Cloning and application of genes regulating soybean seed size
By cloning and expressing the soybean grain weight-related GmSGF11 gene, the unclear genetic basis of soybean seed size regulation was solved, grain size and yield were increased, and molecular breeding was supported.
Patent Information
- Application Number
- CN202410920264.2
- Authority / Receiving Office
- CN · China
- Patent Type
- Patents(China)
- Current Assignee / Owner
- Filing Date
- 2024-07-10
- Publication Date
- 2025-10-17
- Estimated Expiration
- 2044-07-10
AI Technical Summary
The existing technology for gene cloning that regulates soybean seed size is relatively limited, and the genetic basis and regulatory mechanism are unclear, which affects the increase in soybean yield.
The soybean grain weight-related GmSGF11 gene was cloned and expressed, a recombinant vector was constructed using a plant expression vector and introduced into soybean cells to cultivate transgenic soybeans and achieve grain enlargement.
Significantly increase soybean seed size, improve 100-grain weight and single-plant yield, and provide theoretical basis and genetic resources to support molecular breeding.
Smart Images

Figure SMS_1 
Figure SMS_2 
Figure SMS_3
Abstract
Description
TECHNICAL FIELD
[0001] The present application belongs to the field of biotechnology, and particularly relates to cloning and application of a gene for regulating soybean seed size. BACKGROUND
[0002] Soybean (Glycine max [L]. Merr.) is one of the important oil crops and economic crops in the world, and is also the main source of high-quality protein and feed protein for human beings. Soybean is originally from China. The main reason is that the soybean yield per unit in China is low, so it is urgent to increase the soybean yield per unit in China.
[0003] Soybean yield is largely dependent on seed weight, i.e. seed size (including seed length, seed width and seed thickness). However, so far, the cloning of genes for regulating soybean seed size is still limited, and the genetic basis and specific regulatory mechanism in variation of soybean germplasm resources are unclear. Therefore, it is of great significance to deeply explore the molecular genetic mechanism for regulating soybean seed size for increasing soybean yield. SUMMARY
[0004] In order to further improve the yield and quality of soybean, the purpose of the present application is to provide a soybean seed weight related protein and its coding gene and application, and to provide a theoretical basis and gene resources for subsequent molecular assisted breeding and molecular design breeding.
[0005] In the specific embodiments of the present application, the cDNA sequence of the soybean seed weight related GmSGF11 gene is shown as SEQ ID NO: 1, and in the specific embodiments of the present application, the amino acid sequence of the GmSGF11 gene is shown as SEQ ID NO: 2. In the specific embodiments of the present application, the genomic DNA (gDNA) sequence of the GmSGF11 gene is shown as SEQ ID NO: 3.
[0006] In the present application, the existing plant expression vector can be used to construct a recombinant vector containing the target gene. The plant expression vector includes Agrobacterium binary vector and a vector that can be used for plant microprojectile bombardment, etc. In order to facilitate the identification and screening of transgenic plant cells or plants, the plant expression vector used can be processed, such as adding a gene that can express an enzyme or a luminescent compound in plants to produce color change, a resistant antibiotic marker or an anti-chemical reagent marker gene, etc. In view of the safety of transgenic plants, no selective marker gene can be added, and the transformed plants can be directly screened under stress. The plant expression vector can also contain an enhancer to increase the expression of the inserted nucleotide fragment.
[0007] To achieve the above object, the present application also provides a method for obtaining transgenic soybean, which is introducing the aforementioned nucleic acid or the vector or host cell containing the aforementioned gene into the soybean of interest, to obtain transgenic soybean showing increased grain size compared with the soybean of interest.
[0008] The method for introducing into the soybean of interest can be transforming plant cells or tissues by using Ti plasmid, Ri plasmid, plant virus vector, direct DNA transformation, microinjection, electroporation, Agrobacterium-mediated transformation, etc.
[0009] To achieve the above object, the present application also provides the use of the aforementioned protein or the aforementioned nucleic acid or the vector or host cell containing the aforementioned gene in soybean genetic engineering.
