; antigen; polynucleotide; and ligand, such as biotin.

[0379] Any protein described herein, such as a transmembrane protein pore, can be made synthetically or by recombinant means. For example, the pore can be synthesized by in vitro translation and transcription (IVTT). The amino acid sequence of the pore can be modified to include non-naturally occurring amino acids or to increase the stability of the protein. When the protein is made by synthetic means, such amino acids can be introduced during manufacture. The pore can also be altered after synthesis or recombinant manufacture.

[0380] Any protein described herein, such as a transmembrane protein pore, can be made using standard methods known in the art. The polynucleotide sequence encoding the pore or construct can be derived and replicated using standard methods in the art. The polynucleotide sequence encoding the pore or construct can be expressed in a bacterial host cell using standard techniques in the art. The pore can be produced in a cell by in situ expression of the polypeptide from a recombinant expression vector. The expression vector optionally carries an inducible promoter to control the expression of the polypeptide. These methods are described in Sambrook, J. and Russell, D. (2001). Molecular Cloning: A Laboratory Manual, 3rd ed. Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York.

[0381] The pores can be produced on a large scale from protein producing organisms after purification by any protein liquid chromatography system or after recombinant expression. Typical protein liquid chromatography systems include FPLC, AKTA system, Bio-Cad system, Bio-Rad BioLogic system, and Gilson HPLC system.

[0382] Measuring ion current

[0383] Electrical and / or optical measurements can be used to monitor the flow of ions through the transmembrane pore.

[0384] The electrical measurement may be a current measurement, an impedance measurement, a tunneling measurement or a field effect transistor (FET) measurement.

[0385] Changes in ion flow through the transmembrane pore as the polypeptide translocates through the pore can be detected as changes in current, resistance, or optical properties. The effect measured can be electron tunneling through the transmembrane pore. The effect measured can be a change in potential due to the interaction of the polynucleotide with the transmembrane pore, where a local potential sensor is used to monitor the effect in a FET measurement.

[0386] Various different types of measurements can be performed. This includes, but is not limited to, electrical measurements and optical measurements. The Journal of the American Chemical Society 2009, 131 1652-1653 discloses a suitable optical method involving fluorescence measurements. Possible electrical measurements include: current measurements, impedance measurements, tunneling measurements (Ivanov AP et al., Nano Express January 12, 2011; 11(1): 279-85) and FET measurements (International Application WO 2005 / 124888). Optical measurements can be combined with electrical measurements (Soni GV et al., Scientific Instruments Review (Rev Sci Instrum.) January 2010; 81(1): 014301). The measurement can be a transmembrane current measurement, such as a measurement of the ionic current flowing through the pore.

[0387] Electrical measurements can be made using standard single-channel recording equipment as described in:

[0388] Stoddart D et al., Proc. Natl. Acad. Sci. USA, 12; 106(19):7702-7; Lieberman KR et al., J. Am. Chem. Soc. 2010; 132(50):17961-72; and International Application WO 2000 / 28312. Alternatively, electrical measurements can be performed using a multi-channel system, such as described, for example, in WO 2009 / 077734 and WO 2011 / 067559.

[0389] The method is preferably performed with an applied potential across the membrane. The applied potential may be a voltage potential. Alternatively, the applied potential may be a chemical potential. In some embodiments, the applied potential may be driven by an osmotic imbalance. An example of a chemical potential is across the membrane, such as using a salt gradient across an amphiphilic layer. Holden et al., Journal of the American Chemical Society, July 11, 2007; 129(27):8650-5 discloses a salt gradient. In some cases, the current passing through the pore as the polynucleotide moves relative to the pore is used to assess or determine the sequence of the polynucleotide.

[0390] Polynucleotide characterization

[0391] In some embodiments of various aspects described herein, the method may include further characterizing the target polynucleotide.While the target polynucleotide is in contact with the pore, one or more measurements are taken as the polynucleotide moves relative to the pore, which are indicative of one or more characteristics of the target polynucleotide.

[0392] The method may include determining whether the polynucleotide is modified. The presence or absence of any modification may be measured. The method preferably comprises determining whether the polynucleotide is modified by methylation, by oxidation, by damage using one or more proteins or using one or more markers, tags or spacers. A specific modification will cause a specific interaction with the hole, which can be measured using the method described below. For example, methylcytosine and cytosine can be distinguished based on the ion flow through the hole during the interaction of the hole with each nucleotide.

[0393] equipment

[0394] The method can be performed using any device suitable for studying a membrane / pore system in which a pore is present in the membrane. The method can be performed using any device suitable for transmembrane pore sensing. For example, the device comprises a chamber comprising an aqueous solution and a barrier that divides the chamber into two parts. The barrier typically has an orifice in which a membrane containing a pore is formed. Alternatively, the barrier forms a membrane in which a pore is present.

[0395] The method may be carried out using the apparatus described in WO 2008 / 102120.

[0396] Various different types of measurements can be performed. This includes, but is not limited to, electrical measurements and optical measurements. The Journal of the American Chemical Society 2009, 131 1652-1653 discloses a suitable optical method involving fluorescence measurements. Possible electrical measurements include current measurements, impedance measurements, tunneling measurements (Ivanov AP et al., Nano Lett. January 12, 2011; 11(1):279-85) and FET measurements (International Application WO 2005 / 124888). Optical measurements can be combined with electrical measurements (Soni GV et al., Rev Sci Instrum. January 2010; 81(1):014301). The measurement can be a transmembrane current measurement, such as a measurement of the ionic current flowing through the pore.

[0397] Electrical measurements can be made using standard single-channel recording equipment, as described in Stoddart D et al., Proc. Natl. Acad. Sci. USA, 12; 106(19):7702-7; Lieberman KR et al., J. Am. Chem. Soc. 2010; 132(50):17961-72; and WO 2000 / 28312. Alternatively, electrical measurements can be made using a multi-channel system, as described, for example, in WO 2009 / 077734 and WO 2011 / 067559.

[0398] The method is preferably performed with an applied potential across the membrane. The applied potential may be a voltage potential. Alternatively, the applied potential may be a chemical potential. An example of a chemical potential is across the membrane, such as using a salt gradient across an amphiphilic layer. Salt gradients are disclosed in Holden et al., Journal of the American Chemical Society, 2007 Jul 11; 129(27):8650-5. In some cases, the current passing through the pore as the polynucleotide moves relative to the pore is used to assess or determine the sequence of the polynucleotide.

[0399] The method may involve measuring the current through the hole when the polynucleotide moves relative to the hole. Therefore, the device may also include a circuit capable of applying a potential across the membrane and the hole and measuring the electrical signal. The method may be performed using a patch clamp or a voltage clamp. The method preferably involves using a voltage clamp.

[0400] The method of the present invention may involve measuring the current through the hole when the polynucleotide moves relative to the hole. Suitable conditions for measuring the ionic current through the transmembrane protein hole are known in the art and disclosed in the embodiments. The method is usually carried out when the voltage is applied across the membrane and the hole. The voltage used is usually +5V to -5V, such as +4V to -4V, +3V to -3V or +2V to -2V. The voltage used is usually -600mV to +600mV or -400mV to +400mV. The voltage used is preferably in a range with a lower limit and an upper limit, the lower limit being selected from -400mV, -300mV, -200mV, -150mV, -100mV, -50mV, -20mV and 0mV, and the upper limit being independently selected from +10mV, +20mV, +50mV, +100mV, +150mV, +200mV, +300mV and +400mV. The voltage used is more preferably in a range of 100mV to 240mV, and most preferably in a range of 120mV to 220mV. By using an increased applied potential, the differentiation of different nucleotides by the hole can be increased.

[0401] The method is usually carried out in the presence of any charge carrier, such as a metal salt, such as an alkali metal salt; a halogen salt, such as a chloride salt, such as an alkali metal chloride salt. The charge carrier may include an ionic liquid or an organic salt, such as tetramethylammonium chloride, trimethylphenylammonium chloride, phenyltrimethylammonium chloride or 1-ethyl-3-methylimidazolium chloride. In the exemplary device discussed above, the salt is present in an aqueous solution in the chamber. Potassium chloride (KCl), sodium chloride (NaCl), cesium chloride (CsCl), or a mixture of potassium ferrocyanide and potassium ferrocyanide are usually used. KCl, NaCl and a mixture of potassium ferrocyanide and potassium ferrocyanide are preferred. The charge carrier may be asymmetric across the membrane. For example, the type and / or concentration of the charge carrier may be different on each side of the membrane.

[0402] The salt concentration can be saturated. The salt concentration can be 3M or lower, and is typically 0.1 to 2.5M, 0.3 to 1.9M, 0.5 to 1.8M, 0.7 to 1.7M, 0.9 to 1.6M or 1M to 1.4M. The salt concentration is preferably 150mM to 1M. The method is preferably performed using a salt concentration of at least 0.3M, such as at least 0.4M, at least 0.5M, at least 0.6M, at least 0.8M, at least 1.0M, at least 1.5M, at least 2.0M, at least 2.5M or at least 3.0M. High salt concentrations provide a high signal-to-noise ratio and allow the current indicating the presence of nucleotides to be identified relative to the background of normal current fluctuations.

[0403] The method is typically performed in the presence of a buffer. In the exemplary apparatus discussed above, the buffer is present in an aqueous solution in the chamber. Any buffer may be used in the method of the invention. Typically, the buffer is a phosphate buffer. Other suitable buffers are HEPES and Tris-HCl buffers. The method is typically performed at a pH of 4.0 to 12.0, 4.5 to 10.0, 5.0 to 9.0, 5.5 to 8.8, 6.0 to 8.7, or 7.0 to 8.8, or 7.5 to 8.5. The pH used is preferably about 7.5.

[0404] The method can be carried out at a temperature of 0°C to 100°C, 15°C to 95°C, 16°C to 90°C, 17°C to 85°C, 18°C ​​to 80°C, 19°C to 70°C, or 20°C to 60°C. The method is typically carried out at room temperature. The method is optionally carried out at a temperature that supports enzyme function, such as at about 37°C.

