A crisper enzyme and system and uses

By developing a new CRISPR/Cas system, utilizing the Cas-sf6728 protein and its gene editing tools, the shortcomings of existing systems have been overcome, enabling more robust and efficient gene editing and improving targeting and multiplexing capabilities.

CN118910008BActive Publication Date: 2026-02-10SHANDONG SHUNFENG BIOTECH CO LTD
View PDF 2 Cites 0 Cited by

Patent Information

Application Number
CN202411329321.6
Authority / Receiving Office
CN · China
Patent Type
Patents(China)
Current Assignee / Owner
Priority Date
2023-09-25
Filing Date
2024-09-24
Publication Date
2026-02-10
Estimated Expiration
2044-09-24

AI Technical Summary

Technical Problem

Existing CRISPR/Cas systems each have their own advantages and disadvantages in gene editing, and there is a need to develop a more robust system with good performance in many aspects to improve the development of biotechnology.

Method used

A novel CRISPR/Cas system, comprising the Cas-sf6728 protein and its corresponding gene editing tools, was developed. This system preserves the biological function of the Cas protein by making minor adjustments to its amino acid sequence and combines gRNA and vector systems for gene editing.

Benefits of technology

It achieves more robust gene editing results, improves targeting and reduces off-target effects, and enhances the system's multiple gene editing capabilities.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN118910008B_ABST
    Figure CN118910008B_ABST
Patent Text Reader

Abstract

The present application belongs to the field of nucleic acid editing, in particular, the field of clustered regularly interspaced short palindromic repeats (CRISPR) technology. Specifically, the present application provides a Cas enzyme, which has a wide application prospect.
Need to check novelty before this filing date? Find Prior Art

Description

[0001] This application claims priority to Chinese patent application CN202311235588.4, filed on September 25, 2023. The entire contents of the aforementioned Chinese patent application are incorporated herein by reference. Technical Field

[0002] This invention relates to the field of gene editing, particularly to the field of regularly clustered short palindromic repeats (CRISPR) technology. Specifically, this invention has screened a class of Cas enzymes and developed corresponding gene editing tools and their applications based on these Cas enzymes. Background Technology

[0003] CRISPR / Cas technology is a widely used gene editing technology that uses RNA to specifically bind to target sequences on the genome and cut DNA to create double-strand breaks, using biological non-homologous end joining or homologous recombination for site-specific gene editing.

[0004] The CRISPR / Cas9 system is the most commonly used type II CRISPR system. It recognizes the 3'-NGG PAM motif and performs blunt-end cleavage on the target sequence. CRISPR / Cas Type V systems are a newly discovered class of CRISPR systems with a 5'-TTN motif, performing sticky-end cleavage on the target sequence; examples include Cpf1, C2c1, CasX, and CasY. However, the different CRISPR / Cas systems currently available each have their own advantages and disadvantages. For example, Cas9, C2c1, and CasX all require two guide RNAs, while Cpf1 only requires one and can be used for multiplex gene editing. CasX is 980 amino acids in size, while common systems like Cas9, C2c1, CasY, and Cpf1 are typically around 1300 amino acids. Furthermore, the PAM sequences of Cas9, Cpf1, CasX, and CasY are relatively complex and diverse, while C2c1 recognizes the strict 5'-TTN, making its target site easier to predict than other systems and reducing potential off-target effects.

[0005] In conclusion, given the limitations of currently available CRISPR / Cas systems, developing a more robust CRISPR / Cas system with superior performance in multiple aspects is of great significance to the development of biotechnology. Summary of the Invention

[0006] Through extensive experimentation and repeated exploration, the inventors of this application unexpectedly discovered a nuclease (Cas enzyme). Based on this discovery, the inventors developed a new CRISPR / Cas system, as well as gene editing methods and nucleic acid detection methods based on this system.

[0007] Cas effector proteins

[0008] On the one hand, the present invention provides a Cas protein, which is an effector protein in the CRISPR / Cas system. In the present invention, it is referred to as Cas-sf6728, and the amino acid sequence of the Cas-sf6728 protein is shown in SEQ ID No. 1.

[0009] In one embodiment, the amino acid sequence of the Cas protein has at least 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, 99.1%, 99.2%, 99.3%, 99.4%, 99.5%, 99.6%, 99.7%, 99.8%, or 99.9% sequence identity with the sequence from which it originates, and substantially retains the biological function of the sequence from which it originates. Preferably, the Cas protein originates from the same species as Cas-sf6728.

[0010] In one embodiment, the Cas protein amino acid sequence has one or more amino acid substitutions, deletions, or additions compared to the SEQ ID No. 1 sequence; and substantially retains the biological function of its derived sequence; the one or more amino acid substitutions, deletions, or additions include substitutions, deletions, or additions of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids.

[0011] In one embodiment, the Cas protein is a derivative protein with the same biological function as the protein having the sequence shown in SEQ ID No. 1.

[0012] In one embodiment, the amino acid sequence of the Cas protein is shown in SEQ ID No. 1.

[0013] In one embodiment, the Cas protein, compared to SEQ ID No. 1, has a mutation (e.g., any 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid sites) at any of the following amino acid sites corresponding to the amino acid sequence shown in SEQ ID No. 1: position 36, position 39, position 65, position 69, position 73, position 75, position 119, position 122, position 132, position 154, position 155, position 156, position 157, position 171, position 186, position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, and position 344.

[0014] In one embodiment, the Cas protein has mutations at amino acid positions 65 and 75 corresponding to the amino acid sequence shown in SEQ ID No. 1, compared to SEQ ID No. 1.

[0015] In one embodiment, the amino acid sequence of the Cas protein has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity with the sequence corresponding to SEQ ID No. 1; and the amino acid sequence of the Cas protein, compared with the sequence of SEQ ID No. 1, has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity with the sequence of SEQ ID No. 1. The amino acid sequence shown in No. 1 contains a mutation at any one or more of the following amino acid sites (e.g., any 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid sites): position 36, position 39, position 65, position 69, position 73, position 75, position 119, position 122, position 132, position 154, position 155, position 156, position 157, position 171, position 186, position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, and position 344.

[0016] In one embodiment, the 36th amino acid is mutated to a non-T amino acid, such as A, V, G, L, Q, F, W, Y, D, K, E, N, M, S, C, P, H, R, I; preferably, W.

[0017] In one embodiment, the 39th amino acid is mutated to a non-D amino acid, such as A, V, G, L, Q, F, W, Y, S, K, E, N, M, T, C, P, H, R, I; preferably, L.

[0018] In one embodiment, the 65th or 191st amino acid is mutated to a non-L amino acid, such as A, V, G, Y, Q, F, W, S, D, K, E, N, M, T, C, P, H, R, I; preferably, R.

[0019] In one embodiment, the 69th, 154th, or 278th amino acid is mutated to a non-S amino acid, such as A, V, G, Y, Q, F, W, L, D, K, E, N, M, T, C, P, H, R, I; preferably, R.

[0020] In one embodiment, the 73rd, 119th, 155th, 281st, or 344th amino acid is mutated to a non-A amino acid, such as S, V, G, Y, Q, F, W, L, D, K, E, N, M, T, C, P, H, R, I; preferably, R.

[0021] In one embodiment, the 75th amino acid is mutated to a non-V amino acid, such as A, D, G, L, Q, F, W, Y, S, K, E, N, M, T, C, P, H, R, I; preferably, R.

[0022] In one embodiment, the 122nd, 195th, or 264th amino acid is mutated to a non-T amino acid, such as A, V, G, Y, Q, F, W, L, D, K, E, N, M, S, C, P, H, R, I; preferably, R.

[0023] In one embodiment, the 132nd amino acid is mutated to a non-N amino acid, such as A, D, G, L, Q, F, W, Y, S, K, E, V, M, T, C, P, H, R, I; preferably, R.

[0024] In one embodiment, the 157th or 296th amino acid is mutated to a non-D amino acid, such as A, V, G, Y, Q, F, W, S, L, K, E, N, M, T, C, P, H, R, I; preferably, R.

[0025] In one embodiment, the 156th, 171st, or 342nd amino acid is mutated to a non-Q amino acid, such as A, V, G, Y, T, F, W, L, D, K, E, N, M, S, C, P, H, R, I; preferably, R.

[0026] In one embodiment, the 186th or 208th amino acid is mutated to a non-E amino acid, such as A, V, G, Y, Q, F, W, S, L, K, D, N, M, T, C, P, H, R, I; preferably, R.

[0027] In one embodiment, the 304th amino acid is mutated to a non-H amino acid, such as A, D, G, L, Q, F, W, Y, S, K, E, V, M, T, C, P, N, R, I; preferably, R.

[0028] In one embodiment, the Cas protein, compared to the amino acid sequence of the parental Cas protein, has a mutation (e.g., any 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acid sites) at any of the following amino acid sites corresponding to the amino acid sequence shown in SEQ ID No. 1: position 36, position 39, position 65, position 69, position 73, position 75, position 119, position 122, position 132, position 154, position 155, position 156, position 157, position 171, position 186, position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, and position 344.

[0029] In one embodiment, the Cas protein has mutations at amino acid positions 65 and 75 corresponding to the amino acid sequence shown in SEQ ID No. 1, compared to the amino acid sequence of the parental Cas protein.

[0030] In one embodiment, the parental Cas protein is a natural wild-type Cas protein; in other embodiments, the parental Cas protein is an engineered Cas protein.

[0031] Cas proteins from various organisms can be used as parental Cas proteins. In some embodiments, the parental Cas protein has nuclease activity. In some embodiments, the parental Cas protein is a nuclease, i.e., cleaving both strands of a target double-stranded nucleic acid (e.g., double-stranded DNA). In some embodiments, the parental Cas protein is a cleavage enzyme, i.e., cleaving a single strand of a target double-stranded nucleic acid (e.g., double-stranded DNA).

[0032] In one embodiment, the parental Cas protein is a Cas protein from the Cas12f family, the Cas14 family, or the CasZ family.

[0033] In one embodiment, the amino acid sequence of the Cas protein of the Cas12f family, Cas14 family, or CasZ family has at least 70%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% or 100% sequence identity with SEQ ID No. 1.

[0034] In one embodiment, the amino acid sequence of the parental Cas protein has at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, at least 99%, at least 99.1%, at least 99.2%, at least 99.3%, at least 99.4%, at least 99.5%, at least 99.6%, at least 99.7%, at least 99.8%, or at least 99.9% sequence identity with SEQ ID No. 1.

[0035] In one embodiment, the amino acid sequence of the parental Cas protein is shown in SEQ ID No. 1.

[0036] In some embodiments, the Cas protein of the present invention is capable of recognizing the preseptal adjacent motif (PAM), and the target nucleic acid includes or is composed of the PAM.

[0037] Those skilled in the art will understand that the structure of a protein can be altered without adversely affecting its activity and function. For example, one or more conserved amino acid substitutions can be introduced into the amino acid sequence of a protein without adversely affecting the activity and / or three-dimensional structure of the protein molecule. Examples and implementations of conserved amino acid substitutions are familiar to those skilled in the art. Specifically, an amino acid residue can be substituted with another amino acid residue belonging to the same group as the site to be substituted, i.e., a nonpolar amino acid residue can replace another nonpolar amino acid residue, a polar uncharged amino acid residue can replace another polar uncharged amino acid residue, a basic amino acid residue can replace another basic amino acid residue, and an acidic amino acid residue can replace another acidic amino acid residue. Such substituted amino acid residues may or may not be encoded by the genetic code. Conservative substitutions, where an amino acid is replaced by another amino acid belonging to the same group, fall within the scope of this invention, provided that the substitution does not lead to inactivation of the protein's biological activity. Therefore, the proteins of this invention can contain one or more conserved substitutions in their amino acid sequences, preferably generated by substitutions according to the table below. Furthermore, this invention also covers proteins that also contain one or more other nonconservative substitutions, provided that such nonconservative substitutions do not significantly affect the desired function and biological activity of the proteins of this invention.

[0038] Conserved amino acid substitutions can occur at one or more predicted non-essential amino acid residues. “Non-essential” amino acid residues are those that can be altered (deleted, substituted, or replaced) without changing their biological activity, while “essential” amino acid residues are required for biological activity. A “conserved amino acid substitution” is a substitution in which an amino acid residue is replaced by an amino acid residue with a similar side chain. Amino acid substitutions can occur in the non-conserved regions of the aforementioned Cas protein. Generally, such substitutions are not performed on conserved amino acid residues, or on amino acid residues located within conserved motifs, where such residues are required for protein activity. However, those skilled in the art will understand that functional variants may have fewer conserved or non-conserved alterations in conserved regions.