[0010] The soybean genetic engineering is preferably soybean genetic engineering aiming at increasing soybean yield.
[0011] The soybean grain weight-related protein and the encoding nucleic acid thereof provided by the present application are the first discovery of the applicant in terms of the function in regulating soybean grain weight, such as hundred-grain weight, and the phenotype analysis of transgenic plants and wild-type plants verifies that expressing the soybean grain weight-related protein of the present application can increase the grain weight of the transgenic soybean plants. The present application will have great theoretical and application value for the breeding of high-yield soybean and the related application research.
[0012] Specifically, the present application provides the following technical solutions:
[0013] In one aspect, the present application provides an isolated gene for regulating soybean grain weight, wherein the coding region sequence of the gene is shown as SEQ ID NO: 1 or a homologous sequence thereof.
[0014] In some embodiments, the genomic sequence (gDNA) of the gene is shown as SEQ ID NO: 3 or a homologous sequence thereof.
[0015] In another aspect, the present application provides a protein for regulating soybean grain weight, wherein the amino acid sequence of the protein is shown as SEQ ID NO: 2 or a homologous sequence thereof.
[0016] In another aspect, the present application provides an expression vector, which comprises the aforementioned gene or the nucleotide sequence encoding the aforementioned protein.
[0017] In some embodiments, the expression vector has an antibiotic marker or an anti-chemical reagent marker.
[0018] In some embodiments, the antibiotic marker is selected from ampicillin, chloramphenicol, kanamycin, neomycin, rifampicin, spectinomycin, hygromycin, streptomycin and tetracycline, and the chemical resistance marker is, for example, a herbicide resistance marker.
[0019] In another aspect, the present invention provides a host cell comprising the expression vector described above.
[0020] On the other hand, the present invention provides a method for cultivating soybeans with increased yield, which comprises transforming the gene as described above or the nucleotide sequence encoding the protein as described above or the expression vector or host cell as described above into soybean plant cells or tissues and cultivating them to obtain soybean plants with increased yield.
[0021] In some embodiments, the vector is a plant expression vector, including a binary Agrobacterium vector and / or a vector that can be used for plant microprojectile bombardment.
[0022] In some embodiments, the host cell is selected from an Escherichia coli cell, an Agrobacterium cell, or a plant cell.
[0023] In some embodiments, the Agrobacterium is selected from EHA105, EHA101 and GV3101
[0024] In another aspect, the present invention provides use of the gene or the nucleotide sequence encoding the protein or the expression vector or host cell described above in cultivating soybeans with improved yield.
[0025] In some embodiments, the yield improvement is manifested as increased grain width, increased grain length, increased grain thickness, larger grains, increased 100-grain weight, and / or increased yield per plant.
[0026] On the other hand, the present invention provides a method for cultivating transgenic plants with increased yield, which comprises introducing the gene as described above or the nucleotide sequence encoding the protein as described above or the expression vector or host cell as described above into target plant cells or tissues to obtain a transgenic plant, wherein the yield of the transgenic plant is increased compared to the target plant, and the plant is a leguminous plant, preferably soybean. BRIEF DESCRIPTION OF THE DRAWINGS
[0027] Figure 1 The results of expression analysis of wild-type and transgenic plants overexpressing GmSGF11 (W82 version, gene ID: Glyma.11G168600) are shown. The vertical axis shows the expression level of GmSGF11, and the horizontal axis shows the plant number. Significance analysis was performed using the Student's t-test (*p < 0.05, ***p < 0.001).
[0028] Figure 2Phenotype statistics of wild type and transgenic plants overexpressing GmSGF11 are shown. Among them, A: comparison of grain width phenotype of wild type and transgenic plants overexpressing GmSGF11, the scale is 1 cm. B: comparison of grain length phenotype of wild type and transgenic plants overexpressing GmSGF11, the scale is 1 cm. C: comparison of grain thickness phenotype of wild type and transgenic plants overexpressing GmSGF11, the scale is 1 cm. D: statistics of grain width of wild type and transgenic plants overexpressing GmSGF11. E: statistics of grain length of wild type and transgenic plants overexpressing GmSGF11. F: statistics of grain thickness of wild type and transgenic plants overexpressing GmSGF11. G: statistics of hundred-grain weight of wild type and transgenic plants overexpressing GmSGF11. H: statistics of yield per plant of wild type and transgenic plants overexpressing GmSGF11. Significance analysis uses Student's t test (***p < 0.001). DETAILED DESCRIPTION
[0029] In order to make the objects, technical solutions and advantages of the present application clearer, the present application will be further described in detail below with reference to specific embodiments and drawings.