[0405] Free nucleotides and cofactors

[0406] The method is usually carried out in the presence of free nucleotides or free nucleotide analogs and / or enzyme cofactors that promote the action of the polynucleotide binding protein. The method can also be carried out in the absence of free nucleotides or free nucleotide analogs and in the absence of enzyme cofactors. The free nucleotides can be one or more of any individual nucleotides discussed above. Free nucleotides include, but are not limited to: adenosine monophosphate (AMP), adenosine diphosphate (ADP), adenosine triphosphate (ATP), guanosine monophosphate (GMP), guanosine diphosphate (GDP), guanosine triphosphate (GTP), thymidine monophosphate (TMP), thymidine diphosphate (TDP), thymidine triphosphate (TTP), uridine monophosphate (UMP), uridine diphosphate (UDP), uridine triphosphate (UTP), cytidine monophosphate (CMP), cytidine diphosphate (CDP), cytidine triphosphate (CTP), cyclic adenosine monophosphate (cAMP), cyclic guanosine monophosphate (cGMP), deoxyribonucleic acid monophosphate (DGP), deoxyribonucleic acid monophosphate (DGP), deoxyribonucleic acid monophosphate (DTP ...TP), deoxyribonucleic acid monophosphate (DMP), deoxyribonucleic acid monophosphate (DTP), deoxyribonucleic acid monophosphate (DTP), deoxyribonucleic acid monophosphate (DTP), deoxyribonucleic acid monophosphate (DTP), deoxyribonu The free nucleotides are preferably selected from AMP, TMP, GMP, CMP, UMP, dAMP, dTMP, dGMP or dCMP. The free nucleotides are preferably adenosine triphosphate (ATP). The enzyme cofactor is a factor that allows a polynucleotide binding protein (e.g., a polynucleotide depolymerase) to work. The enzyme cofactor is preferably a divalent metal cation. The divalent metal cation is preferably Mg 2+ , Mn 2+ , Ca 2+ or Co 2+ The enzyme cofactor is most preferably Mg 2+ .

[0407] Reagent test kit

[0408] The present invention also provides a population of adaptors comprising a double-stranded barcode sequence, a single-stranded leader sequence, and a polynucleotide binding protein (e.g., a polynucleotide helicase) capable of separating the strands of a double-stranded polynucleotide and controlling the movement of the polynucleotide through a transmembrane pore, wherein the barcode sequence in each adaptor in the population is unique.

[0409] The present invention also provides a kit for use in the methods of the present invention. The kit typically comprises a population of adaptors according to the present invention. The kit may additionally comprise one or more membrane anchors, polynucleotide binding proteins (e.g., polynucleotide helicases) (which may be pre-bound to the adaptors), ligases, polymerases and / or free nucleotides or cofactors.

[0410] The kit may comprise components of any membrane disclosed above, such as an amphiphilic layer or a triblock copolymer membrane. The kit may further comprise a transmembrane pore. Any of the embodiments discussed above with reference to the method of the invention are equally applicable to the kit.

[0411] The kit of the present invention may additionally include one or more other reagents or instruments, and the reagent or instrument can implement any one of the above-mentioned embodiments. Such reagents or instruments include one or more of the following: suitable buffer (aqueous solution), a device for obtaining a sample from a subject (such as a container or an instrument comprising a needle), a device for amplifying and / or expressing polynucleotides, a film as defined above or a voltage clamp or a patch clamp device. Reagents may be present in the kit in a dry state so that a fluid sample is used for resuspension reagents. The kit may also optionally include instructions for enabling the kit to be used in the method of the present invention. The kit may include a magnet or an electromagnet. The kit may optionally include nucleotides.

[0412] The following examples illustrate non-limiting aspects of the present application.

[0413] Example

[0414] Example 1

[0415] This example shows that when double-stranded genomic DNA with a single-stranded leader sequence attached to the template strand and the complementary strand is contacted with a CsgG nanopore, the template strand and the complementary strand are sequentially but separately translocated through the nanopore under the control of the Dda helicase (the template is not connected to the complementary sequence by a hairpin). An increase in sequencing accuracy is observed compared to translocation of the same template / complementary sequence when connected together by a hairpin.

[0416] Materials and methods

[0417] DNA sample preparation

[0418] The genomic DNA was fragmented as follows. 46 μl of 1 μg of genomic DNA was transferred to a Covaris g-TUBE. The g-TUBE was then spun for 1 minute at room temperature at a speed that recommended the desired fragment size according to the manufacturer's protocol. The g-TUBE was then inverted and spun for another 1 minute to collect the fragmented DNA. The fragmented DNA was transferred to a clean 1.5 ml Eppendorf DNA LoBind tube. The success of the fragmentation process was assessed by analyzing 1 μl of the sample using an Agilent Bioanalyzer 12000 DNA chip according to the manufacturer's protocol.

[0419] Recovered DNA was treated with NEB's FFPE Repair Kit in a 62 μl volume according to the manufacturer's protocol and purified using 1x Agencourt AMPure XP beads followed by elution in 46 μl of nuclease-free water.

[0420] The FFPE-repaired DNA was then treated with NEB's Ultra II End-prep module to add a 5' phosphate and a single dA-nucleotide to each end of the fragmented DNA. According to the manufacturer's protocol, 45 μl of FFPE-repaired DNA was used for the reaction in a 60 μl volume, after which it was purified using 1x Agencourt AMPure XP beads and eluted in 31 μl of nuclease-free water. 1 μl of the recovered prepped DNA was quantified using a QuBit fluorometer.

[0421] Next, add 30 μl of the prepared DNA to a clean 1.5 ml Eppendorf DNA LoBind tube. Then add the Figure 3A A solution of adapters with Dda helicase attached thereto as shown (20 μl of Oxford Nanopore's SQK-LSK108 adapter mixture with Dda helicase attached to each adapter, as shown in FIG. Figure 3A The components of the ligation sequencing kit 1D (R9.4) are available from Oxford Nanopore Technologies (this volume of adapter mix is ​​optimized for ~350ng with a fragment size greater than or equal to 8kb), followed by the addition of 50μl of NEB's blunt end / TA ligation master mix, which was then mixed by inverting 5 times. The reaction was then left at room temperature for 10 minutes.

[0422] To purify the DNA, 40 μl of Ampure XP beads were added to the adapter ligation reaction from the previous step and mixed by inverting 5 times. The tube was then incubated on a rotating mixer (Hula mixer) at room temperature for 5 minutes. The tube was then placed on a magnetic stand to allow the beads to settle and the supernatant was then removed by pipetting. The tubes were removed from the rack before adding the adapter bead binding buffer (140 μl of Oxford Nanopore's SQK-LSK108 adapter bead binding buffer, a component of the ligation sequencing kit 1D (R9.4) commercially available from Oxford Nanopore Technologies). The beads were then resuspended by flicking the tube. After this the tubes were returned to the magnetic rack, the beads were pelleted, and the supernatant was removed by pipetting. This step was repeated a second time. After the wash step, the tubes were removed from the magnetic rack and the pellet was resuspended in elution buffer (25 μl of Oxford Nanopore's SQK-LSK108 elution buffer, a component of the ligation sequencing kit 1D (R9.4) commercially available from Oxford Nanopore Technologies). The tubes were then incubated at room temperature for 10 minutes and returned to the magnetic rack to pellet the beads. The eluate was transferred to a clean 1.5 ml Eppendorf DNA LoBind tube.

[0423] The sequencing reaction mixture was then prepared to produce Figure 3B The sequencing reaction mixture was prepared by adding 37.5 μl of RBF and 25.5 μl of LLB (components of the Sequencing by Ligation Kit 1D (R9.4) commercially available from Oxford Nanopore Technologies), both from the SQK-LSK108 kit of Oxford Nanopore, to 12.0 μl of the recovered library.

[0424] To generate double-stranded genomic DNA with a hairpin that connects the template to the complementary sequence (see Figure 1A Schematic diagram of the construct in ), a similar procedure as above was followed. In a similar procedure, Oxford Nanopore SQK-LSK102 adapter mix and SQK-LSK208 HP adapter (components of the ligation sequencing kit 2D (R9.4) commercially available from Oxford Nanopore Technologies) were used instead of the adapter mix mentioned above, and all other steps and components used were the same as mentioned above.

[0425] Nanopore sequencing

[0426] Electrical measurements were obtained using an Oxford Nanopore MinION R9.4 flow cell. Double-stranded genomic DNA (with or without a hairpin linking the template to the complementary sequence) was added to the nanopore system. The experiment was performed and the helicase-controlled DNA movement was monitored.

[0427] analyze

[0428] Comparison of events

[0429] The signal was aligned using the method disclosed in WO2016059427. Alignment values ​​of 95% or higher indicate that each event indicates that the template and its respective complementary sequence

[0430] Analysis of alignment signals

[0431] Subsequent analysis of the comparison signals was performed using the 2D method as described above to determine the nucleotide sequence.

[0432] result

[0433] FIG. 1 includes a schematic diagram of a DNA construct comprising a template and complementary DNA sequence attached to a Y-adapter and a hairpin, translocated through a nanopore under enzymatic control ( Figure 1A ), and FIG. 1 includes a graph showing the sequencing accuracy obtained ( Figure 1B ). Figure 2A and 2B Includes a cartoon illustration of a DNA construct comprising a template and a complementary DNA sequence, both attached to a leader sequence, translocated through a nanopore under enzymatic control ( Figure 2A ) and includes a graph showing the sequencing accuracy obtained ( Figure 2B ). Figure 1B and 2B Peaks illustrating the sequencing accuracy obtained using template alone, complementary sequence alone, and combined information from template and complementary sequence are shown. Figure 1B and 2B , it can be clearly seen that the accuracy of the complementary sequence alone increases (from ∼75% to >85%) when the template and complementary sequence are not connected by a hairpin loop, and the accuracy also increases when the information from the template and complementary sequence are combined when the template and complementary sequence are not connected.