[0039] Initial residue Representative substitutions Preferred substitutions Ala (A) Val; Leu; lie Val Arg (R) Lys; Gin; Asn Lys Asn (N) Gin; His; Lys; Arg Gin Asp (D) Glu Glu Cys (C) Ser Ser Gin (Q) Asn Asn Glu (E) Asp Asp Gly (G) Pro; Ala Ala His (H) Asn; Gin; Lys; Arg Arg lie (I) Leu; Val; Met; Ala; Phe Leu Leu (L) lie; Val; Met; Ala; Phe lie Lys (K) Arg; Gin; Asn Arg Met (M) Leu; Phe; lie Leu Phe (F) Leu; Val; lie; Ala; Tyr Leu Pro (P) Ala Ala Ser (S) Thr Thr Thr (T) Ser Ser Trp (W) Tyr; Phe Tyr Tyr (Y) Trp; Phe; Thr; Ser Phe Val (V) lie; Leu; Met; Phe; Ala Leu

[0040] As is well known in the art, one or more amino acid residues can be altered (replaced, deleted, truncated, or inserted) from the N and / or C ends of a protein while retaining its functional activity. Therefore, proteins that have one or more amino acid residues altered from their N and / or C ends while retaining their desired functional activity are also within the scope of this invention. These alterations can include those introduced by modern molecular methods such as PCR, which includes PCR amplification that alters or lengthens the protein-coding sequence by means of oligonucleotides containing amino acid-coding sequences used in the PCR amplification.

[0041] It should be recognized that proteins can be altered in various ways, including amino acid substitutions, deletions, truncations, and insertions, and methods for such operations are generally known in the art. For example, amino acid sequence variants of the aforementioned proteins can be prepared by mutating DNA. This can also be accomplished through other forms of mutagenesis and / or directed evolution, for example, using known mutagenesis, recombination, and / or shuffling methods, combined with relevant screening methods, to perform single or multiple amino acid substitutions, deletions, and / or insertions.

[0042] Those skilled in the art will understand that these minor amino acid changes in the Cas protein of this invention can occur (e.g., naturally occurring mutations) or be generated (e.g., using r-DNA technology) without loss of protein function or activity. If these mutations occur in the catalytic domain, active site, or other functional domains of the protein, the properties of the polypeptide may be altered, but the polypeptide may retain its activity. If the mutations are not located near the catalytic domain, active site, or other functional domains, a smaller impact can be expected.

[0043] Those skilled in the art can identify the essential amino acids of the Cas protein of the present invention using methods known in the art, such as localized mutagenesis, protein evolution, or bioinformatics analysis. The catalytic domains, active sites, or other functional domains of the protein can also be determined through physical structural analysis, such as by techniques like nuclear magnetic resonance, crystallography, electron diffraction, or photoaffinity labeling, combined with mutations in presumed key site amino acids.

[0044] The biological functions include, but are not limited to, activities that bind to guide RNA, endonuclease activities, and activities that bind to and cleave target sequences at specific sites under the guidance of guide RNA, including but not limited to Cis cleavage activities and Trans cleavage activities.

[0045] The present invention also provides a fusion protein comprising the Cas protein as described above and other modified portions.

[0046] In one embodiment, the modified portion is selected from other proteins or peptides, detectable markers, or any combination thereof.

[0047] In one embodiment, the modified portion is selected from epitope tags, reporter gene sequences, nuclear localization signal (NLS) sequences, targeting portions, transcriptional activation domains (e.g., VP64), transcriptional repression domains (e.g., KRAB or SID domains), nuclease domains (e.g., Fok1), and domains having activities selected from: nucleotide deaminase, methyltransferase activity, demethylase, transcriptional activation activity, transcriptional repression activity, transcriptional release factor activity, histone modification activity, nuclease activity, single-stranded RNA cleavage activity, double-stranded RNA cleavage activity, single-stranded DNA cleavage activity, double-stranded DNA cleavage activity, and nucleic acid binding activity; and any combination thereof. The NLS sequences are well known to those skilled in the art, and examples include, but are not limited to, the SV40 large T antigen, EGL-13, c-Myc, and TUS protein.

[0048] In one embodiment, the NLS sequence is located at, near, or close to the end (e.g., N-terminus, C-terminus, or both ends) of the Cas protein of the present invention.

[0049] The epitope tag is well known to those skilled in the art, including but not limited to His, V5, FLAG, HA, Myc, VSV-G, Trx, etc., and those skilled in the art can choose other suitable epitope tags (e.g., for purification, detection, or tracing).

[0050] The reporter gene sequences are well known to those skilled in the art, and examples include, but are not limited to, GST, HRP, CAT, GFP, HcRed, DsRed, CFP, YFP, BFP, etc.

[0051] In one embodiment, the fusion protein of the present invention includes a domain capable of binding to DNA molecules or intracellular molecules, such as maltose-binding protein (MBP), the DNA-binding domain (DBD) of Lex A, the DBD of GAL4, etc.

[0052] In one embodiment, the fusion protein of the present invention contains a detectable marker, such as a fluorescent dye, such as FITC or DAPI.

[0053] In one embodiment, the Cas protein of the present invention is optionally coupled, conjugated, or fused to the modified portion via a linker.

[0054] In one embodiment, the modified portion is directly connected to the N-terminus or C-terminus of the Cas protein of the present invention.

[0055] In one embodiment, the modified portion is attached to the N-terminus or C-terminus of the Cas protein of the present invention via a linker. Such linkers are well known in the art, and examples include, but are not limited to, linkers containing one or more (e.g., 1, 2, 3, 4, or 5) amino acids (e.g., Glu or Ser) or amino acid derivatives (e.g., Ahx, β-Ala, GABA, or Ava), or PEG, etc.

[0056] The Cas protein, protein derivative, or fusion protein of the present invention is not limited by the manner of its production. For example, it can be produced by genetic engineering methods (recombinant technology) or by chemical synthesis methods.

[0057] Nucleic acid of a Cas protein

[0058] On the other hand, the present invention provides an isolated polynucleotide comprising:

[0059] (a) A polynucleotide sequence encoding the Cas protein or fusion protein of the present invention;

[0060] (b) Polynucleotides with sequences as shown in SEQ ID No. 2;

[0061] (c) A sequence having one or more substitutions, deletions, or additions (e.g., substitutions, deletions, or additions of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 bases) compared to the sequence shown in SEQ ID No. 2;

[0062] (d) A polynucleotide whose nucleotide sequence has ≥80% homology to the sequence shown in SEQ ID No. 2 (preferably ≥90%, more preferably ≥95%, most preferably ≥98%) and encodes the polypeptide shown in SEQ ID No. 1; or,

[0063] (e) and any of the polynucleotides complementary to the polynucleotides described in (a)-(d).

[0064] In one embodiment, the nucleotide sequence described in any one of (a)-(e) is codon-optimized for expression in prokaryotic cells. In one embodiment, the nucleotide sequence described in any one of (a)-(e) is codon-optimized for expression in eukaryotic cells.

[0065] In one embodiment, the polynucleotide is preferably single-stranded or double-stranded.

[0066] Guide RNA (gRNA)

[0067] On the other hand, the present invention provides a gRNA comprising tracrRNA and crRNA; tracrRNA is capable of pairing with the pairing region of crRNA to form a double strand; crRNA also includes a region that hybridizes with a target sequence (i.e., a target sequence of a target nucleic acid).

[0068] As is known in the art, Cas proteins need to target target sequences under the action of gRNA (guide RNA), including tracrRNA and crRNA; the 3' end of tracrRNA can form a pairing region with the 5' end of crRNA, and the 3' end of crRNA includes a region that hybridizes with the target sequence (i.e., the target sequence).

[0069] In one embodiment, the gRNA (from 5' to 3') includes tracrRNA and crRNA, the crRNA including a pairing region sequence with tracrRNA and a target sequence.

[0070] In one embodiment, the gRNA (from 5' to 3') includes tracrRNA, a pairing region sequence of crRNA and tracrRNA, and a target sequence of crRNA.

[0071] In one embodiment, a linker portion is further included between the tracrRNA and crRNA of the gRNA. Preferably, the sequence of the linker portion is GAAA.

[0072] In one embodiment, the gRNA (from 5' to 3') consists of tracrRNA, a linker portion, a pairing region sequence of crRNA and tracrRNA, and a target sequence of crRNA.

[0073] In one embodiment, the gRNA includes a non-target sequence and a target sequence from the 5' to the 3' end, wherein the non-target sequence includes tracrRNA, crRNA, and the pairing region sequence of tracrRNA.

[0074] In one embodiment, the gRNA includes a non-target sequence and a target sequence from its 5' to 3' ends, wherein the non-target sequence includes tracrRNA, a linker portion, and a pairing region sequence of crRNA and tracrRNA from its 5' to 3' ends.

[0075] In one embodiment, the pairing region sequence of the crRNA and tracrRNA is shown in SEQ ID No. 3.

[0076] In one embodiment, the sequence of the tracrRNA is shown in SEQ ID No. 4.

[0077] In one embodiment, the non-target sequence of the gRNA is as shown in SEQ ID No. 5, or the non-target sequence of the gRNA has a base mutation compared to SEQ ID No. 5.

[0078] In one embodiment, the base mutation includes base deletion, base substitution, or base insertion.

[0079] In one embodiment, the above-mentioned base mutation is selected from any one or any combination of the following (1)-(20):

[0080] (1) Compared with SEQ ID No. 5, bases 1-12 are missing;

[0081] (2) Compared with SEQ ID No. 5, bases 1-26 are missing;

[0082] (3) Compared with SEQ ID No. 5, bases at positions 13-26 and 158-172 are missing;

[0083] (4) Compared with SEQ ID No. 5, A at position 29 is mutated to C and U at position 155 is mutated to G;

[0084] (5) Compared with SEQ ID No. 5, the U at position 31 is mutated to C and the A at position 154 is mutated to G;

[0085] (6) Compared with SEQ ID No. 5, add U between U at position 155 and G at position 156;

[0086] (7) Compared with SEQ ID No. 5, the A at position 29 is mutated to C, the U at position 31 is mutated to C, the A at position 154 is mutated to G, and the U at position 155 is mutated to G;

[0087] (8) Compared with SEQ ID No. 5, the A at position 74 is mutated to C and the U at position 88 is mutated to G;

[0088] (9) Compared with SEQ ID No. 5, the U at position 100 is mutated to C, and the A at position 119 is mutated to G;

[0089] (10) Compared with SEQ ID No. 5, the U at position 105 is mutated to C and the A at position 114 is mutated to G;

[0090] (11) Compared with SEQ ID No. 5, the U at position 100 is mutated to C, the U at position 105 is mutated to C, the A at position 114 is mutated to G, and the A at position 119 is mutated to G;

[0091] (12) Compared with SEQ ID No. 5, the U at position 124 is mutated to G and the A at position 143 is mutated to C;

[0092] (13) Compared with SEQ ID No. 5, A at position 126 is mutated to G and U at position 141 is mutated to C;

[0093] (14) Compared with SEQ ID No. 5, add U between G in position 127 and G in position 128;

[0094] (15) Compared with SEQ ID No. 5, the U at position 124 is mutated to G, the A at position 126 is mutated to G, the U at position 141 is mutated to C, and the A at position 143 is mutated to C;

[0095] (16) Compared with SEQ ID No. 5, bases 198-201 are missing;

[0096] (17) Compared with SEQ ID No. 5, bases 192-200 are missing;

[0097] (18) Compared with SEQ ID No. 5, bases 205-209 are missing;

[0098] (19) Compared with SEQ ID No. 5, bases 205-217 are missing;

[0099] (20) Compared with SEQ ID No. 5, bases 205-222 are missing.

[0100] In one embodiment, the above base mutation is selected from any two combinations of (1)-(20) above, for example, (1) and (3), (1) and (13), (3) and (13), (5) and (6), (5) and (13), (13) and (17).

[0101] In one embodiment, the above base mutation is a combination of (1) and (3), that is, the bases at positions 1-26 and 158-172 are deleted.

[0102] In one embodiment, the above base mutation is a combination of (1) and (13), that is, the 1st to 12th bases are deleted, the 126th A is mutated to G, and the 141st U is mutated to C.

[0103] In one embodiment, the above base mutation is a combination of (3) and (13), that is, the bases at positions 13-26 and 158-172 are deleted, the A at position 126 is mutated to G, and the U at position 141 is mutated to C.

[0104] In one embodiment, the above base mutation is a combination of (5) and (6), that is, the 31st position U is mutated to C, the 154th position A is mutated to G, and U is added between the 155th position U and the 156th position G.