[0030] The following examples are intended to better illustrate the present application but not to limit the present application. In the following examples, the experimental methods are conventional methods or selected according to the product instructions unless otherwise specified. In the following examples, the experimental materials are conventional biochemical reagents available on the market unless otherwise specified. In the following examples, the quantitative tests are set up with three repeated experiments, and the results are averaged.
[0031] In the following examples, the transformation receptor is DN50, i.e. wild type, which is a Heilongjiang Province approved variety (Hei Shen Bean 2007022) and can be purchased on the market. Agrobacterium strain EHA101 is purchased from Biovector Science Lab, Inc.
[0032] Consumables such as enzyme digestion recovery kit are purchased from New England Biolabs and Tian Gen Biochemical Technology (Beijing) Co., Ltd.
[0033] PFGC5941 vector was purchased from Beijing Huabodey Biotechnology Co., Ltd., item number vt-3034, vector details and use method please refer to product manual, reference literature is: Kerschen A, Napoli C A, Jorgensen R A, et al. Effectiveness of RNA interference in transgenic plants [J]. FEBS letters, 2004, 566(1-3): 223-228.
[0034] Example 1 Discovery of GmSGF11 protein and its encoding gene
[0035] On the basis of a large number of sequence analysis and function verification, a protein was found from soybean variety Williams 82, which was named GmSGF11 protein, its amino acid sequence is shown as SEQ ID NO: 2 in the sequence listing, the gene encoding GmSGF11 protein was named GmSGF11 gene, its genomic sequence is shown as SEQ ID NO: 3 in the sequence listing, and its cDNA sequence is shown as SEQ ID NO: 1 in the sequence listing.
[0036] Example 2 Function verification of GmSGF11 protein
[0037] I. Construction of recombinant plasmid
[0038] 1. The seeds of soybean variety Williams 82 R4 stage (full pod stage) were separated from the plants, and the RNA was extracted to obtain the seed RNA of soybean variety Williams 82.
[0039] 2. The total RNA obtained in step 1 was reverse transcribed into cDNA using a reverse transcription kit (full type gold). The cDNA was used as a template for PCR amplification with a primer pair composed of F1 and R1 to obtain a PCR amplification product.
[0040] F1: 5'-ATGTCTGTTCCTAATGAGGAA-3' (SEQ ID NO: 4);
[0041] R1: 5'-TCATGACTCCAGTGTCCCATTTG-3' (SEQ ID NO: 5).
[0042] 3. The PFGC5941 vector was double digested with restriction endonuclease AscI and XmaI, and the vector backbone of about 9992 bp was recovered.
[0043] 4. The PCR product of step 2 was amplified with a primer pair composed of F2 and R2 to obtain PCR amplification product 2.
[0044] F2: 5'-cattacaattacatttacaattac ATGTCTGTTCCTAATGAGGAA -3' (SEQ ID NO: 6);
[0045] R2: 5'-caggactctagggactagtcccggg TCATGACTCCAGTGTCCCATTTG -3' (SEQ ID NO: 7).
[0046] 5, The PCR product of step 4 and the vector skeleton of step 3 are connected to obtain a recombinant plasmid. According to the sequencing result, the structure of the recombinant plasmid A is described as follows: a double-stranded DNA molecule as shown in SEQ ID NO: 1 is inserted between the AscI I and Xma I enzyme cutting sites of the PFGC5941 vector.
[0047] II. Obtaining of GmSGF11 overexpression transgenic plants
[0048] 1, The recombinant plasmid is introduced into Agrobacterium strain EHA101 (purchased from China Plasmid Vector Strain Cell Gene Preservation Center) to obtain a recombinant Agrobacterium.