[0434] Example 2 (Control: Modified Wells without Addition of Binding Sites for Analyte)

[0435] This embodiment describes a method for characterizing a template (captured first strand) and a complementary sequence (reverse complement of the first strand) of a double-stranded polynucleotide when the template and complementary sequence are not covalently linked. The identification of the determined template and complementary sequence after data analysis as described below is referred to as "follow-up pairing" in the embodiments. In some embodiments, when the pairing occurs within 1 minute of each other>80% overlap, potential follow-up pairing is identified. In some embodiments, when the follow-up pairing occurs immediately and has 95-100% overlap, potential follow-up pairing is identified.

[0436] Only template strands (i.e., those not classified as belonging to the following pair) are referred to herein as "T". Template strands belonging to the following pair are referred to herein as "T n The complementary strand that follows the pairing is referred to herein as "C n "n" can be used to identify the T that follows the pairing. n and C n Components, for example, T1 and C1 are followed by a pair.

[0437] In this example, a control adaptor containing a polynucleotide sequence that is not complementary to a pore tag (eg, a capture polynucleotide) attached to a modified nanopore is used to illustrate the frequency of follow-up pairing detection using a modified nanopore.

[0438] Exemplary Materials and Methods

[0439] Ligation of control adaptors to genomic DNA

[0440] The control adaptor is NB01 (native barcode 1), comprising a barcode upper strand (SEQ ID NO: 1) and a barcode lower strand (SEQ ID NO: 2).

[0441] SEQ ID NO:1

[0442] / 5Phos / AAGGTTAACACAAAGACACCGACAACTTTCTTCAGCACCT

[0443] SEQ ID NO:2

[0444] / 5Phos / GGTGCTGAAGAAAGTTGTCGGTGTCTTTGTGTTAACCTTAGCAAT

[0445] The control adapter was ligated to the genomic DNA using an Oxford Nanopore Technologies sequencing kit according to the manufacturer's instructions. 1000 ng of end-repaired and dA-tailed E. coli genomic DNA was ligated with 5.5 μl of 640 nM control adapter from above in 1x Blunt / TA master mix (NEB M0367L) at room temperature for 20 minutes. SPRI purification of the sample was performed as follows: 40 μL of Agencourt AMPure beads (Beckman Coulter) were added, the sample was mixed with a pipette, and incubated at room temperature for 5 minutes. Nuclease-free water (Ambion TM ) and anhydrous ethanol (Fisher Scientific) to prepare a 70% ethanol solution, and the solution was stored on ice.

[0446] The beads were pelleted on a magnetic stand and the supernatant was removed. The pelleted beads were washed with 500 μL of the 70% ethanol solution from above without disrupting the pellet. The supernatant was removed and the pelleted beads were washed again with 500 μL of the 70% ethanol solution. The 70% ethanol solution was removed and the pellet was briefly pulsed in a centrifuge and then placed back on the magnetic stand before removing the last remaining 70% ethanol solution.

[0447] The pellet was resuspended in 50 μL of nuclease-free water (Ambion TM ) and the sample was eluted from the beads on ice for 10 minutes. The beads were pelleted and the supernatant containing the sample was transferred to a fresh DNA LoBind tube (Eppendorf), which was called control-adapter-genomic-DNA.

[0448] Ligation of enzyme-adapter complex to control-adapter-genomic DNA

[0449] Aliquots of BAM (barcode adapter mixture) commercially available from Oxford Nanopore Technologies sequencing kits were thawed on ice. 20 μL of BAM were connected to 50 μL of control-adapter-genomic-DNA, 20 μL of NEBNext Quick ligation reaction buffer and 10 μL of QuickT4 DNA ligase (E6056L) at room temperature for 10 minutes. SPRI purification 2 of the sample was performed as follows: 40 μL of Agencourt AMPure beads (BeckmanCoulter) were then added, the sample was mixed with a pipette, and incubated at room temperature for 5 minutes. The beads were precipitated on a magnetic stand and the supernatant was removed. The precipitated beads were washed with 140 μL of adapter bead binding buffer, and the beads were resuspended in the adapter bead binding buffer by rotating the Eppendorf tube on the magnetic stand 180° twice in a row. The beads were precipitated on a magnetic stand and the supernatant was removed. Wash the pelleted beads again with 140 μL of buffer and resuspend the beads in buffer by rotating the Eppendorf tube on the magnetic stand 180° twice in succession. Allow the beads to pellet on the magnetic stand and remove the buffer, pulse the pellet briefly in the centrifuge and place back on the magnetic stand before removing the last remaining buffer.

[0450] The pellet was resuspended in 25 μL of nuclease-free water (Ambion TM ) and the library was eluted from the beads on ice for 10 min.

[0451] Preparation of tag-modified nanopores

[0452] A modified CsgG nanopore is prepared to allow conjugation of a pore tag. For example, a CsgG monomer is modified (e.g., by amino acid substitution), such as to provide cysteine, unnatural bases, etc., for pore tag conjugation. The modified CsgG monomer is prepared using a PT7 vector containing a plasmid encoding the amino acid sequence SEQ ID NO:7, with one or more amino acid substitutions as described herein.

[0453] SEQ ID NO:7: Amino acid sequence of wild-type E. coli CsgG without signal sequence (Uniprot accession number P0AEA2)

[0454] CLTAPPKEAARPTLMPRAQSYKDLTHLPAPTGKIFVSVYNIQDETGQFKPYPASNFSTAVPQSATAMLVTALKDSRWFIPLERQGLQNLLNERKIIRAAQENGTVAINNRIPLQSLTAANIMVEGSIIGYE SNVKSGGVGARYFGIGADTQYQLDQIAVNLRVVNVSTGEILSSVNTSKTILSYEVQAGVFRFIDYQRLLEGEVGYTSNEPVMLCLMSAIETGVIFLINDGIDRGLWDLQNKAERQNDILVKYRHMSVPPES

[0455] The plasmid was transformed into a BL21 derivative cell line and mutated to replace the endogenous CsgG gene with kanamycin resistance. The cells were plated on agar plates containing ampicillin (100 μg / ml) and kanamycin (30 μg / ml) and incubated at 37°C for 16 hours. A single colony was used to inoculate 100 ml of LB medium containing carbenicillin (100 μg / ml) and kanamycin (30 μg / ml), and the starter culture was then grown for 16 hours at 37°C / 250 rpm. 4 x 25 ml starter cultures were used to inoculate 4 x 500 ml of LB containing carbenicillin (100 μg / ml), kanamycin (30 μg / ml) 3 mM ATP, 15 mM MgSo4 and 0.5 mM rhamnose. The culture was grown until stationary phase was reached and then grown for another 2 hours at 37°C / 250 rpm. Glucose was added to 0.2%, the temperature was lowered to 18° C., and protein expression was induced by adding 1% α-lactose monohydrate once the culture was at 18° C. The culture was incubated at 18° C. / 250 rpm for 16 hours.

[0456] Cells were harvested by centrifugation and detergent lysed (Bugbuster). Once lysed, samples were subjected to initial streptavidin purification (5 ml HP streptavidin trap), eluted fractions were heated to 60°C, centrifuged and the supernatant was subjected to qIEX purification (1 ml Hi trap Q HP). Fractions containing the correct protein were pooled, concentrated and subjected to final polishing on 24 ml Superdex.

[0457] An aliquot of the above nanopore was modified with a morpholino oligonucleotide (SEQ ID NO: 8) as follows:

[0458] (SEQ ID NO:8): Morpholino oligonucleotide provided by GeneTools

[0459] / 5' / -GGAACCTCTCTGACAA / -3'-pyridyl-dithio /

[0460] 1.3 μL of 1M DTT (dithiothreitol) was added to 130 μL of the nanopores from above, which contained approximately 9.75 μg of nanopores, and incubated at room temperature for 1 hour. According to the manufacturer's instructions, the sample buffer was exchanged into reaction buffer (25 mM Tris, 150 mM NaCl, 2 mM EDTA, 0.1% SDS and 0.1% Brij58, pH 7) using a 0.5 mL 7 MWCO Zeba desalting column (Thermo Fisher Scientific). According to the manufacturer's instructions, the sample was buffer exchanged into reaction buffer again using a 7 MWCO Zeba desalting column (Thermo Fisher Scientific). The 300 nmol morpholino oligonucleotides provided by GeneTools were dissolved in 150 μL of nuclease-free water (Ambion TM ) to prepare a 2 mM stock solution of morpholino oligonucleotide (SEQ ID NO: 8). This was added to the buffer exchanged sample to a final concentration of 500 μM and incubated overnight at room temperature. This is called a modified nanopore.

[0461] Electrical Measurement

[0462] Electrical measurements were taken from a single modified nanopore inserted into a block copolymer in phosphate buffer (e.g., containing potassium ferrocyanide (II) and potassium ferrocyanide (III), pH 8.0). Upon reaching the single modified nanopore inserted into the block copolymer, any excess modified nanopore was removed by flushing with 2 mL of buffer.

[0463] The initiation buffer was flowed through the nanopore system. To prepare the sequencing mixture, 400 nM tether (SEQ ID NO: 9), the recovered bead-purified library and the library-loaded beads were mixed in the buffer according to the manufacturer's instructions. The sequencing mixture was then added to the nanopore system. The experiment was performed at 180 mV and the DNA movement controlled by the helicase was monitored.

[0464] SEQ ID NO:9

[0465] / 5Chol-TEG / TT / iSp18 / / iSp18 / / iSp18 / / iSp18 / TTGACCGCTCGCCTC

[0466] Data analysis

[0467] When the DNA chain passes through the modified nanopore, the current change through the nanopore is measured and collected. The sequence of the chain is then determined using a base recognition algorithm (e.g., a recurrent neural network (RNN) algorithm) to obtain fastq data. Subsequently, the fastq sequence data is compared with the reference genome using a sequence alignment tool known in the art.

[0468] In order to identify paired mutually complementary chains (paired templates and complementary chains), the overlap fraction between chains was calculated. The overlap fraction is defined as the length (in bases) of the continuous segment of bases common to the two chains in the genome, normalized by the length (in bases) of the portion of the genome spanned (not necessarily overlapped) by the two chains. The maximum overlap fraction of each chain is calculated as the maximum overlap between the chain and all other chains that pass through the hole within 1 minute of the chain (before or after the chain). Therefore, a high maximum score indicates that a given chain belongs to a complementary pair (as a template or complementary sequence), while a low overlap fraction indicates that the chain does not belong to a complementary pair.