[0105] In one embodiment, the above base mutation is a combination of (5) and (13), that is, the 31st position U is mutated to C, the 154th position A is mutated to G, the 126th position A is mutated to G, and the 141st position U is mutated to C.

[0106] In one embodiment, the above base mutation is a combination of (13) and (17), that is, the A at position 126 is mutated to G, the U at position 141 is mutated to C, and the bases at positions 192-200 are deleted.

[0107] In one embodiment, the sequence of the gRNA includes any of the sequences shown in SEQ ID No. 5-31.

[0108] In one embodiment, the non-target sequence of the gRNA is shown in any of SEQ ID No. 5-31.

[0109] In one embodiment, the gRNA (also known as guide RNA or directing RNA) of the present invention comprises partially complementary crRNA and tracrRNA molecules forming a complex, wherein the crRNA contains a sequence that is sufficiently complementary to the target sequence to hybridize with the complementary sequence of the target sequence and directs the Cas enzyme to bind to the target sequence in a sequence-specific manner. The gRNA of the present invention includes tracrRNA and crRNA.

[0110] The target sequence or target region of the nucleic acid targeted by this invention comprises a nucleotide sequence complementary to a sequence in the target nucleic acid. In other words, the target sequence or target region of the nucleic acid targeted by this invention interacts with the target nucleic acid in a sequence-specific manner through hybridization (i.e., base pairing). Therefore, the target sequence or target region of the nucleic acid can be altered or modified to hybridize with any desired sequence within the target nucleic acid. The nucleic acid is selected from DNA or RNA.

[0111] The percentage of complementarity between the target sequence or target region of the target nucleic acid and the target sequence of the target nucleic acid may be at least 60% (e.g., at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, at least 97%, at least 98%, at least 99%, or 100%).

[0112] In this invention, the gRNA guides the interacting Cas protein to a specific nucleotide sequence within the target nucleic acid through the targeting sequence of the target nucleic acid.

[0113] The gRNA of the present invention can form a complex with the Cas protein.

[0114] The gRNA of the Cas-sf6728 protein of the present invention contains a targeting sequence that hybridizes with a target nucleic acid, wherein the target nucleic acid includes a sequence located at the 3' end of the adjacent motif (PAM) in the prototype spacer region; the aforementioned PAM sequence is 5'-AAN-3', where N represents A / C / G / T.

[0115] Vector

[0116] The present invention also provides a carrier comprising the Cas protein, isolated nucleic acid molecule or polynucleotide as described above; preferably, it further comprises a regulatory element operatively linked thereto.

[0117] In one embodiment, the regulatory element is selected from one or more of the following: enhancers, transposons, promoters, terminators, leader sequences, polyadenylation sequences, and marker genes.

[0118] In one embodiment, the vector includes a cloning vector, an expression vector, a shuttle vector, and an integration vector.

[0119] In some implementations, the vectors included in the system are viral vectors (e.g., retroviral vectors, lentiviral vectors, adenovirus vectors, adeno-associated vectors, and herpes simplex vectors), and may also be plasmids, viruses, granules, bacteriophages, etc., which are well known to those skilled in the art.

[0120] CRISPR system

[0121] The present invention provides an engineered, non-naturally occurring vector system, or a CRISPR-Cas system, comprising a Cas protein or a nucleic acid sequence encoding the Cas protein and a nucleic acid encoding one or more guide RNAs, wherein the guide RNAs include a region that binds to the Cas protein and a targeting sequence for the target nucleic acid, or the guide RNAs are the aforementioned gRNAs.

[0122] In one embodiment, the nucleic acid sequence encoding the Cas protein and the nucleic acid encoding one or more guide RNAs are artificially synthesized.

[0123] In one embodiment, the nucleic acid sequence encoding the Cas protein and the nucleic acid encoding one or more guide RNAs do not coexist naturally.

[0124] The one or more guide RNAs target one or more target sequences in the cell. The one or more target sequences hybridize to the genomic loci of a DNA molecule encoding one or more gene products and guide the Cas protein to the genomic locus of the DNA molecule of the one or more gene products. Once the Cas protein reaches the target sequence location, it modifies, edits, or cuts the target sequence, thereby altering or modifying the expression of the one or more gene products.

[0125] The cells of this invention include one or more of animals, plants, or microorganisms.

[0126] In some embodiments, the Cas protein is codon-optimized for expression in cells.

[0127] In some embodiments, the Cas protein directs cleavage of one or both strands at the target sequence location.

[0128] The present invention also provides an engineered, non-naturally occurring carrier system, which may include one or more carriers, the one or more carriers comprising:

[0129] a) A first regulatory element, which is operatively linked to the gRNA.

[0130] b) A second regulatory element operatively linked to the Cas protein;

[0131] Components (a) and (b) are located on the same or different carriers in the system.

[0132] The first and second regulatory elements include promoters (e.g., constitutive or inducible promoters), enhancers (e.g., 35S promoters or 35S enhanced promoters), internal ribosome entry sites (IRES), and other expression control elements (e.g., transcription termination signals, such as polyadenylation signals and polyU sequences).

[0133] In some implementations, the vector in the system is a viral vector (e.g., a retroviral vector, lentiviral vector, adenovirus vector, adeno-associated vector, and herpes simplex vector), or it can be a plasmid, virus, granule, bacteriophage, or other type known to those skilled in the art.

[0134] In some embodiments, the system provided herein is a delivery system. In some embodiments, the delivery system is a nanoparticle, liposome, exosome, microbubble, or gene gun.

[0135] In one embodiment, the target sequence is a DNA or RNA sequence derived from prokaryotic or eukaryotic cells. In another embodiment, the target sequence is a non-naturally occurring DNA or RNA sequence.

[0136] In one embodiment, the target sequence is present within the cell. In another embodiment, the target sequence is present in the cell nucleus or cytoplasm (e.g., organelles). In one embodiment, the cell is a eukaryotic cell. In other embodiments, the cell is a prokaryotic cell.

[0137] In one embodiment, the Cas protein is linked to one or more NLS sequences. In one embodiment, the fusion protein comprises one or more NLS sequences. In one embodiment, the NLS sequence is linked to the N-terminus or C-terminus of the protein. In one embodiment, the NLS sequence is fused to the N-terminus or C-terminus of the protein.

[0138] On the other hand, the present invention relates to an engineered CRISPR system comprising the aforementioned Cas protein and one or more guide RNAs, wherein the guide RNA includes a region that binds to the Cas protein and a target sequence that targets a nucleic acid, the Cas protein being able to bind to the guide RNA and target a target nucleic acid sequence complementary to the target sequence, or the guide RNA being the aforementioned gRNA.

[0139] In one embodiment, the Cas enzyme is Cas-sf6728, the target nucleic acid is DNA (preferably double-stranded DNA), the target nucleic acid is located at the 3' end of the protospacer adjacent motif (PAM), and the PAM is 5'-AAN-3', where N represents A / C / G / T.

[0140] Protein-nucleic acid complex / composition

[0141] On the other hand, the present invention provides a complex or composition comprising:

[0142] (i) Protein components selected from: the aforementioned Cas proteins, derived proteins, or fusion proteins, and any combination thereof; and

[0143] (ii) A nucleic acid component selected from: gRNA, or nucleic acid encoding said gRNA, or precursor RNA of said gRNA, or nucleic acid of precursor RNA encoding said gRNA; said gRNA includes a region that binds to said Cas protein and a targeting sequence for the targeting nucleic acid.

[0144] The protein components and nucleic acid components combine to form a complex.

[0145] In one embodiment, the nucleic acid component is a guide RNA in a CRISPR-Cas system.

[0146] In one embodiment, the complex or composition is non-natural or modified. In one embodiment, at least one component of the complex or composition is non-natural or modified. In one embodiment, the first component is non-natural or modified; and / or, the second component is non-natural or modified.

[0147] Activated CRISPR complex

[0148] On the other hand, the present invention also provides an activated CRISPR complex comprising: (1) a protein component selected from: the Cas protein, derived protein, or fusion protein of the present invention, and any combination thereof; (2) a nucleic acid component selected from: gRNA, or nucleic acid encoding said gRNA, or precursor RNA of said gRNA, or precursor RNA nucleic acid encoding said gRNA; said gRNA includes a region that binds to said Cas protein and a target sequence of the target nucleic acid; and (3) a target sequence bound to the gRNA. Preferably, the binding is performed by binding the target nucleic acid to the target nucleic acid via the target sequence of the target nucleic acid on the gRNA.

[0149] The term “activated CRISPR complex”, “activated complex”, or “ternary complex” used in this article refers to the complex formed by the binding or modification of the Cas protein, gRNA, and target nucleic acid in the CRISPR system.

[0150] The Cas protein and gRNA of this invention can form a binary complex, which is activated upon binding to a nucleic acid substrate to form an activated CRISPR complex. The nucleic acid substrate is complementary to the target sequence (or, in other words, the guide sequence for hybridization with the target nucleic acid) in the gRNA. In some embodiments, the target sequence of the gRNA perfectly matches the target substrate. In other embodiments, the target sequence of the gRNA partially (continuously or discontinuously) matches the target substrate.

[0151] In a preferred embodiment, the activated CRISPR complex can exhibit side-branch nuclease cleavage activity, which refers to the non-specific or random cleavage activity of the activated CRISPR complex on single-stranded nucleic acids, also known in the art as trans cleavage activity.

[0152] Delivery and delivery composition

[0153] The Cas proteins, gRNAs, fusion proteins, nucleic acid molecules, vectors, systems, complexes, and compositions of the present invention can be delivered by any method known in the art. Such methods include, but are not limited to, electroporation, lipid transfection, nuclear transfection, microinjection, acoustic pore effect, gene gun, calcium phosphate-mediated transfection, cationic transfection, liposome transfection, dendritic transfection, heat shock transfection, nuclear transfection, magnetic transfection, lipid transfection, puncture transfection, optical transfection, reagent-enhanced nucleic acid uptake, and delivery via liposomes, immunoliposomes, viral particles, artificial viruses, etc.

[0154] Therefore, in another aspect, the present invention provides a delivery composition comprising a delivery vector and selected from one or more of the following: the Cas protein, fusion protein, nucleic acid molecule, vector, system, complex and composition of the present invention.

[0155] In one embodiment, the delivery carrier is a particle.

[0156] In one embodiment, the delivery vector is selected from lipid particles, sugar particles, metal particles, protein particles, liposomes, exosomes, microvesicles, gene guns, or viral vectors (e.g., replication-defective retroviruses, lentiviruses, adenoviruses, or adeno-associated viruses).

[0157] Host cell

[0158] The present invention also relates to an in vitro, ex vivo, or in vivo cell or cell line or its progeny, said cell or cell line or its progeny comprising: the Cas protein, fusion protein, nucleic acid molecule, gRNA, protein-nucleic acid complex, activated CRISPR complex, vector, or delivery composition of the present invention.

[0159] In some implementations, the cell is a prokaryotic cell.

[0160] In some embodiments, the cell is a eukaryotic cell. In some embodiments, the cell is a mammalian cell. In some embodiments, the cell is a human cell. In some embodiments, the cell is a non-human mammalian cell, such as cells of non-human primates, cattle, sheep, pigs, dogs, monkeys, rabbits, or rodents (e.g., rats or mice). In some embodiments, the cell is a non-mammalian eukaryotic cell, such as cells of poultry (e.g., chickens), fish, or crustaceans (e.g., clams, shrimp). In some embodiments, the cell is a plant cell, such as cells of monocotyledonous or dicotyledonous plants, or cells of cultivated plants or food crops such as cassava, corn, sorghum, soybeans, wheat, oats, or rice, such as algae, trees, or productive plants, fruits, or vegetables (e.g., trees such as citrus trees, nut trees; nightshade plants, cotton, tobacco, tomatoes, grapes, coffee, cocoa, etc.).

[0161] In some implementations, the cell is a stem cell or stem cell line.

[0162] In some cases, the host cells of the present invention contain genetic or genomic modifications that are not present in their wild type.

[0163] Gene editing methods and applications

[0164] The Cas protein, nucleic acid, gRNA, composition, CRISPR / Cas system, vector system, delivery composition, activated CRISPR complex, or host cell of the present invention can be used for any or more of the following purposes: targeting and / or editing target nucleic acids; cleaving double-stranded DNA, single-stranded DNA, or single-stranded RNA; non-specifically cleaving and / or degrading side-branched nucleic acids; non-specifically cleaving single-stranded nucleic acids; nucleic acid detection; detecting nucleic acids in target samples; specifically editing double-stranded nucleic acids; base editing double-stranded nucleic acids; base editing single-stranded nucleic acids. In other embodiments, they can also be used to prepare reagents or kits for any or more of the above purposes.