[0049] 2, The recombinant Agrobacterium obtained in step 1 is used to transform the receptor plant DN50 by the cotyledon node transformation method (for specific operation method, see Margie M. P. et al 2004 Assessment of conditions affecting Agrobacterium-mediated soybean transformation using the cotyledonary node explant. Euphytica 136: 167-179), and the T0 generation seeds are harvested. The specific operation steps are as follows:
[0050] (1) Sterilization of soybean seeds: select full soybean seeds without scratches on the seed coat, divide and place them in a culture dish, place the culture dish in a desiccator, and sterilize the seeds by chlorine fumigation. A small beaker is placed in the desiccator, 100 mL of sodium hypochlorite is added, then 5 mL of concentrated hydrochloric acid is added, the lid is quickly closed, and sterilization is performed for 10-14 h. After sterilization is completed, the soybeans are taken out of the desiccator and blown for more than 30 min in a clean bench to eliminate excess chlorine;
[0051] (2) Soybean seed imbibition: insert the sterilized seed nodule into the germination medium (Table 1) with the nodule facing down, place it in a 23°C dark environment for 16-18 h;
[0052] (3) Agrobacterium preparation: Agrobacterium stored at -80°C was taken out and added to 5 mL of YEB medium (Table 2) containing the corresponding resistance, and cultured at 28°C, 250 rpm for 24 h to recover, then 200 μL of the recovered bacterial solution was taken and added to 200 mL of YEB medium containing the corresponding resistance, and cultured at 28°C, 250 rpm until the OD 600 = 0.6. The bacterial solution was collected. Centrifugation was performed at 22°C, 5,000 rpm for 10 min, and then the bacterial solution was resuspended in liquid infiltration medium (Table 3) to an OD 600 = 0.5, and cultured at 22°C, 70 rpm for 0.5 h for standby use;
[0053] (4) Preparation of explants: The swollen seed coat was taken out, and the hypocotyl was cut away from the cotyledon with a scalpel, leaving about 2-3 mm of the hypocotyl, and then the soybean seed was cut into two, and the embryo was removed with a small iron brush to obtain the prepared explants;
[0054] (5) Infection of explants: The prepared explants were placed in the Agrobacterium suspension, and the resuspension was made to cover the explants, and gently shaken for 0.5 h;
[0055] (6) Co-culture of explants and Agrobacterium: The infected explants were blotted on sterile filter paper to remove excess bacterial solution, and a sterile filter paper was placed on the co-culture medium (Table 4), and the blotted explants were placed on the co-culture medium, and cultured at 23°C in the dark for 3-5 d;
[0056] (7) Callus induction culture: After the co-culture of the explants and Agrobacterium was completed, the explants were transferred to the callus induction medium (Table 5), at this time the explants were inserted into the medium at an angle of 45 degrees, and the bottom was gently inserted into the medium, and cultured at 23°C, 16 h light / 8 h dark for 14 d;
[0057] (8) Bud induction culture: The induced callus was cut from the explants and placed in the bud induction medium (Table 6), and cultured at 23°C, 16 h light / 8 h dark for 14 d, and transferred to new bud induction medium every 14 d;
[0058] (9) Bud elongation culture: The explants with induced new buds were transferred to the bud elongation medium (Table 7), and transferred to new bud elongation medium every 2 weeks until the buds elongated to more than 3 cm;
[0059] (10) Rooting culture: The elongated buds were cut and inserted into the rooting medium (Table 8) until the roots grew more than 3 cm, and then the seedlings were hardened and transplanted to the greenhouse, and cultured at 24°C, 16 h light / 8 h dark until maturity, during which Basta and PCR identification were performed on the positive lines.