[0469] Table 2 shows the percentage of chains with different maximum overlap fraction values ​​measured using unmodified or modified nanopores as described herein

[0470]

[0471] result

[0472] A helicase, such as a Dda helicase, such as that described in International PCT Publication No. WO 2015 / 055981 (the contents of which are incorporated herein by reference in their entirety), is used to control the movement of a polynucleotide through a modified nanopore, such as a modified CsgG nanopore as described in International PCT Publication No. WO 2016 / 034591 (the contents of which are incorporated herein by reference in their entirety). Table 3 shows the data of Examples 2-5 as described herein. It lists the number of mapped chains (e.g., using a mapping method known in the art) that are assigned to T, ... n and C n The second row of Table 3 below shows the T, T n and C n The number of chains. 2.9% of the chains were classified as following pairs.

[0473] In Example 5, the frequency of follow-up pairing was lower (Table 3, row 5), at only 0.6%, when using an unmodified nanopore. This suggests that using a tag on the nanopore enhances follow-up events even when the analyte does not contain the exact sequence. Without wishing to be bound by theory, this may be because the pore-tag can bind to exposed ssDNA of complementary sequence (relative to the defined site) with low efficiency.

[0474] Example 3 (Modified pore and follower adapter embodiment 1)

[0475] This embodiment describes a method for characterizing a template (captured first strand) and a complementary sequence (reverse complement of the first strand) of a double-stranded polynucleotide when the template and complementary sequence are not covalently linked. The identification of the determined template and complementary sequence after data analysis as described below is referred to as "follow-up pairing" in the embodiments. In some embodiments, when the pairing occurs within 1 minute of each other>80% overlap, potential follow-up pairing is identified. In some embodiments, when the follow-up pairing occurs immediately and has 95-100% overlap, potential follow-up pairing is identified.

[0476] Only template strands (i.e., those not classified as belonging to the following pair) are referred to herein as "T". Template strands belonging to the following pair are referred to herein as "T n The complementary strand that follows the pairing is referred to herein as "C n” . "n" can be used to identify the T that follows the pairing n and C n Components, for example, T1 and C1 are followed by a pair.

[0477] In this embodiment, according to one embodiment described herein, the frequency increase of detection following pairing is achieved by following the connection of the adapter. As shown in Figures 9-10, the adapter contains a capture polynucleotide sequence in the duplex stem so that the capture polynucleotide sequence is only revealed when the chain is unwound. The capture polynucleotide sequence is complementary to the polynucleotide sequence attached to the modified nanopore. In this embodiment, the capture polynucleotide sequence does not contain a spacer, such as sp18, in the duplex stem, and such adapters produce a following efficiency of about 10% (i.e., the following % of all chains reaches about 10%).

[0478] Materials and methods

[0479] Follow the ligation of adapters to genomic DNA

[0480] One embodiment of the follower adapter includes a barcode upper strand (SEQ ID NO: 3) and a barcode lower strand (SEQ ID NO: 4) annealed together at 10 μM and 11 μM, respectively, in 50 mM HEPES pH 8, 100 mM potassium acetate at 2°C / min from 95°C to 22°C. The hybridized DNA is referred to as barcode adapter 2. 6.4 μL of the follower adapter was added to 93.6 μL of 50 mM Tris-HCl pH 7.5, 20 mM sodium chloride to produce a 640 nM dilution of the follower adapter 1.

[0481] SEQ ID NO:3

[0482] / 5Phos / GGCGTCTGCTTGGGTGTTTAACCTTTTT GTCAGAGAGGTTCC AA GTCAGAGAGG TTCC T

[0483] SEQ ID NO:4

[0484] / 5Phos / GGAACCTCTCTGACTTGGAACCTCTCTGACAAAAAGGTTAAACACCCAAGCAGACGCCAGCAAT

[0485] The Oxford Nanopore Technologies sequencing kit was used to perform the ligation of the follow-up adapter to the genomic DNA according to the manufacturer's instructions. 1000 ng of end-repaired and dA-tailed E. coli genomic DNA was ligated with 5.5 μL of 640 nM follow-up adapter from above in 1x Blunt / TA master mix (NEB M0367L) at room temperature for 20 minutes. SPRI purification was then performed as described in Example 2. This sample will be referred to as the follow-up adapter-genomic DNA.

[0486] Ligation of the enzyme-adapter complex followed by adapter-genomic DNA

[0487] An aliquot of BAM (barcode adapter mix) commercially available from Oxford Nanopore Technologies sequencing kit was thawed on ice. 20 μL of BAM was ligated at room temperature with 100 μL to 50 μL of follow-up adapter-genomic DNA, 20 μL of NEBNext Quick ligation reaction buffer and 10 μL of QuickT4 DNA ligase (E6056L) for 10 minutes. SPRI purification 2 was then performed as described in Example 2.

[0488] Preparation of tag-modified nanopores

[0489] The method of preparing a nanopore modified to include a polynucleotide sequence complementary to the capture polynucleotide sequence of the adaptor is performed in a similar manner as described in Example 2 above.

[0490] Electrical Measurement

[0491] The method of measuring and obtaining electrical measurements as the strands pass through the nanopore is performed in a similar manner as described in Example 2 above.

[0492] Data analysis

[0493] Data processing and analysis of the collected electrical measurements was performed in a similar manner as described in Example 2 above.

[0494] result

[0495] A helicase, such as a Dda helicase, such as the helicase described in International PCT Publication No. WO 2015 / 055981 (the contents of which are incorporated herein by reference in their entirety), is used to control the movement of a polynucleotide through a modified nanopore, such as a modified CsgG nanopore as described in International PCT Publication No. WO 2016 / 034591 (the contents of which are incorporated herein by reference in their entirety). Row 3 of Table 3 shows the T, T, and T values ​​assigned by data analysis in an example using a follower adapter as described in this Example. n and C n Number of chains. 7.7% of all chains were classified as following pairs.

[0496] Example 4 (Modified pore and follower adapter embodiment 2)

[0497] This embodiment describes a method for characterizing a template (captured first strand) and a complementary sequence (reverse complement of the first strand) of a double-stranded polynucleotide when the template and complementary sequence are not covalently linked. The identification of the determined template and complementary sequence after data analysis as described below is referred to as "follow-up pairing" in the embodiments. In some embodiments, when the pairing occurs within 1 minute of each other>80% overlap, potential follow-up pairing is identified. In some embodiments, when the follow-up pairing occurs immediately and has 95-100% overlap, potential follow-up pairing is identified.

[0498] Only template strands (i.e., those not classified as belonging to the following pair) are referred to herein as "T". Template strands belonging to the following pair are referred to herein as "T n The complementary strand that follows the pairing is referred to herein as "C n "n" can be used to identify the T that follows the pairing. n and C n Components, for example, T1 and C1 are followed by a pair.

[0499] In this example, the frequency of detection of follow-up pairing is increased by ligation of a follow-up adapter according to one embodiment described herein. The adapter contains a capture polynucleotide sequence within the duplex stem such that the capture polynucleotide sequence is revealed only when the strands are unzipped. The capture polynucleotide sequence is complementary to the polynucleotide sequence attached to the modified nanopore. The adapter also contains an enhancement C n The capture efficiency of the chemical is improved. For example, in this example, the capture polynucleotide sequence contains a spacer, such as sp18, within the duplex stem, and such an adaptor produces a following efficiency of about 60% (i.e., the following % of all chains reaches ~60%). Without wishing to be bound by theory, this improvement may be due to a variety of reasons, for example, because the enzyme pauses briefly when encountering sp18, thereby giving more coupling time, thereby improving the hybridization efficiency of the capture polynucleotide sequence with the complementary sequence tag on the modified nanopore, and / or because sp18s give more flexibility for coupling geometry, and / or because the increased length of sp18s is a better geometry and displays the sequence closer to the hole tag (e.g., C n The orientation of T is changed so that capture efficiency is improved, and / or T is obscured / prevented from being captured).

[0500] Materials and methods

[0501] Follow the ligation of adapters to genomic DNA

[0502] One embodiment of the follower adapter includes a barcode upper strand (SEQ ID NO: 5) and a barcode lower strand (SEQ ID NO: 6) annealed together at 10 μM and 11 μM, respectively, in 50 mM HEPES pH 8, 100 mM potassium acetate at 2°C / min from 95°C to 22°C. The hybridized DNA is referred to as barcode adapter 2. 6.4 μL of the follower adapter was added to 93.6 μL of 50 mM Tris-HCl pH 7.5, 20 mM sodium chloride to produce a 640 nM dilution of the follower adapter 2.

[0503] SEQ ID NO:5

[0504] / 5Phos / GGCGTCTGCTTGGGTGTTTAACC / iSp18 / / iSp18 / / iSp18 / / iSp18 / TTTTT GTCAG AGAGGTTCC AA GTCAGAGAGGTTCC T

[0505] SEQ ID NO:6

[0506] / 5Phos / GGAACCTCTCTGACTTGGAACCTCTCTGACAAAAA / iSp18 / / iSp18 / / iSp18 / / iSp18 / GGT TAAACACCCAAGCAGACGCCAGCAAT

[0507] The Oxford Nanopore Technologies sequencing kit was used to perform the ligation of the follow-up adapter to the genomic DNA according to the manufacturer's instructions. 1000 ng of end-repaired and dA-tailed E. coli genomic DNA was ligated with 5.5 μL of 640 nM follow-up adapter from above in 1x Blunt / TA master mix (NEB M0367L) at room temperature for 20 minutes. SPRI purification was then performed as described in Example 2. This sample will be referred to as the follow-up adapter-genomic DNA.

[0508] Ligation of the enzyme-adapter complex followed by adapter-genomic DNA

[0509] An aliquot of BAM (barcode adapter mix) commercially available from Oxford Nanopore Technologies sequencing kit was thawed on ice. 20 μL of BAM was ligated at room temperature with 100 μL to 50 μL of follow-up adapter-genomic DNA, 20 μL of NEBNext Quick ligation reaction buffer and 10 μL of QuickT4 DNA ligase (E6056L) for 10 minutes. SPRI purification 2 was then performed as described in Example 2.