[0165] The present invention also provides the use of the above-mentioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition or activated CRISPR complex in gene editing, gene targeting or gene cutting; or, in the preparation of reagents or kits for gene editing, gene targeting or gene cutting.

[0166] In one embodiment, the gene editing, gene targeting, or gene cutting is performed intracellularly and / or extracellularly.

[0167] The present invention also provides a method for editing, targeting, or cleaving a target nucleic acid, the method comprising contacting the target nucleic acid with the aforementioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition, or activated CRISPR complex. In one embodiment, the method comprises editing, targeting, or cleaving the target nucleic acid intracellularly or extracellularly.

[0168] The gene editing or editing of target nucleic acids includes modifying genes, knocking out genes, altering the expression of gene products, repairing mutations, and / or inserting polynucleotides, and gene mutations.

[0169] The editing can be performed in prokaryotic and / or eukaryotic cells.

[0170] On the other hand, the present invention also provides the use of the above-mentioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition or activated CRISPR complex in nucleic acid detection, or in the preparation of reagents or kits for nucleic acid detection.

[0171] On the other hand, the present invention also provides a method for cleaving single-stranded nucleic acids, the method comprising contacting a nucleic acid population with the aforementioned Cas protein and gRNA, wherein the nucleic acid population comprises a target nucleic acid and a plurality of non-target single-stranded nucleic acids, and the Cas protein cleaving the plurality of non-target single-stranded nucleic acids.

[0172] The gRNA can bind to the Cas protein.

[0173] The gRNA can target the target nucleic acid.

[0174] The contact can be outside the body, outside the body, or inside the cells within the body.

[0175] Preferably, the cleavage of the single-stranded nucleic acid is non-specific.

[0176] On the other hand, the present invention also provides the use of the above-mentioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition or activated CRISPR complex in nonspecific cleavage of single-stranded nucleic acids, or in the preparation of reagents or kits for nonspecific cleavage of single-stranded nucleic acids.

[0177] On the other hand, the present invention also provides a kit for gene editing, gene targeting or gene cutting, the kit comprising the above-mentioned Cas protein, nucleic acid, the above-mentioned gRNA, the above-mentioned composition, the above-mentioned CIRSPR / Cas system, the above-mentioned vector system, the above-mentioned delivery composition, the above-mentioned activated CRISPR complex or the above-mentioned host cell.

[0178] On the other hand, the present invention also provides a kit for detecting target nucleic acids in a sample, the kit comprising: (a) a Cas protein, or a nucleic acid encoding the Cas protein; (b) a guide RNA, or a nucleic acid encoding the guide RNA, or a precursor RNA containing the guide RNA, or a nucleic acid encoding the precursor RNA; and (c) a single-stranded nucleic acid detector that is single-stranded and does not hybridize with the guide RNA.

[0179] As is known in the art, precursor RNA can be cleaved or processed into the aforementioned mature guide RNA.

[0180] On the other hand, the invention provides the use of the above-mentioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition, activated CRISPR complex, or host cell in the preparation of formulations or kits, wherein the formulations or kits are used for:

[0181] (i) Gene or genome editing;

[0182] (ii) Target nucleic acid detection and / or diagnosis;

[0183] (iii) Editing target sequences in target loci to modify biological or non-human organisms;

[0184] (iv) Treatment of the disease;

[0185] (v) Targeting the target gene;

[0186] (vi) Cut the target gene.

[0187] Preferably, the above-mentioned gene or genome editing is performed intracellularly or extracellularly.

[0188] Preferably, the target nucleic acid detection and / or diagnosis is performed in vitro.

[0189] Preferably, the treatment of the disease is to treat symptoms caused by defects in the target sequence at the target locus.

[0190] In another aspect, the present invention provides a method for detecting target nucleic acids in a sample, the method comprising contacting the sample with the Cas protein, gRNA (guide RNA) and a single-stranded nucleic acid detector, the gRNA including a region that binds to the Cas protein and a targeting sequence that hybridizes with the target nucleic acid; detecting a detectable signal generated by the single-stranded nucleic acid detector by the Cas protein cleaving the single-stranded nucleic acid detector, thereby detecting the target nucleic acid; the single-stranded nucleic acid detector not hybridizing with the gRNA.

[0191] Methods of specifically modifying a target nucleic acid

[0192] On the other hand, the present invention also provides a method for specifically modifying target nucleic acids, the method comprising: contacting the target nucleic acid with the above-mentioned Cas protein, nucleic acid, above-mentioned gRNA, above-mentioned composition, above-mentioned CIRSPR / Cas system, above-mentioned vector system, above-mentioned delivery composition or above-mentioned activated CRISPR complex.

[0193] This specific modification can occur in vivo or in vitro.

[0194] This specific modification can occur either inside or outside the cell.

[0195] In some cases, the cells are selected from prokaryotic or eukaryotic cells, such as animal cells, plant cells, or microbial cells.

[0196] In one embodiment, the modification refers to a break in the target sequence, such as a single-strand / double-strand break in DNA or a single-strand break in RNA.

[0197] In some cases, the method further includes contacting the target nucleic acid with a donor polynucleotide, wherein the donor polynucleotide, a portion of the donor polynucleotide, a copy of the donor polynucleotide, or a portion of a copy of the donor polynucleotide is integrated into the target nucleic acid.

[0198] In one embodiment, the modification further includes inserting an editing template (e.g., exogenous nucleic acid) into the break.

[0199] In one embodiment, the method further includes contacting the editing template with the target nucleic acid or delivering it to a cell containing the target nucleic acid. In this embodiment, the method repairs the broken target gene by homologous recombination with a foreign template polynucleotide; in some embodiments, the repair results in a mutation, including the insertion, deletion, or substitution of one or more nucleotides of the target gene; in other embodiments, the mutation results in a change in one or more amino acids in a protein expressed from a gene containing the target sequence.

[0200] Detection (non-specific cleavage)

[0201] On the other hand, the present invention provides a method for detecting target nucleic acid in a sample, the method comprising contacting the sample with the above-mentioned Cas protein, nucleic acid, gRNA, composition, CIRSPR / Cas system, vector system, delivery composition or activated CRISPR complex and single-stranded nucleic acid detector; detecting a detectable signal generated by the single-stranded nucleic acid detector by the Cas protein cleaving the single-stranded nucleic acid, thereby detecting the target nucleic acid.

[0202] In this invention, the target nucleic acid includes ribonucleotides or deoxyribonucleotides; including single-stranded nucleic acids and double-stranded nucleic acids, such as single-stranded DNA, double-stranded DNA, single-stranded RNA, and double-stranded RNA.

[0203] In one embodiment, the target nucleic acid is derived from samples such as viruses, bacteria, microorganisms, soil, water sources, humans, animals, and plants. Preferably, the target nucleic acid is a product enriched or amplified by methods such as PCR, NASBA, RPA, SDA, LAMP, HAD, NEAR, MDA, RCA, LCR, and RAM.

[0204] In one embodiment, the target nucleic acid is viral nucleic acid, bacterial nucleic acid, disease-related specific nucleic acid, such as specific mutation sites or SNP sites, or nucleic acids that differ from controls; preferably, the virus is a plant virus or animal virus, such as papillomavirus, hepatocyte DNA virus, herpesvirus, adenovirus, poxvirus, parvovirus, or coronavirus; preferably, the virus is a coronavirus, preferably SARS, SARS-CoV2 (COVID-19), HCoV-229E, HCoV-OC43, HCoV-NL63, HCoV-HKU1, or Mers-Cov.

[0205] In this invention, the gRNA has at least a 50% match with the target sequence on the target nucleic acid, preferably at least 60%, preferably at least 70%, preferably at least 80%, and preferably at least 90%.

[0206] In one implementation, when the target sequence contains one or more signature sites (such as specific mutation sites or SNPs), the signature sites perfectly match the gRNA.

[0207] In one embodiment, the detection method may include one or more gRNAs with different guide sequences that target different target sequences.

[0208] In this invention, the single-stranded nucleic acid detector includes, but is not limited to, single-stranded DNA, single-stranded RNA, DNA-RNA hybrids, nucleic acid analogs, base modifiers, and single-stranded nucleic acid detectors containing base-free spacers; "nucleic acid analogs" include, but are not limited to: locked nucleic acids, bridging nucleic acids, morpholine nucleic acids, ethylene glycol nucleic acids, hexitol nucleic acids, threonine nucleic acids, arabinose nucleic acids, 2'-oxymethyl RNA, 2'-methoxyacetyl RNA, 2'-fluoroRNA, 2'-aminoRNA, 4'-thioRNA, and combinations thereof, including optional ribonucleotide or deoxyribonucleotide residues.

[0209] In this invention, the detectable signal is achieved through the following methods: vision-based detection, sensor-based detection, color detection, fluorescence signal-based detection, gold nanoparticle-based detection, fluorescence polarization, colloidal phase transition / dispersion, electrochemical detection, and semiconductor-based detection.

[0210] In this invention, preferably, a fluorescent group and a quenching group are respectively disposed at both ends of the single-stranded nucleic acid detector, so that the single-stranded nucleic acid detector can exhibit a detectable fluorescent signal after being cleaved. The fluorescent group is selected from one or any combination of FAM, FITC, VIC, JOE, TET, CY3, CY5, ROX, Texas Red, or LC RED460; the quenching group is selected from one or any combination of BHQ1, BHQ2, BHQ3, Dabcy1, or Tamra.

[0211] In other embodiments, different labeling molecules are set at the 5' and 3' ends of the single-stranded nucleic acid detector, and the colloidal gold test results of the single-stranded nucleic acid detector before and after being cleaved by the Cas protein are detected by colloidal gold detection. The single-stranded nucleic acid detector will show different color development results on the colloidal gold detection line and control line before and after being cleaved by the Cas protein.

[0212] In some implementations, the method for detecting target nucleic acids may further include comparing the level of a detectable signal with a reference signal level, and determining the amount of target nucleic acid in the sample based on the level of the detectable signal.

[0213] In some implementations, the method for detecting target nucleic acids may also include using RNA reporter nucleic acids and DNA reporter nucleic acids (e.g., fluorescence color) on different channels and determining the level of a detectable signal by measuring the signal levels of the RNA and DNA reporter molecules and by measuring the amount of target nucleic acid in the RNA and DNA reporter molecules, sampling based on the combined (e.g., using minimum or product) level of the detectable signal.

[0214] In one embodiment, the target gene is present within the cell.

[0215] In one embodiment, the cell is a prokaryotic cell.

[0216] In one embodiment, the cell is a eukaryotic cell.

[0217] In one embodiment, the cell is an animal cell.

[0218] In one embodiment, the cell is a human cell.

[0219] In one embodiment, the cell is a plant cell, such as the cell of a cultivated plant (e.g., cassava, corn, sorghum, wheat, or rice), algae, tree, or vegetable.

[0220] In one embodiment, the target gene is present in an in vitro nucleic acid molecule (e.g., a plasmid).

[0221] In one embodiment, the target gene is present in a plasmid.

[0222] Definitions of terms

[0223] In this invention, unless otherwise stated, the scientific and technical terms used herein have the meanings commonly understood by those skilled in the art. Furthermore, the operational steps used herein, such as molecular genetics, nucleic acid chemistry, chemistry, molecular biology, biochemistry, cell culture, microbiology, cell biology, genomics, and recombinant DNA, are all conventional steps widely used in their respective fields. To better understand this invention, definitions and explanations of relevant terms are provided below.

[0224] In this invention, amino acid residues can be represented by a single letter or by three letters, for example: alanine (Ala, A), valine (Val, V), glycine (Gly, G), leucine (Leu, L), glutamic acid (Gln, Q), phenylalanine (Phe, F), tryptophan (Trp, W), tyrosine (Tyr, Y), aspartic acid (Asp, D), asparagine (Asn, N), glutamic acid (Glu, E), lysine (Lys, K), methionine (Met, M), serine (Ser, S), threonine (Thr, T), cysteine ​​(Cys, C), proline (Pro, P), isoleucine (Ile, I), histidine (His, H), and arginine (Arg, R).

[0225] The term "AxxB" indicates that amino acid A at position xx is replaced by amino acid B. Unless otherwise specified, the change always starts from the N-terminus and proceeds from position xx. For example, L65R indicates that L at position 65 is mutated to R. When multiple amino acid sites are mutated simultaneously, it can be expressed using forms such as L65R-V75R, L65R V75R, or L65R / V75R. For example, L65R-V75R represents that L at position 65 is mutated to R while V at position 75 is mutated to R.