[0060] Table 1 Germination medium
[0061] GM (germination medium) 1L B5 (macro, micro, iron salts) 3.1g Sucrose 20g pH 5.8 Phytagel 2.5g Sterilization 121 °C, 20 min B5 vitamins (1000x) 1 mL
[0062] Table 2 YEB medium
[0063]
[0064]
[0065] Table 3 Infection medium
[0066] LCCM (infection liquid) 1L B5 (macro, micro, iron salts) 0.31g Sucrose 30g MES (methyl ester sulfonate of fatty acids) 3.9g pH 5.4 Sterilization 121 °C, 20 min B5 vitamins (1000x) 1 mL GA3 (1 mg / mL) 0.25 mL 6-BA (1 mg / mL) 1.67 mL DTT (100 mg / mL) 1.8 mL As (100 mg / mL) 0.8 mL Silwet 20 μL / 100 mL
[0067] Table 4 Co-culture medium
[0068]
[0069]
[0070] Table 5 Callus induction medium
[0071]
[0072] Table 6 Shoot induction medium
[0073]
[0074]
[0075] Table 7 Shoot elongation medium
[0076]
[0077] Table 8 Rooting medium
[0078]
[0079] Example 3 Statistics of transgenic phenotypes of GmSGF11
[0080] 1. Identification of expression amount of genes
[0081] The following identifications were made for the recipient line DN50 and the GmSGF11 overexpression transgenic line, respectively:
[0082] (1) DN50 and GmSGF11 overexpression transgenic R4 stage seeds were separated from the plants, total RNA was extracted and reverse transcribed into cDNA.
[0083] (2) The cDNA extracted in step (1) was used as a template to identify the expression amount of the GmSGF11 gene using primers composed of F4 and R4, and to identify the expression amount of the internal reference gene (Actin gene) using F3 and R3.
[0084] F3: 5'-CGGTGGTTTCTATCTTGGCATC-3' (SEQ ID NO: 8);
[0085] R3: 5'-GTCTTTCGCTTCAATAACCCTA-3' (SEQ ID NO: 9).
[0086] F4: 5'-TGTGGTCGATCCATCATGGCTG-3' (SEQ ID NO: 10);
[0087] R4: 5'-CCAACCGATTCATGCTATTGGTA-3' (SEQ ID NO: 11).
[0088] Using the cDNA as a template, quantitative PCR amplification was performed using each specific primer pair to obtain the expression levels of the GmSGF11 gene in different materials. The results are as follows: Figure 1 As shown. Figure 1 It can be seen that in the three overexpression lines GmSGF11-OE-1, GmSGF11-OE-2 and GmSGF11-OE-3, the gene expression level of GmSGF11 was significantly higher than that of the control DN50.
[0089] 2. Comparison of grain size, grain weight and single plant yield of the recipient line DN50 and the GmSGF11 overexpressing transgenic line
[0090] We counted the grain size, 100-grain weight, and single-plant yield of the seeds of the recipient line DN50 and the GmSGF11 overexpressing transgenic line. The results are as follows: Figure 2 As shown. Figure 2 It can be seen that the grains of the GmSGF11 overexpressing transgenic strain are significantly larger than DN50 (specifically, the grain width increased by 9.7%, the grain length increased by 9.1%, and the grain thickness increased by 9.7%), which indicates that the GmSGF11 gene is a key gene for regulating soybean yield. Overexpressing the GmSGF11 gene in soybean plants can promote the enlargement of soybean grains and increase the 100-grain weight (increased by 19%), thereby increasing the single-plant yield of soybeans (increased by 30%).