[0510] Preparation of tag-modified nanopores

[0511] The method of preparing a nanopore modified to include a polynucleotide sequence complementary to the capture polynucleotide sequence of the adaptor is performed in a similar manner as described in Example 2 above.

[0512] Electrical Measurement

[0513] The method of measuring and obtaining electrical measurements as the strands pass through the nanopore is performed in a similar manner as described in Example 2 above.

[0514] Data analysis

[0515] Data processing and analysis of the collected electrical measurements was performed in a similar manner as described in Example 2 above.

[0516] result

[0517] A helicase, such as a Dda helicase, such as the helicase described in International PCT Publication No. WO 2015 / 055981 (the contents of which are incorporated herein by reference in their entirety), is used to control the movement of a polynucleotide through a modified nanopore, such as a modified CsgG nanopore as described in International PCT Publication No. WO 2016 / 034591 (the contents of which are incorporated herein by reference in their entirety). Row 4 of Table 3 shows the T, T, and T values ​​assigned by data analysis in an example using a follower adapter as described in this Example. n and C n The number of chains. 45.1% of the chains were classified as following pairs.

[0518] Figures 11A-11B Current traces from the experiments described in this example are shown. n and C n The labels correspond to the data shown in Table 4 below. The data shown in Table 4 below were obtained as described in the Data Analysis section and are an example portion of the data summarized in Table 3 for Examples 2, 3 and 4.

[0519] Figures 12A-12D The template (T) following the paired polynucleotide is shown. n ) and complementary sequence (C n ) as it translocates through the modified nanopore. The nanopore returns to Fig. 12A The opening between the template and the complementary sequence in the sequencing Fig. 12C ), accounting for the fact that the template and complementary strands are not covalently linked.

[0520] SEQ ID NO:10 and SEQ ID NO:11 are derived from Figures 12A to 12D Sequences derived from the Oxford Nanoopore Technologies base-recognition RNN algorithm of polynucleotides. These can be aligned with high fidelity to demonstrate sequencing by the modified nanopores as templates and complementary sequences from randomly fragmented double-stranded polynucleotide fragments.

[0521] exist Figures 12A-12D In the figure, the position marked with * is the Sp18 spacer found in SEQ ID NO:5 and SEQ ID NO:6. The presence of this motif indicates that the follower adapter as described in this example is successfully connected to the polynucleotide, and the presence of the follower adapter greatly enhances the percentage of follower pairing (as shown in Table 3).

[0522] Fig.13The "strand interval time" is shown on a logarithmic scale in seconds. The label "strand" is used to classify the electrical signal of the movement of the helicase-controlled polynucleotide sequence through the nanopore. This is classified using methods known in the art. The strands are prone to splitting due to returning to the open pore. The arrows indicate a significant population in the data from Example 4, which uses a follow-up adapter as described in that example. This population indicates an increase in the proportion of follow-up pairings because in Examples 2 and 4, T n and C n The interval is usually shorter than T and T or T and T n or C n time interval with T. This suggests that follow-up adapters can also be used to increase throughput when the time interval between strands is reduced.

[0523] Example 5

[0524] This embodiment describes a method for characterizing a template (captured first strand) and a complementary sequence (reverse complement of the first strand) of a double-stranded polynucleotide when the template and complementary sequence are not covalently linked. The identification of the determined template and complementary sequence after data analysis as described below is referred to as "follow-up pairing" in the embodiments. In some embodiments, when the pairing occurs within 1 minute of each other>80% overlap, potential follow-up pairing is identified. In some embodiments, when the follow-up pairing occurs immediately and has 95-100% overlap, potential follow-up pairing is identified.

[0525] Only template strands (i.e., those not classified as belonging to the following pair) are referred to herein as "T". Template strands belonging to the following pair are referred to herein as "T n The complementary strand that follows the pairing is referred to herein as "C n "n" can be used to identify the T that follows the pairing. n and C n Components, for example, T1 and C1 are followed by a pair.

[0526] In this example, standard components from an Oxford Nanopore Technologies sequencing kit were used together with a Minion and a Flowcell (comprising a SpotON flowcell that has not been modified to include a nanopore array with pore tags as described herein) to demonstrate the frequency of detecting follow-up pairings in the absence of modified nanopores and follow-up adapters as described herein.

[0527] Materials and methods

[0528] Ligation of control adaptors to genomic DNA

[0529] Ligation of control adapters (e.g., as described in Example 2) to genomic DNA was performed using an Oxford Nanopore Technologies sequencing kit according to the manufacturer's guidelines. 1000 ng of end-repaired and dA-tailed E. coli genomic DNA was ligated in 100 μL with 5.5 μL of 640 nM follow-up adapter from above in 1x Blunt / TA master mix (NEB M0367L) at room temperature for 20 minutes. SPRI purification was then performed as described in Example 2. This sample will be referred to as follow-up adapter-genomic DNA.

[0530] Ligation of the enzyme-adapter complex followed by adapter-genomic DNA

[0531] An aliquot of BAM (barcode adapter mix) commercially available from Oxford Nanopore Technologies sequencing kit was thawed on ice. 20 μL of BAM was ligated at room temperature for 10 minutes with 50 μL of control-adapter-genomic-DNA, 20 μL of NEBNext Quick ligation reaction buffer and 10 μL of QuickT4 DNA ligase (E6056L) at 100 μL. SPRI purification 2 was then performed as described in Example 2.

[0532] Electrical Measurement

[0533] The method of measuring and obtaining electrical measurements as the strands pass through the nanopore is performed in a similar manner as described in Example 2 above.

[0534] Data analysis

[0535] Data processing and analysis of the collected electrical measurements was performed in a similar manner as described in Example 2 above.

[0536] result

[0537] A helicase, such as a Dda helicase, such as the helicase described in International PCT Publication No. WO 2015 / 055981 (the contents of which are incorporated herein by reference in their entirety), for controlling the movement of a polynucleotide through a modified nanopore, such as a modified CsgG nanopore as described in International PCT Publication No. WO 2016 / 034591 (the contents of which are incorporated herein by reference in their entirety). Row 5 of Table 3 below shows, in an example, the T, T, and T values ​​specified by data analysis. n and C n Number of chains. 0.6% of all chains were classified as following pairs.

[0538] Table 3

[0539]

[0540] Table 3 shows the strand numbers identified as Template-only (not followed by its mutual complement), Template-n (following the first strand of the pair), and Complement-n (following the reverse complement of the pair) for Examples 2-5 herein.

[0541] Table 4

[0542]

[0543]

[0544] Table 4 contains the analysis data for the strand shown in Figure 11 from a single lane (lane 241) of a MinION follow-up run. The table contains the following columns:

[0545] Fast5 = unique file name for the chain, saved as fast5 output during MinION run

[0546] Start = start time of the chain (seconds)

[0547] End = End time of the chain (seconds)

[0548] Duration = duration of the chain (seconds)

[0549] Genome_start_position = the starting position of the segment of the aligned strand in the genome reference after aligning the base-called strand to the E. coli reference

[0550] Genome_end_position = the ending position of the segment of the aligned strand in the genome reference after aligning the base-called strand to the E. coli reference

[0551] Interval = the time between chains for pairing (in seconds)

[0552] Overlap ratio = for a pair, compare the overlap ratio of the alignment overlap (between genome_start_position and genome_end_position)

[0553] Pairs are identified by very short spacing between strands, and they overlap when aligned to a reference.

[0554] Example 6

[0555] This example describes a method for increasing the number of sequenced DNA molecules when low concentrations of DNA are added to a sequencing apparatus.

[0556] In this example, this is accomplished by generating a modified DNA-enzyme adapter containing a DNA sequence complementary to the polynucleotide sequence attached to the modified nanopore. The exemplary adapter used in this example is Figures 32A-35 Shown in.

[0557] Exemplary Materials and Methods

[0558] Adapter preparation (adapter design A, e.g., Fig.32A (shown)

[0559] The upper chain (SEQ ID NO: 12), the blocking chain (SEQ ID NO: 13) and the lower chain (SEQ ID NO: 14) were annealed at 10 μM, 11 μM and 11 μM in 50 mM Hepes, 100 mM KOAc, pH 8 (total volume 40 μL) by adjusting the temperature from 95 ° C to 22 ° C at 2 ° C / min. The annealed chain was mixed with 800 μL of 2.8 μM helicase (e.g., including Dda helicase of wild type or its mutant as known in the art) and incubated at room temperature for 5 minutes. 10 μL of 8.1 mM tetramethyl azodicarbonamide was added to the solution and incubated at 35 ° C for 1 hour. NaCl was added to a final concentration of 500 mM, MgCl2 was added to a final concentration of 10 mM, ATP was added to a final concentration of 1 mM, and the solution was incubated at room temperature for 30 minutes. The sample was purified by HPLC.

[0560] SEQ ID NO:12

[0561] / 5SpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iS pC3 / / iSpC3 / / iSpC3 / / iSpC3 / GGCGTCTGCTTGGGTGTTTAACC TTTTTTTTTT / iSp18 / AATGTACTTCGTTCAGTTACGTATTGCT

[0562] SEQ ID NO:13

[0563] / 5BNA-G / / iBNA-G / / iBNA-T / / iBNA-T / / iBNA-A / AACACCCAAGCAGACGCCTAAGTCAGAGAGGTTCC

[0564] SEQ ID NO:14

[0565] / 5Phos / GCAAT ACGTAACTGAACGAAGT / iBNA-A / / iBNA-meC / / iBNA-A / / iBNA-T / / iBNA-T / TTT GAGGCGAGCGGTCAA

[0566] Adapter preparation (adapter design B, e.g., Fig.34A (shown)

[0567] The upper chain (SEQ ID NO: 12), the blocking chain (SEQ ID NO: 15) and the lower chain (SEQ ID NO: 16) were annealed at 10 μM, 11 μM and 11 μM in 50 mM Hepes, 100 mM KOAc, pH 8 (total volume 40 μL) by adjusting the temperature from 95 ° C to 22 ° C at 2 ° C / min. The annealed chain was mixed with 800 μL of 2.8 μM helicase (e.g., including Dda helicase of wild type or its mutant as known in the art) and incubated at room temperature for 5 minutes. 10 μL of 8.1 mM tetramethyl azodicarbonamide was added to the solution and incubated at 35 ° C for 1 hour. NaCl was added to a final concentration of 500 mM, MgCl2 was added to a final concentration of 10 mM, ATP was added to a final concentration of 1 mM, and the solution was incubated at room temperature for 30 minutes. The sample was purified by HPLC.