[0226] The specific amino acid positions (numbers) within the protein described in this invention are determined using standard sequence alignment tools by comparing the amino acid sequence of the target protein with SEQ ID No. 1. For example, the Smith-Waterman algorithm or the CLUSTALW2 algorithm can be used to align two sequences, with the sequence considered aligned when the alignment score is the highest. The alignment score can be calculated according to the method described in Wilbur, WJ and Lipman, DJ (1983) Rapid similarity searches of nucleic acid and protein data banks. Proc. Natl. Acad. Sci. USA, 80:726-730. In the ClustalW2 (1.82) algorithm, the default parameters are preferably used: protein gap opening penalty = 10.0; protein gap extension penalty = 0.2; protein matrix = Gonnet; protein / DNA end gap = -1; protein / DNA GAPDIST = 4. The AlignX program (part of the vectorNTI group) is preferably used to determine the position of specific amino acids in the protein of the present invention by comparing the amino acid sequence of the protein with SEQ ID No. 1 using default parameters suitable for multiple alignments (gap opening penalty: 10, gap extension penalty: 0.05).

[0227] Those skilled in the art can use commonly used software, such as Clustal Omega, to perform sequence identity comparison and alignment between the amino acid sequence of any parental Cas protein and SEQ ID No. 1, thereby obtaining the amino acid sites in the parental Cas protein corresponding to the amino acid sites defined in SEQ ID No. 1 as described in this application.

[0228] Cas protein

[0229] In this invention, Cas protein, Cas enzyme, and Cas effector protein can be used interchangeably; the inventors have for the first time discovered and identified a Cas effector protein having an amino acid sequence selected from the following:

[0230] (i) A sequence having at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 80%, at least 80%, at least 85%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the sequence shown in SEQ ID No. 1;

[0231] (ii) A sequence having one or more amino acid substitutions, deletions, or additions (e.g., substitutions, deletions, or additions of 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 amino acids) compared to the sequence shown in SEQ ID No. 1; or

[0232] (iii) A sequence having at least 80% sequence identity with the sequence shown in SEQ ID No. 1; and, compared with the parental Cas protein, having a mutation (e.g., any one, two, three, four, or five amino acid sites) at any of the following amino acid sites corresponding to the amino acid sequence shown in SEQ ID No. 1: position 36, position 39, position 65, position 69, position 73, position 75, position 119, position 122, position 132, position 154, position 155, position 156, position 157, position 171, position 186, position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, and position 344.

[0233] Nucleic acid cleavage or cleavage of nucleic acids as used herein includes: DNA or RNA breaks in target nucleic acids produced by the Cas enzyme described herein (Cis cleavage), and DNA or RNA breaks in side-branched nucleic acid substrates (single-stranded nucleic acid substrates) (i.e., nonspecific or non-targeted, trans cleavage). In some embodiments, the cleavage is a double-stranded DNA break. In some embodiments, the cleavage is a single-stranded DNA break or a single-stranded RNA break.

[0234] CRISPR system

[0235] As used herein, the terms “regularly clustered short palindromic repeats (CRISPR)-CRISPR-related (Cas) (CRISPR-Cas) system” or “CRISPR system” are used interchangeably and have the meaning commonly understood by those skilled in the art, which typically includes transcripts or other elements relating to the expression of CRISPR-related (“Cas”) genes, or transcripts or other elements capable of directing the activity of said Cas genes.

[0236] CRISPR / Cas complex

[0237] As used herein, the term “CRISPR / Cas complex” refers to a complex formed by the binding of guide RNA or mature crRNA to the Cas protein, which is capable of recognizing and cleaving polynucleotides that hybridize with the guide RNA or mature crRNA.

[0238] Guide RNA (gRNA)

[0239] As used herein, the terms “guide RNA (gRNA),” “mature crRNA,” and “guide sequence” are used interchangeably and have the meanings commonly understood by those skilled in the art. Generally, guide RNA includes both tracrRNA and crRNA; tracrRNA is capable of pairing with a pairing region of crRNA to form a double strand; crRNA also includes a region that hybridizes to a target sequence (i.e., a target sequence for a nucleic acid). crRNA includes a pairing region sequence capable of pairing with tracrRNA and also includes a region that hybridizes to a target sequence (i.e., a target sequence for a nucleic acid).

[0240] In some cases, the target sequence is any polynucleotide sequence that is sufficiently complementary to the target sequence to hybridize with it and guide the specific binding of the CRISPR / Cas complex to the target sequence. In one embodiment, the complementarity between the target sequence and its corresponding target sequence is at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95%, or at least 99% when optimal alignment is achieved. Determining the optimal alignment is within the capabilities of a person skilled in the art. For example, publicly available and commercially available alignment algorithms and programs exist, such as, but not limited to, ClustalW, the Smith-Waterman algorithm in MATLAB, Bowtie, Geneious, Biopython, and SeqMan.

[0241] Target sequence

[0242] A "target sequence" refers to a polynucleotide targeted by a target sequence in the gRNA, such as a sequence complementary to that target sequence, where hybridization between the target sequences will promote the formation of a CRISPR / Cas complex (including the Cas protein and gRNA). Perfect complementarity is not required, as long as there is sufficient complementarity to induce hybridization and promote the formation of a CRISPR / Cas complex.

[0243] The target sequence can contain any polynucleotide, such as DNA or RNA. In some cases, the target sequence is located inside or outside the cell. In some cases, the target sequence is located in the cell nucleus or cytoplasm. In some cases, the target sequence may be located in an organelle of a eukaryotic cell, such as a mitochondrion or chloroplast. The sequence or template that can be used for recombination into a target locus containing the target sequence is referred to as an "edit template," "edit polynucleotide," or "edit sequence." In one embodiment, the edit template is a foreign nucleic acid. In one embodiment, the recombination is homologous recombination.

[0244] In this invention, the "target sequence," "target polynucleotide," or "target nucleic acid" can be any endogenous or exogenous polynucleotide for a cell (e.g., a eukaryotic cell). For example, the target polynucleotide can be a polynucleotide present in the nucleus of a eukaryotic cell. The target polynucleotide can be a sequence encoding a gene product (e.g., a protein) or a non-coding sequence (e.g., a regulatory polynucleotide or useless DNA). In some cases, the target sequence should be associated with a protospacer adjacent motif (PAM).

[0245] Single-stranded nucleic acid detector

[0246] The single-stranded nucleic acid detector described in this invention refers to a sequence containing 2-200 nucleotides, preferably 2-150 nucleotides, more preferably 3-100 nucleotides, more preferably 3-30 nucleotides, more preferably 4-20 nucleotides, and even more preferably 5-15 nucleotides. It is preferably a single-stranded DNA molecule, a single-stranded RNA molecule, or a single-stranded DNA-RNA hybrid.

[0247] The single-stranded nucleic acid detector has different reporter groups or label molecules at both ends. When it is in its initial state (i.e., uncut state), it does not present a reporter signal. When the single-stranded nucleic acid detector is cut, it presents a detectable signal, that is, it shows a detectable difference after cutting compared to before cutting.

[0248] In one embodiment, the reporter group or labeled molecule includes a fluorescent group and a quencher group, wherein the fluorescent group is selected from one or any of FAM, FITC, VIC, JOE, TET, CY3, CY5, ROX, Texas Red, or LC RED460; and the quencher group is selected from one or any of BHQ1, BHQ2, BHQ3, Dabcy1, or Tamra.

[0249] In one embodiment, the single-stranded nucleic acid detector has a first molecule (such as FAM or FITC) connected to the 5' end and a second molecule (such as biotin) connected to the 3' end. The reaction system containing the single-stranded nucleic acid detector is used in conjunction with a flow strip to detect target nucleic acids (preferably, colloidal gold detection). The flow strip is designed with two capture lines, with an antibody binding the first molecule (i.e., the first molecule antibody) at the sample contact end (colloidal gold), an antibody binding the first molecule antibody at the first line (control line), and an antibody binding the second molecule antibody (i.e., the second molecule antibody, such as avidin) at the second line (test line). As the reaction flows along the strip, the first molecule antibody binds to the first molecule, carrying cleaved or uncleaved oligonucleotides to the capture lines. Cleaved reporters bind to the first molecule antibody at the first capture line, while uncleaved reporters bind to the second molecule antibody at the second capture line. The binding of the reporter group at each line results in a strong readout / signal (e.g., color). As more reporters are cleaved, more signal accumulates at the first capture line, and less signal appears at the second line. In some aspects, the present invention relates to the use of flow strips as described herein for the detection of nucleic acids. In some aspects, the present invention relates to methods for detecting nucleic acids using flow strips as defined herein, such as (lateral)flow assays or (lateral)flow immunochromatographic assays. In some aspects, the molecules in the single-stranded nucleic acid detector may be interchanged or their positions altered, provided that their reporting principle is the same as or similar to that of the present invention, and any modifications thereof are also included in the present invention.

[0250] The detection method described in this invention can be used for the quantitative detection of target nucleic acids. The quantitative detection index can be determined based on the signal strength of the reporter group, such as the luminescence intensity of the fluorescent group or the width of the colored band.

[0251] Wild type

[0252] As used herein, the term “wildtype” has the meaning commonly understood by those skilled in the art as referring to the typical form of an organism, strain, or gene, or the characteristic that distinguishes it from mutant or variant forms when it exists in nature, is separable from its natural source and has not been intentionally modified by humans.

[0253] Derivatization

[0254] As used herein, the term "derivation" refers to the chemical modification of an amino acid, polypeptide, or protein in which one or more substituents are covalently linked to the amino acid, polypeptide, or protein. Substituents may also be referred to as side chains.

[0255] A derivatized protein is a derivative of the original protein. Generally, the derivatization of a protein does not adversely affect its desired activity (e.g., activity to bind to guide RNA, endonuclease activity, activity to bind to and cleave a target sequence at a specific site under the guidance of guide RNA). In other words, the derivative of a protein has the same activity as the original protein.

[0256] Derivatized protein

[0257] Also known as "protein derivatives," these are modified forms of proteins, where one or more amino acids of the protein may be deleted, inserted, modified, and / or substituted.

[0258] Non-naturally occurring

[0259] As used herein, the terms “non-naturally occurring” or “engineered” are used interchangeably and indicate artificial involvement. When these terms are used to describe nucleic acid molecules or peptides, they indicate that the nucleic acid molecule or peptide is at least substantially free from at least one other component bound to it, either naturally occurring or found in nature.

[0260] Orthologue

[0261] As used herein, the term "orthologue" has the meaning commonly understood by those skilled in the art. As further guidance, an "orthologue" of a protein, as described herein, refers to a protein belonging to a different species that performs the same or similar function as the protein that is its orthologue.

[0262] Identity

[0263] As used herein, the term "identity" refers to the sequence matching between two polypeptides or two nucleic acids. Two compared sequences are identical at a position when the same base or amino acid monomeric subunit occupies the same location (e.g., a position in each of two DNA molecules is occupied by adenine, or a position in each of two polypeptides is occupied by lysine). The "percentage identity" between two sequences is a function of the number of matching positions shared by the two sequences divided by the number of positions compared × 100. For example, if six out of ten positions in two sequences match, then the two sequences have 60% identity. For example, the DNA sequences CTGACT and CAGGTT share 50% identity (three out of six positions match). Typically, two sequences are compared to produce the maximum identity. Such comparisons can be made using methods readily available, for example, computer programs such as the Align program (DNAstar, Inc.) Needleman et al. (1970) J. Mol. Biol. 48: 443-453. The percentage identity between two amino acid sequences can also be determined using the algorithm of E. Meyers and W. Miller (Comput. Appl Biosci., 4:11-17 (1988)) integrated into the ALIGN program (version 2.0), which uses a PAM120 weight residue table, a gap length penalty of 12, and a gap penalty of 4. Alternatively, the percentage identity between two amino acid sequences can be determined using the Needleman and Wunsch algorithm (J MoIBiol. 48:444-453 (1970)) in the GAP program integrated into the GCG software package (available at www.gcg.com), which uses a Blossum 62 matrix or a PAM250 matrix, along with gap weights of 16, 14, 12, 10, 8, 6, or 4, and length weights of 1, 2, 3, 4, 5, or 6.