[0091] Sequence Listing
[0092] SEQ ID NO: 1GmSGF11 546 bp cDNA Glycine max (soybean)
[0093] ATGTCTGTTCCTAATGAGGAAAACTTGTCGTCACATTCCCAGCTTTCTTCTCATTTTTTCTTGGATCTCCTTGATTCCATCATAGTTGATGTGGCATCAGAGTGTCACAGAGTAGCAAGGCTGGGGCTTGATTCTAATTTGGAAGAAGAAGATGAAGAATTGAAGCTATCGGCACAAGCCAGGGTTAGGGTGGCTGATCCTAGTAACAGTAATGAAGCAAATGGCAAGTATGTGGTTGACATATTTGGACAAACCCATCCTCCTGTGGCAAATGAAATATTTGATTGCATGAATTGTGGTCGATCCATCATGGCTGGGAGGTTTGCTCCACATTTGGAGAAGTGCATGGGAAAGGGTAGGAAGGCACGTCTGAAAGTGACAAGAAGCAGCACAGCCGCGCAGAACCGGTATTCACGAGGCAGTCCTAGTCCTGGTTCTACATATTCTCCATATTCAAATTACTCTACCAATAGCATGAATCGGTTGGCAAATGGAACCTCCACTTTTGCAGGTGAGGAGCACTCAAATGGGACACTGGAGTCATGA
[0094] SEQ ID NO:2 GmSGF11 182 aa protein Glycine max (soybean)
[0095] MSVPNEENLSSHSQLSSHFFLDLLDSIIVDVASECHRVARLGLDSNLEEEDEELKLSAQARVR VADPSNSNEANGKYVVDIFGQTHPPVANEIFDCMNCGRSIMAGRFAPHLEKCMGKGRKARLKVT RSSTAAQNRYSRGSPSPGSTYSPYSNYSTNSMNRLANGTSTFAGEEHSNGTLES
[0096] SEQ ID NO:3 GmSGF11 3795 bp gDNA Glycine max (soybean)
[0097]
[0098] The above-described specific embodiments further illustrate the objects, technical solutions, and beneficial effects of the present application. It should be understood that the above-described specific embodiments are merely examples of the present application and are not intended to limit the present application. Any modifications, equivalent replacements, improvements, and the like made within the spirit and principle of the present application shall be included in the protection scope of the present application.
Claims
1. A method for increasing soybean grain weight, characterized in that: The method comprises the steps of transforming an isolated gene for increasing soybean grain weight into soybeans and cultivating the soybeans, wherein the gene encodes the protein shown in SEQ ID NO:
2.
2. The method according to claim 1, characterized in that The genomic sequence of the gene is shown in SEQ ID NO:
3.
3. The method according to claim 1, characterized in that The coding region sequence of the gene is shown in SEQ ID NO:
1.
4. A method for increasing soybean grain weight, characterized in that: The method comprises the steps of transforming an expression vector comprising the gene according to any one of claims 1 to 3 into soybeans and cultivating the soybeans.
5. The method according to claim 4, characterized in that The expression vector has an antibiotic marker or a chemical resistance marker.
6. The method according to claim 5, characterized in that The antibiotic label is selected from the group consisting of an ampicillin label, a chloramphenicol label, a kanamycin label, a neomycin label, a rifampicin label, a spectinomycin label, a hygromycin label, a streptomycin label and a tetracycline label.
7. The method according to claim 5, characterized in that The chemical resistance marker is a herbicide resistance marker.
8. The method according to any one of claims 4 to 7, characterized in that The vector is a plant expression vector, including a binary Agrobacterium vector and / or a vector that can be used for plant microprojectile bombardment.
9. A method for increasing soybean grain weight, characterized in that: The method comprises the steps of transforming a host cell comprising the expression vector according to any one of claims 4 to 8 into soybean and cultivating the host cell.
10. The method according to claim 9, characterized in that The host cell is an Agrobacterium cell.
11. The method according to claim 10, characterized in that The Agrobacterium is selected from EHA105, EHA101 and GV3101.
12. A method for cultivating soybeans with increased yield, comprising transforming the gene according to any one of claims 1 to 3, the expression vector according to any one of claims 4 to 8, or the host cell according to any one of claims 9 to 11 into soybeans and cultivating the soybeans to obtain soybean plants with increased yield.
13. The method according to claim 12, characterized in that The yield increase is manifested in increased grain width, increased grain length, increased grain thickness, increased 100-grain weight and / or increased yield per plant.
14. Use of the gene according to any one of claims 1 to 3, the expression vector according to any one of claims 4 to 8, or the host cell according to any one of claims 9 to 11 in cultivating soybean with improved yield.
15. The use according to claim 14, characterized in that The yield increase is manifested in increased grain width, increased grain length, increased grain thickness, larger grains, increased 100-grain weight and / or increased yield per plant.
Citation Information
Patent Citations
Cloning and application of gene for regulating and controlling soybean grain size
CN118638814A