[0568] SEQ ID NO:15

[0569] GGTTAAACACCCAAGCAGACGCC TTTGAGGCGAGCGGTCAA

[0570] SEQ ID NO:16

[0571] / 5Phos / GCAAT ACGTAACTGAACGAAGT / iBNA-A / / iBNA-meC / / iBNA-A / / iBNA-T / / iBNA-T / TTT TAAGTCAGAGAGGTTCC

[0572] Connection preparation

[0573] Adapter Design A was buffer exchanged into 50 mM Tris, 20 mM NaCl, pH 8 using 75 μL 7k MWCO zeba spin columns, using 2 columns with 10 μL per column and following the manufacturer's protocol. As measured by the dsDNA assay kit, the sample was diluted to 2.65 ng / μL. The following components were combined, mixed, and incubated at room temperature for 10 minutes in a 1.5 mL DNA low binding tube (supplied by Eppendorf): 11.3 μL adapter (2.65 ng / μL in 50 mM Tris, 20 mM NaCl, pH 8), 8.7 μL 50 mM Tris, 20 mM NaCl (pH 8), 0.9 μL 3.6 kb dA-tail DNA (40 ng / μL; SEQ ID NO: 26)), 29.1 μL distilled water, and 50 μL TA ligase master mix (supplied by New England Biolabs (UK)).

[0574] Then add 40 μL of Agencourt AMPure beads (Beckman Coulter), mix the sample with a pipette, and incubate at room temperature for 5 minutes. The beads are pelleted on a magnetic stand and the supernatant is removed. The pelleted beads are washed with 140 μL of adapter bead binding buffer and resuspended in adapter bead binding buffer by rotating the Eppendorf tube on the magnetic stand 180° twice in a row. The beads are pelleted on a magnetic stand and the supernatant is removed. The pelleted beads are washed again with 140 μL of buffer and resuspended in buffer by rotating the Eppendorf tube on the magnetic stand 180° twice in a row. The beads are pelleted on a magnetic stand and the buffer is removed, the pellet is briefly pulsed in a centrifuge, then returned to the magnetic stand, and the last remaining buffer is removed.

[0575] The pellet was resuspended in 25 μL of elution buffer containing the tether (SEQ ID NO: 9) by pipetting mixing, and the library was eluted from the beads for 10 minutes on ice.

[0576] Hole modification

[0577] Modified CsgG nanopores are prepared to allow conjugation of pore tags. For example, CsgG monomers are modified (e.g., by amino acid substitution), such as providing cysteine, non-natural bases, etc., for pore tag conjugation. Modified CsgG monomers are prepared using a PT7 vector containing a plasmid encoding the amino acid sequence SEQ ID NO:7, with one or more amino acid substitutions as described herein. The plasmid is transformed into a BL21-derived cell line and mutated to replace the endogenous CsgG gene with kanamycin resistance. The cells are plated on agar plates containing ampicillin (100 μg / ml) and kanamycin (30 μg / ml) and incubated at 37°C for 16 hours. A single colony is used to inoculate 100 ml of LB medium containing carbenicillin (100 μg / ml) and kanamycin (30 μg / ml), and the starter culture is then grown at 37°C / 250 rpm for 16 hours. 4x 25ml starter cultures were used to inoculate 4x 500ml LB containing carbenicillin (100μg / ml), kanamycin (30μg / ml) 3mM ATP, 15mM MgSo4, 0.5mM rhamnose. The cultures were grown until stationary phase was reached and then grown for another 2 hours at 37°C / 250rpm. Glucose was added to 0.2%, the temperature was lowered to 18°C, and once the culture was at 18°C, protein expression was induced by adding 1% α-lactose monohydrate. The cultures were incubated at 18°C / 250rpm for 16 hours.

[0578] Cells were harvested by centrifugation and detergent lysed (Bugbuster). Once lysed, samples were subjected to initial streptavidin purification (5 ml HP streptavidin trap), eluted fractions were heated to 60°C, centrifuged and the supernatant was subjected to qIEX purification (1 ml Hi trap Q HP). Fractions containing the correct protein were pooled, concentrated and subjected to final polishing on 24 ml Superdex.

[0579] As described below, an aliquot of the above nanopores was modified with a morpholino oligonucleotide (SEQ ID NO: 8): 1.3 μL of 1M DTT (dithiothreitol) was added to 130 μL of the nanopores from above, which contained approximately 9.75 μg of nanopores, and incubated at room temperature for 1 hour. Following the manufacturer's instructions, the sample buffer was exchanged into a reaction buffer (25 mM Tris, 150 mM NaCl, 2 mM EDTA, 0.1% SDS, and 0.1% Brij58, pH 7) using a 0.5 mL 7 MWCO Zeba desalting column (Thermo Fisher Scientific). Following the manufacturer's instructions, the sample was buffer exchanged into the reaction buffer again using a 7 MWCO Zeba desalting column (Thermo Fisher Scientific). The 300 nmol morpholino oligonucleotide provided by GeneTools was dissolved in 150 μL of nuclease-free water (Ambion TM ) to prepare a 2 mM stock solution of morpholino oligonucleotide (SEQ ID NO: 8). This was added to the buffer exchanged sample to a final concentration of 500 μM and incubated overnight at room temperature. This is called a modified nanopore.

[0580] Electrical Measurement

[0581] Electrical measurements were taken from a single modified nanopore inserted in a block copolymer in buffer (25 mM phosphate buffer, 150 mM potassium ferrocyanide (II), 150 mM potassium ferrocyanide (III), pH 8.0). After reaching the single modified pore inserted in the block copolymer, 2 mL of buffer (25 mM phosphate buffer, 150 mM potassium ferrocyanide (II), 150 mM potassium ferrocyanide (III), pH 8.0) was flowed through the system to remove any excess modified nanopore.

[0582] Flow the priming buffer through the nanopore system. To prepare the sequencing mixture, place the priming buffer, (as in dsDNA HS Assay Kit) and distilled water were mixed together. The sequencing mix was then added to the nanopore system.

[0583] result

[0584] A helicase (eg, a helicase as known in the art, including wild-type or mutants thereof) is used to control the movement of the polynucleotide through the modified nanopore. Fig.38The current traces are shown when a polynucleotide is translocated through an unmodified nanopore, i.e., this is a system in which there is no oligonucleotide hybridization between the nanopore and the analyte. In this system, the interchain time is uniformly distributed around 1 second (see Fig.40 ).

[0585] Fig.39 The current trace is shown when a polynucleotide translocates through a nanopore modified with SEQ ID NO: 8, i.e., this is a system that allows hybridization between the nanopore and the analyte. In this system, there are two populations of interchain time: (a) uniformly distributed around 1 second, and (b) rapidly capturing the analyte (<0.1 second) (see Fig.40 ). This indicates that the analyte is hybridizing to the well, while the well is sequencing the other strand.

[0586] This difference between the two systems (no hybridization between well and analyte versus hybridization between well and analyte) is summarized in Fig.40 , which shows a histogram of the interchain interval time between the two systems. This demonstrates that in the absence of hybridization, only one capture type is observed, and when the analyte can hybridize to the well, there is an additional capture type where the analyte is captured quickly (<0.1 seconds) after the previous analyte. This reduced interchain interval time increases the total number of chains sequenced Fig.41 .

[0587] Both ends of the analyte can be tethered to the pore.

[0588] Example 7

[0589] The following is an exemplary protocol for modifying a nanopore (e.g., a CsgG nanopore) using a pyridyldithiomorpholinyl group to have a pore tag attached to the outer surface of the nanopore.

[0590] Preparation of tag-modified nanopores

[0591] A modified nanopore (e.g., a CsgG nanopore) is prepared to allow conjugation of a pore tag. For example, a CsgG monomer is modified (e.g., by amino acid substitution), such as to provide cysteine, non-natural bases, etc., for pore tag conjugation. The modified CsgG monomer is prepared using a PT7 vector containing a plasmid encoding the amino acid sequence SEQ ID NO:7, with one or more amino acid substitutions as described herein. The plasmid is transformed into a BL21-derived cell line and mutated to replace the endogenous CsgG gene with kanamycin resistance. The cells are plated on agar plates containing ampicillin (100 μg / ml) and kanamycin (30 μg / ml) and incubated at 37°C for 16 hours. A single colony is used to inoculate 100 ml of LB medium containing carbenicillin (100 μg / ml) and kanamycin (30 μg / ml), and the starter culture is then grown at 37°C / 250 rpm for 16 hours. 4x25ml starter cultures were used to inoculate 4x500ml LB containing carbenicillin (100μg / ml), kanamycin (30μg / ml) 3mM ATP, 15mM MgSo4 and 0.5mM rhamnose. The cultures were grown until stationary phase was reached and then grown for another 2 hours at 37°C / 250rpm. Glucose was added to 0.2%, the temperature was lowered to 18°C, and once the culture was at 18°C, protein expression was induced by adding 1% α-lactose monohydrate. The cultures were incubated at 18°C / 250rpm for 16 hours.

[0592] Cells were harvested by centrifugation and detergent lysed (Bugbuster). Once lysed, samples were subjected to initial streptavidin purification (5 ml HP streptavidin trap), eluted fractions were heated to 60°C, centrifuged and the supernatant was subjected to qIEX purification (1 ml Hi trap Q HP). Fractions containing the correct protein were pooled, concentrated and subjected to final polishing on 24 ml Superdex.