[0264] Vector

[0265] The term "vector" refers to a nucleic acid molecule capable of delivering another nucleic acid molecule linked to it. Vectors include, but are not limited to, single-stranded, double-stranded, or partially double-stranded nucleic acid molecules; nucleic acid molecules including one or more free ends, or without free ends (e.g., circular); nucleic acid molecules including DNA, RNA, or both; and a wide variety of other polynucleotides known in the art. A vector can be introduced into a host cell through transformation, transduction, or transfection, thereby enabling the expression of its carried genetic material elements in the host cell. A vector can be introduced into a host cell to produce transcripts, proteins, or peptides, including proteins, fusion proteins, isolated nucleic acid molecules, etc., as described herein (e.g., CRISPR transcripts, such as nucleic acid transcripts, proteins, or enzymes). A vector may contain a variety of elements controlling expression, including, but not limited to, promoter sequences, transcription initiation sequences, enhancer sequences, selection elements, and reporter genes. Additionally, the vector may contain a replication initiation site.

[0266] One type of vector is a "plasmid," which is a circular double-stranded DNA loop into which another DNA fragment can be inserted, for example, using standard molecular cloning techniques.

[0267] Another type of vector is the viral vector, in which a virus-derived DNA or RNA sequence is present in a vector used to package the virus (e.g., retroviruses, replication-defective retroviruses, adenoviruses, replication-defective adenoviruses, and adeno-associated viruses). Viral vectors also contain polynucleotides carried by the virus used for transfection into a host cell. Some vectors (e.g., bacterial vectors with bacterial origins of replication and episodic mammalian vectors) are capable of autonomous replication in the host cells into which they are introduced.

[0268] Other vectors (e.g., non-attachment mammalian vectors) integrate into the host cell's genome upon introduction and thereby replicate along with the host genome. Furthermore, some vectors are capable of directing the expression of genes they are operatively linked to. Such vectors are referred to herein as "expression vectors."

[0269] Host cell

[0270] As used herein, the term “host cell” refers to a cell that can be used to introduce a vector, including but not limited to prokaryotic cells such as Escherichia coli or Bacillus subtilis, and eukaryotic cells such as microbial cells, fungal cells, animal cells, and plant cells.

[0271] Those skilled in the art will understand that the design of expression vectors can depend on factors such as the selection of host cells to be transformed and the desired expression level.

[0272] Regulatory element

[0273] As used herein, the term "regulatory element" is intended to include promoters, enhancers, internal ribosome entry sites (IRES), and other expression control elements (e.g., transcription termination signals such as polyadenylation signals and poly-U sequences), for which detailed description can be found in Goeddel, *Gene Expression Technology: Methods in Enzymology*, 185, Academic Press, San Diego, California (1990). In some cases, regulatory elements include those sequences that direct constitutive expression of a nucleotide sequence in many types of host cells and those sequences that direct expression of that nucleotide sequence only in certain host cells (e.g., tissue-specific regulatory sequences). Tissue-specific promoters can primarily direct expression in the desired tissue of interest, such as muscle, neurons, bone, skin, blood, specific organs (e.g., liver, pancreas), or specific cell types (e.g., lymphocytes). In some cases, regulatory elements can also be directed to express in a time-dependent manner (such as in a cell cycle-dependent or developmental stage-dependent manner), which may or may not be tissue or cell type specific. In some cases, the term "regulatory element" covers enhancer elements such as WPRE; CMV enhancer; R-U5' fragment in the LTR of HTLV-I (Mol. Cell. Biol., Vol. 8(1), pp. 466-472, 1988); SV40 enhancer; and intron sequence between exons 2 and 3 of rabbit β-globin (Proc. Natl. Acad. Sci. USA., Vol. 78(3), pp. 1527-31, 1981).

[0274] Promoter

[0275] As used herein, the term "promoter" has the meaning known to those skilled in the art, referring to a non-coding nucleotide sequence located upstream of a gene that initiates the expression of a downstream gene. A constitutive promoter is a nucleotide sequence that, when operably linked to a polynucleotide encoding or defining a gene product, results in the production of the gene product in the cell under most or all physiological conditions of the cell. An inducible promoter is a nucleotide sequence that, when operably linked to a polynucleotide encoding or defining a gene product, results in the production of the gene product in the cell substantially only when an inducer corresponding to the promoter is present in the cell. A tissue-specific promoter is a nucleotide sequence that, when operably linked to a polynucleotide encoding or defining a gene product, results in the production of the gene product in the cell substantially only when the cell is a cell of the tissue type corresponding to that promoter.

[0276] NLS

[0277] A “nuclear localization signal” or “nuclear localization sequence” (NLS) is an amino acid sequence that “tags” a protein to allow it to be transported to the nucleus via nuclear transport; that is, a protein with an NLS is transported to the nucleus. Typically, an NLS contains positively charged Lys or Arg residues exposed on the protein surface. Exemplary nuclear localization sequences include, but are not limited to, NLS from the following: SV40 large T antigen, EGL-13, c-Myc, and TUS protein. In some embodiments, the NLS contains the PKKKRKV sequence. In some embodiments, the NLS contains the AVKRPAATKKAGQAKKKKLD sequence. In some embodiments, the NLS contains the PAAKRVKLD sequence. In some embodiments, the NLS contains the MSRRRKANPTKLSENAKKLAKEVEN sequence. In some embodiments, the NLS contains the KLKIKRPVK sequence. Other nuclear localization sequences include, but are not limited to, the acidic M9 domain of hnRNP A1, the KIPIK sequence in the yeast transcriptional repressor Matα2, and PY-NLS.

[0278] Operably linked

[0279] As used herein, the term “operably linked” is intended to mean that the nucleotide sequence of interest is linked to one or more regulatory elements in a manner that allows the expression of that nucleotide sequence (e.g., in an in vitro transcription / translation system or in the host cell when the vector is introduced into the host cell).

[0280] Complementarity

[0281] As used herein, the term "complementarity" refers to the ability of a nucleic acid to form one or more hydrogen bonds with another nucleic acid sequence via conventional Watson-Crick or other non-conventional types. The percentage of complementarity indicates the percentage of residues in a nucleic acid molecule that can form hydrogen bonds (e.g., Watson-Crick base pairing) with a second nucleic acid sequence (e.g., 5, 6, 7, 8, 9, 10 out of 10 are 50%, 60%, 70%, 80%, 90%, and 100% complementary). "Complete complementarity" means that all consecutive residues in a nucleic acid sequence form hydrogen bonds with the same number of consecutive residues in a second nucleic acid sequence. As used herein, “substantially complementary” refers to a complementarity of at least 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95%, 97%, 98%, 99%, or 100% in a region having 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 30, 35, 40, 45, 50 or more nucleotides, or to two nucleic acids hybridizing under stringent conditions.

[0282] Stringent conditions

[0283] As used herein, “strict conditions” for hybridization refer to conditions under which a nucleic acid complementary to the target sequence hybridizes primarily with the target sequence and substantially does not hybridize to non-target sequences. Strict conditions are typically sequence-dependent and vary depending on many factors. Generally, the longer the sequence, the higher the temperature at which it specifically hybridizes to its target sequence.

[0284] Hybridization

[0285] The terms “hybridization” or “complementary” or “substantially complementary” refer to nucleic acids (such as RNA, DNA) containing nucleotide sequences that enable them to bind non-covalently, that is, to form base pairs and / or G / U base pairs with another nucleic acid in a sequence-specific, antiparallel manner (i.e., nucleic acid-specific binding of complementary nucleic acids), also known as “annealing” or “hybridization”.

[0286] Hybridization requires two nucleic acids to contain complementary sequences, although mismatches between bases may exist. Suitable conditions for hybridization between two nucleic acids depend on their length and degree of complementarity, which are well-known variables in the art. Typically, hybridizable nucleic acids are 8 nucleotides or longer (e.g., 10 nucleotides or longer, 12 nucleotides or longer, 15 nucleotides or longer, 20 nucleotides or longer, 22 nucleotides or longer, 25 nucleotides or longer, or 30 nucleotides or longer).

[0287] It should be understood that the sequence of a polynucleotide does not need to be 100% complementary to the sequence of its target nucleic acid for specific hybridization. The polynucleotide may contain 60% or higher, 65% or higher, 70% or higher, 75% or higher, 80% or higher, 85% or higher, 90% or higher, 95% or higher, 98% or higher, 99% or higher, 99.5% or higher, or have 100% sequence complementarity with the target region of the target nucleic acid sequence it hybridizes with.

[0288] Hybridization of the target sequence with gRNA means that at least 60%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% of the nucleic acid sequences of the target sequence and gRNA can hybridize to form a complex; or it means that at least 12, 15, 16, 17, 18, 19, 20, 21, 22, or more bases of the nucleic acid sequences of the target sequence and gRNA can be complementary and hybridize to form a complex.

[0289] Expression

[0290] As used herein, the term "expression" refers to the process by which a DNA template is transcribed into polynucleotides (such as mRNA or other RNA transcripts) and / or the transcribed mRNA is subsequently translated into peptides, polypeptides, or proteins. Transcripts and encoded polypeptides can be collectively referred to as "gene products." If the polynucleotides are derived from genomic DNA, expression can include the splicing of mRNA in eukaryotic cells.

[0291] Linker

[0292] As used herein, the term "linker" refers to a linear polypeptide formed by the linkage of multiple amino acid residues via peptide bonds. The linkers of this invention can be synthetically produced amino acid sequences or naturally occurring polypeptide sequences, such as polypeptides with hinge region functions. Such linker polypeptides are well known in the art (see, for example, Holliger, P. et al. (1993) Proc. Natl. Acad. Sci. USA 90:6444-6448; Poljak, RJ et al. (1994) Structure 2:1121-1123).

[0293] Treatment

[0294] As used in this article, the term "treatment" means to treat or cure a disease, to delay the onset of symptoms of a disease, and / or to slow the progression of a disease.

[0295] Subject

[0296] As used herein, the term “subject” includes, but is not limited to, various animals, plants and microorganisms.

[0297] Animal

[0298] For example, mammals, such as bovids, equines, sheep, suidae, canids, felines, lagos, rodents (e.g., mice or rats), non-human primates (e.g., macaques or cynomolgus monkeys), or humans. In some embodiments, the subject (e.g., a human) suffers from a condition (e.g., a condition caused by a disease-related gene defect).

[0299] Plant

[0300] The term "plant" should be understood as any differentiated multicellular organism capable of photosynthesis, including crop plants at any stage of maturity or development, particularly monocotyledonous or dicotyledonous plants, vegetable crops including artichokes, kohlrabi, arugula, leeks, asparagus, lettuce (e.g., head lettuce, leaf lettuce, longleaf lettuce), bok choy, taro, cucurbits (e.g., melons, watermelons, crenshaw, cantaloupes, Roman melons), rapeseed crops (e.g., Brussels sprouts, cabbage, cauliflower, broccoli, kale, headless cabbage, Chinese cabbage, baby bok choy), artichokes, carrots, napa cabbage, okra, onions, celery, parsley, chickpeas, parsnip, chicory, peppers, potatoes, gourds (e.g., zucchini, cucumbers, baby zucchini, squash, pumpkin), radishes, and dried heads. Onions, rutabagas, purple eggplant (also known as eggplant), ginseng, lettuce, scallions, chicory, garlic, spinach, green onions, squash, leafy greens, beets (sugar beets and fodder beets), sweet potatoes, romaine lettuce, wasabi, tomatoes, turnips, and spices; fruits and / or vine crops such as apples, apricots, cherries, nectarines, peaches, pears, plums, prunes, cherries, quince, almonds, chestnuts, hazelnuts, pecans, pistachios, walnuts, citrus fruits, blueberries, boysenberries. Raspberries, cranberries, currants, raspberries, strawberries, blackberries, grapes, avocados, bananas, kiwis, persimmons, pomegranates, pineapples, tropical fruits, pears, melons, mangoes, papayas, and lychees; field crops such as clover, alfalfa, evening primrose, silvergrass, corn / maize (feed corn, sweet corn, popcorn), hops, jojoba, peanuts, rice, safflower, small grain cereals (barley, oats, rye, wheat, etc.), sorghum, tobacco, kapok, legumes (beans, lentils, peas) Beans, soybeans), oil plants (rapeseed, mustard, olive, sunflower, coconut, castor oil plants, cocoa beans, peanuts), Arabidopsis, fiber plants (cotton, flax, jute), Lauraceae (cinnamon, camphor), or a plant such as coffee, sugarcane, tea, and natural rubber plants; and / or bedding plants, such as flowering plants, cacti, succulents and / or ornamental plants, and trees such as forests (broadleaf trees and evergreen trees, such as conifers), fruit trees, ornamental trees, and nut-bearing trees, as well as shrubs and other seedlings.

[0301] Beneficial effects of the invention

[0302] This invention discovers a Cas enzyme. Blast results show that the Cas enzyme of this application has low similarity with previously reported Cas enzymes and belongs to the Cas protein. This invention further mutates this Cas protein to obtain a Cas mutant protein with further enhanced activity, which has broad application prospects.