[0593] As described below, an aliquot of the above nanopores is modified with a pore tag such as a morpholino oligonucleotide (e.g., as shown in SEQ ID NO: 8). 1.3 μL of 1M DTT (dithiothreitol) is added to 130 μL of the nanopores from above, which contains approximately 9.75 μg of nanopores, and incubated at room temperature for 1 hour. Following the manufacturer's instructions, a 0.5 mL 7MWCO Zeba desalting column (Thermo Fisher Scientific) is used to exchange the sample buffer into a reaction buffer (25 mM Tris, 150 mM NaCl, 2 mM EDTA, 0.1% SDS, and 0.1% Brij58, pH 7). Following the manufacturer's instructions, a 7MWCO Zeba desalting column (Thermo Fisher Scientific) is used to exchange the sample buffer into the reaction buffer again. In nuclease-free water (Ambion TM A 2 mM stock solution of a pore tag such as a morpholino oligonucleotide (e.g., as shown in SEQ ID NO: 8) is prepared in PBS. This is added to the buffer-exchanged sample to a final concentration of 500 μM and incubated overnight at room temperature to generate a modified nanopore.

[0594] Analysis and quality control

[0595] SDS-PAGE-Protocol

[0596] 2uL of modified and unmodified nanopores were added to 8uL of reaction buffer. The samples were heated in a PCR block for 4 minutes at 95°C to break the samples from oligomers to monomers. 10uL of 2x Laemmli sample buffer (65.8mM Tris-HCL at pH 6.8, 26.3% (w / v) glycerol, 2.1% SDS, 0.01% bromophenol blue) was added to each sample. The samples were electrophoresed on a 4-20% TGX gel at 300mV for 23 minutes and stained with SYPRO Ruby protein gel. The results of the gel are shown in Fig.27A middle.

[0597] Hybridization with pyridyl-dithiomorpholinyl modified pores - protocol

[0598] 10uL of modified nanopores had the corresponding fluorescent hybridization sequence, which was added in 2-fold excess over the modified nanopores. The samples were made into a total volume of 20uL. Each sample was placed at room temperature for 1 hour. 5uL of 5x dye-free load (50mM Tris-HCl, 25% glycerol, 5mM EDTA at pH 8.0) was added. The samples were electrophoresed at 160mV for 80 minutes on a 4-20% TBE gel. The gel was run on a Cy3 fluorescent gel scanner, stained with SYBR Gold nucleic acid gel stain, and stained with SYPRO Ruby protein gel stain. The results of the gel are shown in Figure 28-30 middle.

[0599] Example 7

[0600] This embodiment describes a method for characterizing a polynucleotide connection, wherein the connection method for connecting the polynucleotides together is click chemistry. In this embodiment, when the template and the complementary sequence are not covalently linked, the template (the first strand captured) and the complementary sequence (the reverse complementary sequence of the first strand) of the first double-stranded polynucleotide are characterized using a nanopore. When the template and the complementary sequence are separated, the sequence complementary to the hole tether in the follow-up adapter connected to the first double-stranded polynucleotide is exposed in the complementary sequence, and the complementary sequence binds to the hole tether attached to the nanopore. The serial adapter is also connected to the first double-stranded polynucleotide so that the complementary chain can be serially connected to the second double-stranded polynucleotide.

[0601] Materials and methods

[0602] Follow the ligation of adapters to genomic DNA

[0603] The following adapter includes a barcode upper strand (SEQ ID NO: 17) and a barcode lower strand (SEQ ID NO: 18), which are annealed together at 10 μM and 11 μM, respectively, in 50 mM HEPES pH 8, 100 mM potassium acetate at 2 ° C / min from 95 ° C to 22 ° C. The hybridized DNA is called the following adapter. 6.4 μL of the following adapter is added to 93.6 μL of 50 mM Tris-HCl pH 7.5, 20 mM sodium chloride to produce a 640 nM dilution of the following adapter.

[0604] SEQ ID NO: 17: Follow the linker upper strand

[0605] / 5Phos / TAACGAGGTTGTTTCTATCTCGGCGTCTGCTTGGGTGTTTAACC / iSp18 / / iSp18 / / iSp18 / / iSp18 / TTTTTGTCAGAGAGGTTCCAAGTCAGAGAGGTTCCT

[0606] SEQ ID NO: 18: following the lower strand of the adapter

[0607] / 5Phos / GGAACCTCTCTGACTTGGAACCTCTCTGACAAAAA / iSp18 / / iSp18 / / iSp18 / / iSp18 / GGTTAAACACCCAAGCAGACGCCGAGATAGAAACAACCCATCAGATTGTGTTTGTTAGTCGCT / iSp18 / / iSp18 / / iSp18 / / iSp18 / AGCGACTAACAAACACAATCTGATG / DBCO /

[0608] The Oxford Nanopore Technologies sequencing kit was used to perform the ligation of the follow-up adapter to the genomic DNA according to the manufacturer's instructions. 1000 ng of end-repaired and dA-tailed E. coli genomic DNA was ligated with 5.5 μL of 640 nM follow-up adapter from above in 1x Blunt / TA master mix (NEB M0367L) at room temperature for 20 minutes. SPRI purification of the sample was performed as described in Example 2. This sample will be referred to as the follow-up adapter-genomic DNA.

[0609] Ligation of the tandem enzyme-adapter complex followed by the adapter-genomic DNA

[0610] The leading strand (SEQ ID NO: 19), blocking strand (SEQ ID NO: 20) and bottom strand (SEQ ID NO: 21) were annealed together at 5.5 uM, 6 uM and 6 uM respectively in 50 mM HEPES pH 8, 100 mM potassium acetate at 2°C / min from 95°C to 22°C. The hybridized DNA is referred to as the tandem enzyme-adapter complex.

[0611] SEQ ID NO: 19: Tandem sequencing adapter on the upper strand

[0612] / azide / GGTTGTTTCTATCTC / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / i SpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / GGCGTCTGCTTGGGTGTTTAACCTTTTTTTTTT

[0613] / iSp18 / AATGTACTTCGTTCAGTTACGT

[0614] SEQ ID NO: 20: Ligation of sequencing adapter blocker strand

[0615] GGTTAAACACCCAAGCAGACGCCTTTGAGGCGAGCGGTCAA

[0616] SEQ ID NO:21: Tandem sequencing adapter bottom strand

[0617] / 5Phos / TCGTTAACGTAACTGAACGAAGT / iBNA-A / / iBNA-meC / / iBNA-A / / iBNA-T / / iBNA-T /

[0618] Aliquots of T4 Dda-(E94C / F98W / C109A / C136A / A360C) (SEQ ID NO: 24 with mutations E94C / F98W / C109A / C136A / A360C followed by (ΔM1)G1G2 (where (ΔM1)G1G2 = deletion of M1 followed by addition of G1 and G2) were thawed on ice and 50 μl of buffer exchanged into 50 mM HEPES pH 8, 100 mM potassium acetate, 2 mM EDTA via a 0.5 ml Zeba column according to the manufacturer's instructions. The recovered protein was quantified using the A280 nm value and adjusted to 0.25 mg ml using the same buffer. -1 .

[0619] 27 μl of buffer exchange protein was mixed with 3 μl of tandem enzyme-adapter complex in a DNA low binding eppendorf and incubated for 10 minutes at 35° C. 0.37 μl of 8.1 mM TMAD was then added and the sample was incubated for 60 minutes at 35° C. 30 μl of 50 mM HEPES pH 8, 1 M NaCl, 2 mM MgCl2, 2 mM rATP was then added and left at room temperature for another 20 minutes.

[0620] 222 μl of AgencourtAMPure beads (Beckman Coulter) were added and the sample was incubated on a rotator at room temperature for 5 minutes. The beads were precipitated on a magnetic stand and the supernatant was removed. While still on the magnetic stand, the beads were washed with 500 μl of 50 mM Tris pH 7.5, 2.5 M NaCl, 20% PEG 8,000 and turned 360° to immerse the precipitate on the stand. The wash buffer was removed and the precipitate was briefly pulsed in a centrifuge and then returned to the magnetic stand to remove the last remaining solution. The precipitate was resuspended in 30 μl of 50 mM Tris pH 7.5, 20 mM NaCl at room temperature for 5 minutes and then placed on a magnetic stand to recover the purified adapter, which is called the pre-assembled tandem enzyme-adapter complex.

[0621] 20 μL of pre-installed concatenator-adapter complexes were connected at room temperature with 100 μL and 50 μL follow-up adapter-genomic DNA, 20 μL of NEBNext Quick ligation reaction buffer and 10 μL of QuickT4 DNA ligase (E6056L) for 10 minutes. SPRI purification was performed as follows, and then 40 μL of Agencourt AMPure beads (Beckman Coulter) were added, the sample was mixed by pipette, and incubated at room temperature for 5 minutes. The beads were precipitated on a magnetic rack and the supernatant was removed. The precipitated beads were washed with 140 μL adapter beads binding buffer, and the beads were resuspended in the adapter beads binding buffer by rotating the Eppendorf tubes on the magnetic rack 180 ° twice in a row. The beads were precipitated on a magnetic rack and the supernatant was removed. The precipitated beads were washed again with 140 μL buffer, and the beads were resuspended in the buffer by rotating the Eppendorf tubes on the magnetic rack 180 ° twice in a row. The beads were pelleted on a magnetic stand and the buffer removed, the pellet was briefly pulsed in a centrifuge and returned to the magnetic stand before removing the last remaining buffer.

[0622] The pellet was resuspended in 25 μL of nuclease-free water (Ambion TM ) and the library was eluted from the beads on ice for 10 min.

[0623] Preparation of tag-modified nanopores

[0624] The method of preparing a nanopore modified to include a polynucleotide sequence complementary to the capture polynucleotide sequence of the adaptor is performed in a similar manner as described in Example 2 above.

[0625] Electrical Measurement

[0626] The method of measuring and obtaining electrical measurements as the strands pass through the nanopore is performed in a similar manner as described in Example 2 above.

[0627] Data analysis

[0628] When the DNA chain passes through the modified nanopore, the current change through the nanopore is measured and collected. The sequence of the chain is then determined using a base recognition algorithm (e.g., a recurrent neural network (RNN) algorithm) to obtain fastq data. Subsequently, the fastq sequence data is compared with the reference genome using a sequence alignment tool known in the art.