[0303] The embodiments of the present invention will now be described in detail with reference to the accompanying drawings and examples. However, those skilled in the art will understand that the following drawings and examples are for illustrative purposes only and are not intended to limit the scope of the invention. Various objects and advantages of the present invention will become apparent to those skilled in the art from the following detailed description of the drawings and preferred embodiments. Attached Figure Description

[0304] Figure 1 The PAM structure of Cas-sf6728.

[0305] Figure 2 Editing efficiency of different Cas-sf6728 single mutant proteins.

[0306] Figure 3 The structure of the non-target sequence portion of the gRNA of the Cas-sf6728 protein.

[0307] Figure 4 The editing efficiency of different editing systems. Detailed Implementation

[0308] The following examples are for illustrative purposes only and are not intended to limit the invention. Unless otherwise specified, the experiments and methods described in the examples are generally performed according to conventional methods well known in the art and described in various references. For example, conventional techniques such as immunology, biochemistry, chemistry, molecular biology, microbiology, cell biology, genomics, and recombinant DNA used in this invention can be found in Sambrook, Fritsch, and Maniatis, *Molecular Cloning: A Laboratory Manual*, 2nd edition (1989); *Current Protocols in Molecular Biology* (edited by FM. Ausubel et al., (1987)); and the *Methods in Enzymology* series (academic publishing company): *PCR 2: A PRACTICAL*. APPROACH (edited by MJ MacPherson, BD Hames and GR Taylor (1995)), Harlow and Lane (1988) Antibodies, ALABORATORY MANUAL, and Animal Cell Culture (edited by R.R. Freshney (1987)).

[0309] Furthermore, unless specific conditions are specified in the examples, conventional conditions or conditions recommended by the manufacturer should be followed. Reagents or instruments whose manufacturers are not specified are all commercially available conventional products. Those skilled in the art will understand that the examples are described by way of illustration and are not intended to limit the scope of protection claimed by the invention. All disclosures and other references mentioned herein are incorporated herein by reference in their entirety.

[0310] Example 1. Obtaining of Cas-sf6728 protein

[0311] The inventors analyzed the metagenomics of uncultured organisms and identified a novel CRISPR-Cas enzyme through redundancy removal and protein clustering analysis. Blast analysis showed that the Cas protein had low sequence identity with previously reported Cas proteins, and it was named Cas-sf6728 in this invention. The amino acid sequence of the Cas-sf6728 protein is shown in SEQ ID No. 1, the nucleotide sequence is shown in SEQ ID No. 2, the pairing region sequences of crRNA and tracrRNA are shown in SEQ ID No. 3, and the tracrRNA sequence is shown in SEQ ID No. 4.

[0312] The amino acid sequence of Cas-sf6728 (SEQ ID No. 1):

[0313] MADESTKPKTHIRTLKLKLKVVGDDPKTSWKRLRQTSNDTWRAANWIAAGQFMNDQL

[0314] VRRLYARLKVDSKDPAAVQKVEDDFKAVFGTKRQATTERDIKQQFPDLPPCVTNTLNQF

[0315] VVASYTKEKPDMLAGNRSLRTYRKGLPIPTSRASVDFSAQDGRHIVSWKVQRGEQIQFEV

[0316] FYGRDKAGNERTIGLIIATERDYGAPSIQLNEKGLFLLLPVKEPAQDATLDPKRVVGVDLG

[0317] LAVPAYAAVSDGPARRPMGSAEDFLKTRLQMQSRRRRLQRSLVAVHGGNGRQRKMKAM

[0318] DRLSEKERHFARTYNHMISRRLVDFALQVGAGQINMELLEGFGRDEQQAFVLRNWSFFE

[0319] LQQLIGEKAARVGIKVRHVDPYHTSQICSECGNWAQGQRDGRDFVCQNCGLKLDADYNAAVNISRSTKYVQRKEQCRAYIERQTTTTESDDIEKSETDSAGPTAEG*;

[0320] The nucleotide sequence of Cas-sf6728 (SEQ ID No. 2):

[0321] atggccgatgaaagcaccaaaccgaaaacccatattcgcaccctgaaactgaaactgaaggttgtgggtgatgatccgaaaaccagctgga

[0322] aacgtctgcgtcagaccagcaatgatacctggcgtgcagcaaattggattgccgccggtcagtttatgaatgatcagctggtgcgtcgtctgt

[0323] atgcacgtctgaaagttgatagcaaagatccggccgccgtgcagaaagttgaagatgattttaaagccgttttcggtaccaaacgccaggca

[0324] accaccgaacgtgatattaaacagcagtttccggatctgccgccgtgtgtgaccaataccctgaatcagtttgtggttgcaagttataccaaag

[0325] aaaaaccggatatgctggcaggcaatcgcagcctgcgtacctatcgcaaaggtctgccgattccgaccagccgcgccagtgtggattttag

[0326] cgcacaggatggtcgtcatattgttagctggaaagttcagcgcggcgaacagattcagtttgaagttttttatggccgtgataaagcaggcaat

[0327] gaacgcaccattggtctgattattgcaaccgaacgtgactatggtgcacctagtattcagctgaatgaaaaaggcctgtttctgctgctgccggt

[0328] taaagaaccggcccaggatgcaaccctggaccctaaacgcgtggttggtgttgatctgggtctggccgtgccggcatatgccgccgtgagc

[0329] gatggcccggcccgtcgtcctatgggtagtgcagaagattttctgaaaacccgtctgcagatgcagagccgccgccgccgtctgcagcgta

[0330] gtctggttgccgtgcatggtggcaatggccgtcagcgtaaaatgaaagccatggatcgtctgagtgaaaaagaacgtcattttgcccgcacct

[0331] ataatcatatgattagtcgccgcctggtggattttgccctgcaggttggtgccggtcagattaatatggaactgctggaaggctttggccgtgat

[0332] gaacagcaggcctttgttctgcgcaattggagcttttttgaactgcagcagctgattggtgaaaaagcagcacgtgtgggtattaaagttcgtca

[0333] tgtggacccttatcataccagccagatttgcagtgaatgtggcaattgggcacagggccagcgcgatggccgtgattttgtgtgccagaattg

[0334] cggtctgaaactggatgcagattataatgcagcagtgaatattagccgtagcaccaaatatgtgcagcgtaaagaacagtgtcgtgcctatattgaacgccagaccaccaccaccgaaagcgatgatattgaaaaaagtgaaaccgatagcgcaggcccgaccgcagaaggctaa;

[0335] The pairing region sequence of the crRNA and tracrRNA of Cas-sf6728 (SEQ ID No.3):

[0336] AACGAGCCCACGCGUGCCGGGAUGGGUCG;

[0337] The tracrRNA sequence of Cas-sf6728 (SEQ ID No.4):

[0338] UCAACCAAAUAUGUCCAACGAAAGGAGCAAUGCCGGGCCUACAUCGAGCGACAAA

[0339] CCACAACAACCGAAUCCGACGUAUAUCGAGAAGUCGGAAACUGAUUCGGCUGGGCC

[0340] CACAGCCGAAGGGUGAGGGCUAAGCGCCACUCACCAACCCCGCAUGCGCAAUAUAUUGCGACUUGGCUCGUCCCACAGCACAACAUGGCA.

[0341] Example 2. PAM identification of Cas-sf6728 protein

[0342] Constructing the expression plasmid for the Cas-sf6728 protein in Example 1: After codon optimization of its nucleic acid sequence using E. coli, the gene was synthesized and ligated into the E. coli expression vector PeT28(a)+. Simultaneously, the J23119 promoter was added to initiate the transcription of Cas protein's tracrRNA and crRNA, forming the vector: PeT28(a)+-Cas-J23119-gRNA. The gRNA sequence is as follows:

[0343] TCAACCAAATATGTCCAACGAAAGGAGCAATGCCGGGCCTACATCGAGCGACAAACC

[0344] ACAACAACCGAATCCGACGATATCGAGAAGTCGGAAACTGATTCGGCTGGGCCCACA

[0345] GCCGAAGGGGTGAGGGCTAAGCGCCACTCACCACCCCGCATGCGCAATATATTGCGA

[0346] CTTGGCTCGTCCCACAGCACAACATGGCAGAAAAACGAGCCCACGCGTGCCGGGATGGGTCG TCCCCT ACGTGCTGCTGAAGTTGC The underlined part represents the target sequence.

[0347] Construction of PAM libraries: Synthetic sequences

[0348] CGTGTTTCGTAAAGTCTGGAAACGCGGAAGCCCCCAGCGCTTCAGCGTCNNNNNN T CCCCTACGTGCTGCTGAAGTTGCCCGCAA, where N represents a random deoxyribonucleotide, and the underlined sequence is the target sequence. After being filled with Klenow enzyme, it was ligated into the pcyc184 vector. Following transformation into E. coli, plasmids were extracted to form a PAM library.

[0349] PAM library reduction experiment: The expression vector PeT28(a)+-Cas-J23119-gRNA was co-transformed with the PAM library plasmid into competent BL21(DE3) cells. The cells were plated on LB agar plates containing kanamycin and chloramphenicol, incubated overnight at 37°C, and the cells were collected. The bacterial concentration was adjusted to OD600 0.6-0.8, and 0.2 mM IPTG was added, followed by induction at 37°C for 4 h. Plasmid extraction was performed using the FastPure EndoFree PlasmidMaxi Kit (vazyme) to obtain the reduced PAM library. Primers: PAM-F: GGTCTTCGGTTTCCGTGTT; PAM-R: TGGCGTTGACTCTCAGTCAT. PCR was performed using 30 ng / μL plasmid (PAM library) as template to obtain control group samples, and PCR was performed using 30 ng / μL plasmid (reduced PAM library) as template to obtain experimental group samples. The control group samples and the experimental group samples were sent for next-generation sequencing for data analysis.

[0350] To obtain the PAM preference of the Cas-sf6728 protein, such as Figure 1 As shown, the PAM preference of the Cas-sf6728 protein is 5'-AAN-3', where N represents A / C / G / T.

[0351] Example 3. Editing efficiency of Cas-sf6728 protein in animal cells

[0352] Gene editing activity of the Cas-sf6728 protein was verified in animal cells. The vector pcDNA3.3 was modified to carry the ECFP fluorescent protein gene. The SV40 NLS-Cas-NLS fusion protein was inserted via the BsmB1 restriction site; the U6 promoter and gRNA sequence were inserted via the Mfe1 restriction site. The gRNA sequence is: TCAACCAAATATGTCCAACGAAAGGAGCAATGCCGGGCCTACATCGAGCGACAAACCACAACAACCGAATCCGACGATATCGAGAAGTCGGAAACTGATTCGGCTGGGCCCACAGCCGAAGGGTGAGGGCTAAGCGCCACTCACCAACCCCGCATGCGCAATATATTGCGACTTGGCTCGTCCCACAGCACAACATGGCAGAAAAACGAGCCCACGCGTGCCGGGATGGGTCG TCCCCTACGTGCTGCTGAAGTTGCThe underlined sequence indicates the target sequence. The CMV promoter initiates the expression of the fusion protein SV40 NLS-Cas-NLS-ECFP. The proteins Cas-NLS and ECFP are linked by the linker peptide T2A. After modification, the pUC19 vector's EF-1α promoter initiates the expression of the tdTomato-T2A-GF(5spacer1 24bp)FP gene. After the Cas protein recognizes and edits the target site 5spacer1 24bp, the proportion of GFP-positive cells in CFP and tdTomato double-positive cells is analyzed to represent the Cas protein editing efficiency.

[0353] Plating: 293T cells were plated when the confluence reached 70-80%, and the number of cells seeded in a 12-well plate was 8*10^4 cells / well.

[0354] Transfection: Transfect after 12-24 hours of plating. Add 2 μg of plasmid to 100 μL of opti-MEM and mix well; add 4 μL of diluted plasmid to... EL Transfection Reagent (TRAN) was used for incubation at room temperature for 15-20 min. The incubated mixture was then added to cell-layered culture medium for transfection. After 24 h of transfection, the medium was replaced with normal medium, and flow cytometry analysis was performed 48 h later. The results showed that the editing efficiency of the Cas-sf6728 protein was 5.89%.