[0629] Example 8

[0630] This embodiment describes a method for characterizing and tandem double-stranded target polynucleotides, wherein the attachment method is non-covalent. The complementary strand of the first double-stranded target polynucleotide recruits the second double-stranded target polynucleotide and brings it to the local concentration of the hole. In turn, when the first complementary strand is sequenced, the recruited second double-stranded target polynucleotide becomes dehybridized from the complementary strand, but hybridizes with the hole tether in a similar manner to that performed in Example 2. This enables the first and second (and subsequently, the third, fourth, fifth, etc.) double-stranded target polynucleotides to follow each other through the hole with the shortest chain interval time. This is particularly useful when the concentration of double-stranded target polynucleotides is low, because the second target polynucleotide can be recruited when sequencing the first target polynucleotide.

[0631] The analytes were prepared in the same manner as described in Example 7, but using SEQ ID NOs: 5, 6, 22, 15 and 23 instead of SEQ ID NOs: 17-21. All other procedures, reagents and conditions were the same as described in Example 7.

[0632] SEQ ID NO: 5: Follow the linker upper strand

[0633] / 5Phos / GGCGTCTGCTTGGGTGTTTAACC / iSp18 / / iSp18 / / iSp18 / / iSp18 / TTTTTGTCAGAGAGG TTCCAAGTCAGAGAGGTTCCT

[0634] SEQ ID NO:6: following the lower strand of the adapter

[0635] / 5Phos / GGAACCTCTCTGACTTGGAACCTCTCTGACAAAAA / iSp18 / / iSp18 / / iSp18 / / iSp18 / GGT TAAACACCCAAGCAGACGCCAGCAAT

[0636] SEQ ID NO:22: Fishing for the upper strand of the adapter

[0637] / 5SpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / TTGTCAGAGAGGTTCC / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / / iSpC3 / GGCGTCTGCTTGGGTGTTTAACCTTTTTT TTTTT / iSp18 / AATGTACTTCGTTCAGTTACGT

[0638] SEQ ID NO: 15: Fishing adapter blocking strand

[0639] GGTTAAACACCCAAGCAGACGCCTTTGAGGCGAGCGGTCAA

[0640] SEQ ID NO:23: Fishing adapter bottom strand

[0641] / 5Phos / ACGTAACTGAACGAAGT / iBNA-A / / iBNA-meC / / iBNA-A / / iBNA-T / / iBNA-T /

[0642] Example 9

[0643] This is another example describing a method of characterizing and tandem double stranded target polynucleotides, where the attachment method is non-covalent. This method is exactly the same as Example 8, but uses a different tether than SEQ ID NO: 9. The two-component fishing tether provides a second hybridization site for the follower sequence and the hole tether to increase the proportion of events seen.

[0644] When forming the sequencing mixture, SEQ ID NO: 9 was replaced with 400 nM annealed SEQ ID NO: 24 and SEQ ID NO: 25. All other procedures, reagents and conditions were the same as described in Example 8.

[0645] SEQ ID NO:24: Fishing tether upper chain

[0646] TTGTCAGAGAGGTTCCTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTTGGTTGTTTCTGTTGGTGCTGATATTGCTTTTTTGACCGCTCGCCTC

[0647] SEQ ID NO:25: Fishing tether lower chain

[0648] GCAATATCAGCACCAACAGAAACAACCTT / iSp18 / / iSp18 / / iSp18 / / iSp18 / / iSp18 / / iSp18 / TT / 3CholTEG /

[0649] Example 10

[0650] This embodiment describes a method for characterizing and tandemly connecting many double-stranded target polynucleotides, wherein the attachment method is non-covalent. The complementary strand of the first double-stranded target polynucleotide recruits many other double-stranded target polynucleotides and concentrates them near the hole. This provides a higher local concentration around the hole than in the general bulk solution, so the double-stranded target polynucleotides follow each other through the open hole with the shortest chain interval time. This is particularly useful when the concentration of double-stranded target polynucleotides is low. This embodiment is performed like Example 8. However, instead of annealing SEQ ID NO:9, a tether consisting of an oligonucleotide coupled to a single-stranded binding protein is used.

[0651] When the template strand of the first double-stranded target polynucleotide is sequenced, the complementary strand is released into the solution as ssDNA. The single-stranded binding proteins of the other double-stranded target polynucleotides are able to bind to the ssDNA. As part of the follow-up process, when the complementary strand is sequenced, the 3' of the complementary strand is pulled back into the hole. The single-stranded binding proteins on the ssDNA complementary strand are displaced from the complementary strand when they encounter the motor protein that controls the movement of the complementary sequence through the hole, and are therefore deposited around the hole, increasing the local concentration.

[0652] Other Implementations

[0653] All features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature for the same, equivalent or similar purpose. Therefore, unless otherwise expressly stated, each feature disclosed is only an example of a series of equivalent or similar features.

[0654] From the above description, those skilled in the art can easily determine the basic characteristics of the present disclosure, and without departing from its spirit and scope, various changes and modifications can be made to the present disclosure to adapt it to various usages and conditions. Therefore, other embodiments are also within the claims.

[0655] Equivalent solutions

[0656] Although several embodiments of the present invention have been described and illustrated herein, it will be readily apparent to those of ordinary skill in the art that various other devices and / or structures for performing the functions described herein and / or obtaining these results and / or one or more of these advantages will be contemplated, and each of such variations and / or modifications is considered to be within the scope of the embodiments of the invention described herein. More generally, it will be readily appreciated by those skilled in the art that all parameters, dimensions, materials, and configurations described herein are meant to be exemplary, and that actual parameters, dimensions, materials, and / or configurations will depend on one or more specific applications for which the invention is taught. It will be recognized or possible to confirm many equivalents of the specific embodiments of the invention described herein using only routine experiments. Therefore, it will be understood that the foregoing embodiments are introduced only by way of example, and within the scope of the appended claims and their equivalents, the embodiments of the invention may be practiced in a manner different from that specifically described and required. The embodiments of the invention disclosed herein relate to each individual feature, system, article, material, and / or method described herein. In addition, any combination of two or more such features, systems, articles, materials, kits and / or methods, if such features, systems, articles, materials, kits and / or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure.

[0657] All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and / or ordinary meanings of the defined terms.

[0658] All references, patents, and patent applications disclosed herein are hereby incorporated by reference with respect to the subject matter for which they are cited, in some cases in their entireties.

[0659] Unless explicitly stated to the contrary, the indefinite articles "a" and "an" as used in this specification and the claims should be understood to mean "at least one".

[0660] As used herein in the specification, the phrase "and / or" should be understood to refer to "either one or both" of the elements so combined, that is, the elements exist together in some cases and separately in other cases. Multiple elements listed with "and / or" should be interpreted in the same manner, that is, "one or more" of the elements so combined. In addition to the elements specifically identified with the "and / or" phrase, other elements may optionally be present, whether related or unrelated to those specifically identified. Therefore, as a non-limiting example, when used in conjunction with open language such as "comprising", reference to "A and / or B" may refer to only A (optionally including elements other than B) in one embodiment; to only B (optionally including elements other than A) in another embodiment; to both A and B (optionally including other elements) in yet another embodiment; and so on.

[0661] As used herein in this specification and claims, "or" should be understood to have the same meaning as "and / or" as defined above. For example, when separating the items in a list, "or" or "and / or" should be interpreted as inclusive, i.e., including at least one element in a plurality of elements or a list of elements, and also including more than one element, and optionally other unlisted items. Only clearly indicating the opposite terms, such as "only one of ..." or "exact one of ..." or "consisting of ..." when used in the claims will refer to including exactly one element in a plurality of elements or a list of elements. In general, when there is an exclusive term before, such as "any one", "one of ...", "only one of ..." or "exact one of ...", the term "or" used in this article should only be interpreted as indicating an exclusive alternative (i.e., "one or the other, not two"). When used in the claims, "consisting essentially of ..." should have the common meaning as used in the field of patent law.

[0662] As used in this specification and claims, the phrase "at least one" with respect to a list of one or more elements should be understood to refer to at least one element selected from...

Claims

1. A method for sequentially translocating two non-covalently bound complementary nucleic acid strands through a nanopore, the method comprising: contacting a pair of non-covalently bound complementary nucleic acid strands with the nanopore under conditions that promote translocation of a first member of the pair of non-covalently bound complementary nucleic acid strands through the nanopore, wherein adaptors are attached to one or both of the two ends of the complementary nucleic acid strands, each adaptor comprising a duplex stem and a first single strand extending from the duplex stem to which a polynucleotide helicase is bound, wherein when the adaptors are attached to both ends of the complementary nucleic acid strands, the first single strand of one adaptor is adjacent to the first member and the first single strand of the other adaptor is adjacent to the second member of the pair, wherein during translocation of the first member through the nanopore, the first member pulls open the duplex stem to expose a binding site on the second member, And wherein the binding site reversibly binds to an oligonucleotide tag conjugated to the outer edge of the outer lumen of the nanopore, and wherein the binding site on the second member is a portion of a nucleic acid having a sequence complementary to the tag. 2 . The method of claim 1 , wherein the pair of complementary nucleic acid strands comprises a target nucleic acid attached to an adaptor, and wherein the binding site is present on the adaptor.

3. A composite for use in the method of claim 1, comprising: (i) A nanopore having a tag, wherein the tag is an oligonucleotide tag conjugated to the outer edge of the nanopore lumen; (ii) a complementary polynucleotide chain that binds to the nanopore via the tag, wherein the binding site on the complementary polynucleotide chain is a portion of a nucleic acid having a sequence complementary to the tag; and (iii) a template polynucleotide chain partially hybridized with a complementary polynucleotide chain, wherein the template polynucleotide chain is translocated through the inner cavity of the nanopore, wherein an adaptor is attached to one or both of the two ends of a double-stranded polynucleotide comprising the complementary polynucleotide chain and the template polynucleotide chain, each adaptor comprising a duplex stem and a first single strand extending from the duplex stem to which a polynucleotide helicase is bound, wherein When the adaptors are attached to both ends of the complementary nucleic acid chains, the first single strand of one adaptor is adjacent to the template polynucleotide chain and the first single strand of the other adaptor is adjacent to the complementary polynucleotide chain.

Images