[0355] Example 4. Obtaining of Cas-sf6728 mutant proteins

[0356] Based on Cas-sf6728 (amino acid sequence shown in SEQ ID No. 1), site-directed mutagenesis was performed on the amino acids that bind to the target sequence using bioinformatics methods. Variants of the Cas protein were generated through PCR-based site-directed mutagenesis, which can employ commonly used site-directed mutagenesis techniques. Specifically, the Cas-sf6728 DNA sequence was divided into two parts centered on the mutation site. Two pairs of primers were designed to amplify these two DNA parts respectively, with the desired mutation sequence introduced onto the primers. The mutants were constructed by splitting the DNA into multiple segments and using PCR and Gibsonclone. Fragment amplification kit: TransStart FastPfu DNA Polymerase (containing 2.5 mM dNTPs), detailed experimental procedures are available in the instruction manual. Gel recovery kit: For detailed experimental procedures, please refer to the instruction manual for the Gel DNA Extraction Mini Kit. The reagent kit used for vector construction is the pEASY-Basic Seamless Cloning and Assembly Kit (CU201-03). For detailed experimental procedures, please refer to the instruction manual.

[0357] In this embodiment, mutations were performed on the following sites based on SEQ ID No. 1: T36W, D39L, L65R, S69R, A73R, V75R, A119R, T122R, N132R, S154R, A155R, Q156R, D157R, Q171R, E186R, L191R, T195R, E208R, T264R, S278R, A281R, D296R, H304R, Q342R, A344R, and other mutated amino acid sites. Based on the above amino acid mutation sites, Cas-sf6728 single mutant proteins T36W, D39L, L65R, S69R, A73R, V75R, A119R, T122R, N132R, S154R, A155R, Q156R, D157R, Q171R, E186R, L191R, T195R, E208R, T264R, S278R, A281R, D296R, H304R, Q342R, A344R and Cas-sf6728 combined mutant protein L65R-V75R were obtained. The above Cas-sf6728 single mutant proteins are respectively derived from SEQ ID […]. No. 1 The following amino acids, starting from the N-terminus, are mutated as follows: amino acid 36 becomes W, amino acid 39 becomes L, amino acid 65 becomes R, amino acid 69 becomes R, amino acid 73 becomes R, amino acid 75 becomes R, amino acid 119 becomes R, amino acid 122 becomes R, amino acid 132 becomes R, amino acid 154 becomes R, amino acid 155 becomes R, amino acid 156 becomes R, amino acid 157 becomes R, and amino acid 171 becomes R. The Cas-sf6728 combined mutant protein L65R-V75R is a mutant protein in which amino acid R is mutated at position 65 from the N-terminus of SEQ ID No. 1, and amino acid R is mutated at position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, and position 344; the Cas-sf6728 combined mutant protein L65R-V75R is a mutant protein in which amino acid R is mutated at position 65 from the N-terminus of SEQ ID No. 1, and amino acid R is mutated at position 75.

[0358] Example 5. Verification of editing activity of Cas-sf6728 mutant proteins

[0359] The gene editing activity of the Cas-sf6728 single mutant protein obtained in Example 4 was verified in cells, with wild-type Cas-sf6728 protein (SEQ ID No. 1) used as a control. The editing efficiency was tested after transforming cells with the target site cagcctagctcaggagaagt on the TTR gene.

[0360] The vector pcDNA3.3 was modified to carry EGFP fluorescent protein. The SV40NLS-Cas fusion protein was inserted via XbaI and PstI restriction sites; the U6 promoter and gRNA sequence were inserted via Mfe1 restriction site. The CMV promoter initiated the expression of the SV40NLS-Cas-XX-NLS-GFP fusion protein. The Cas-XX-NLS and GFP proteins were linked using the linker peptide T2A. Plating: Cells were plated when confluence reached 70-80%, with a seeding density of 8*10^4 cells / well in 12-well plates. Transfection: Transfection was performed 24 hours after plating, adding 6.25 μl of Hieff Transfection reagent to 100 μl opti-MEM. TM Mix the liposome nucleic acid transfection reagent thoroughly; add 2.5 μg of plasmid to 100 μl of opti-MEM and mix well. The diluted Hieff Transfection reagent... TM The liposome nucleic acid transfection reagent was mixed thoroughly with the diluted plasmid and incubated at room temperature for 20 min. The incubated mixture was then added to cell-coated culture medium for transfection. 48 h after transfection, cells were digested with trypsin-EDTA (0.05%) and sorted using flow cytometry (FACS) for GFP signaling.

[0361] DNA extraction, PCR amplification of the area near the editing region, and hiTOM sequencing: Cells were collected after trypsin digestion, and genomic DNA was extracted using a cell / tissue genomic DNA extraction kit (Biotech). Genomic DNA was amplified in the region near the target site. The target sequence was amplified using sequencing primers: TTR-NGS-F1CTATTCGcaggtttgcagtcagattgg, TTR-NGS-R1 ATCACGgtaggaatgggatgtcacag. The PCR products were then sequenced using hiTOM. Sequencing data was analyzed, and the editing efficiency of different Cas-sf6728 single mutant proteins at the target site was obtained, using the editing efficiency of wild-type Cas-sf6728 protein (SEQ ID No. 1) as a baseline (100%). Figure 2 As shown in the table below, the Cas-sf6728 single mutant protein with significantly improved editing efficiency was selected, and its editing efficiency was statistically analyzed.

[0362] Mutant protein name Editing efficiency (%) relative to wild type Cas-sf6728 protein T36W 260 D39L 330 L65R 425 S69R 255 A73R 200 V75R 280 A119R 485 T122R 808 N132R 624 S154R 241 A155R 166 Q156R 308 D157R 172 Q171R 242 E186R 349 L191R 586 T195R 549 E208R 887 T264R 731 S278R 392 A281R 268 D296R 236 H304R 194 Q342R 401 A344R 394

[0363] The results above indicate that amino acids at positions 36, 39, 65, 69, 73, 75, 119, 122, 132, 154, 155, 156, 157, 171, 186, 191, 195, 208, 264, 278, 281, 296, 304, 342, or 344 from the N-terminus of SEQ ID No. 1 are key sites for the Cas-sf6728 protein to exert its activity. Mutations at these amino acid sites can significantly improve the editing efficiency of the Cas-sf6728 protein.

[0364] Furthermore, the editing efficiency of the Cas-sf6728 combined mutant protein L65R-V75R was verified using the above method. The results showed that the editing efficiency of the Cas-sf6728 combined mutant protein L65R-V75R was about 7 times higher than that of the wild-type Cas-sf6728 protein.

[0365] Example 6. gRNA modification of Cas-sf6728 protein

[0366] The gRNA of the Cas-sf6728 protein includes tracrRNA and crRNA. tracrRNA can pair with the pairing region of crRNA to form a double strand; crRNA also includes a region that hybridizes to the target sequence (i.e., the target sequence of the nucleic acid). In this embodiment, the non-target sequence portion of the gRNA is modified. The non-target sequence of the wild-type gRNA of the Cas-sf6728 protein is shown in SEQ ID No. 5.

[0367] The secondary structure of the wild-type gRNA non-target sequence portion of the Cas-sf6728 protein was predicted using RNAfold2, such as... Figure 3 As shown in the table below, by analyzing its secondary structure characteristics, nucleotides at different positions were truncated or mutated, and the non-target sequence portion of the modified gRNA is shown in the table below.

[0368] The editing efficiency of an editing system composed of wild-type Cas-sf6728 protein and modified gRNA was detected using a fluorescent reporter system. A fluorescent reporter system suitable for validating the editing efficiency of the Cas-sf6728 editing system was constructed according to the literature (Yang, Yi, et al. "Highly efficient and rapid detection of the cleavage activity of Cas9 / gRNA via a fluorescent reporter." Applied biochemistry and biotechnology 180.4(2016):655-667.). The fluorescent reporter vector contained RFP and non-luminescent GFFP fluorescent proteins, while the Cas vector contained CFP fluorescent proteins. The GFFP sequence was selected... AAG The target site TTTAACAGTGGCCTTATTAA was used for testing. The underlined position represents the PAM sequence. After transfecting 293T cells for 48 hours, the editing efficiency was determined by flow cytometry sorting the ratio of GFP fluorescence in CFP and RFP. The editing efficiency of the editing system composed of wild-type Cas-sf6728 protein and modified gRNA is shown in the table below.

[0369]

[0370]

[0371]

[0372]

[0373]

[0374] Experimental results show that the modified gRNAs A1-A20 can significantly improve editing efficiency, especially A13 (mutated from A to G at position 126 and from U to C at position 141).

[0375] Subsequently, the modified gRNA sequences A1-A20 were combined to form a new gRNA sequence. The editing activity of the combined gRNA sequence with the wild-type Cas-sf6728 protein was tested in vivo using the method described in Example 5. The results are shown in the table below. The results indicate that the A3+A13 combined gRNA sequence showed the best effect, with an activity more than 5 times higher than that of the wild-type gRNA.

[0376]

[0377]

[0378] Furthermore, the wild-type Cas-sf6728 protein + wild-type gRNA sequence was detected using the method described in Example 5. Figure 4 The WT), Cas-sf6728 combinatorial mutant protein L65R-V75R+ wild-type gRNA sequence ( Figure 4 The L65RV75R and the Cas-sf6728 combined mutant protein L65R-V75R+ modified gRNA sequence (A3+A13) (in the L65RV75R) Figure 4 The editing efficiency of the editing system composed of L65R, V75R+tracrRNA was measured. Results are as follows: Figure 4 As shown, compared with the editing system consisting of wild-type Cas-sf6728 protein + wild-type gRNA sequence, the editing system consisting of Cas-sf6728 combined mutant protein L65R-V75R + wild-type gRNA sequence exhibited approximately 7-fold increased editing activity in vivo, while the editing system consisting of Cas-sf6728 combined mutant protein L65R-V75R + modified gRNA sequence (A3+A13) showed approximately 8-fold increased activity, with an in vivo editing efficiency of 33%. This indicates that mutation of the Cas-sf6728 protein and modification of gRNA can significantly improve the editing activity of the Cas-sf6728 editing system.

[0379] Although specific embodiments of the invention have been described in detail, those skilled in the art will understand that various modifications and variations can be made to the details based on all the published teachings, and all such changes are within the scope of protection of the invention. The entire scope of the invention is given by the appended claims and any equivalents thereof.

[0380]

Claims

1. A Cas protein, characterized in that, The Cas protein is any one of the following Cas proteins described in I-III: I. The amino acid sequence of the Cas protein is shown in SEQ ID No. 1; II. Compared with SEQ ID No. 1, the amino acid sequence of the Cas protein has a mutation at any of the following amino acid sites in the amino acid sequence shown in SEQ ID No. 1: position 36, position 39, position 65, position 69, position 73, position 75, position 119, position 122, position 132, position 154, position 155, position 156, position 157, position 171, position 186, position 191, position 195, position 208, position 264, position 278, position 281, position 296, position 304, position 342, ... 344th bit; the 36th bit mutates to W; the 39th bit mutates to L; the 65th, 69th, 73rd, 75th, 119th, 122nd, 132nd, 154th, 155th, 156th, 157th, 171st, 186th, 191st, 195th, 208th, 264th, 278th, 281st, 296th, 304th, 342nd, and 344th bits mutate to R; III. Compared with SEQ ID No. 1, the amino acid sequence of the Cas protein has mutations at amino acid positions 65 and 75 of the amino acid sequence shown in SEQ ID No. 1; the mutations at positions 65 and 75 are R.

2. A fusion protein comprising the Cas protein of claim 1 and other modified portions.

3. An isolated polynucleotide, characterized in that, The polynucleotide is a polynucleotide sequence encoding the Cas protein of claim 1, or a polynucleotide sequence encoding the fusion protein of claim 2.

4. A carrier, characterized in that, The vector comprises the polynucleotide of claim 3 and a regulatory element operatively linked thereto.

5. A gRNA, said gRNA comprising a targeting sequence and a non-targeting sequence, said non-targeting sequence comprising tracrRNA, crRNA, and a pairing region sequence of tracrRNA; The non-target sequence of the gRNA is shown in SEQ ID No. 5; Alternatively, the non-target sequence of the gRNA has a base mutation compared to SEQ ID No. 5, wherein the base mutation is selected from any one of the following (1)-(20); Alternatively, the non-target sequence of the gRNA has a base mutation compared to SEQ ID No. 5, wherein the base mutation is selected from the following combinations of (1) and (3), (1) and (13), (3) and (13), (5) and (6), (5) and (13), or (13) and (17): (1) Compared with SEQ ID No. 5, bases 1-12 are missing; (2) Compared with SEQ ID No. 5, bases 1-26 are missing; (3) Compared with SEQ ID No. 5, bases at positions 13-26 and 158-172 are missing; (4) Compared with SEQ ID No. 5, the A at position 29 is mutated to C, and the U at position 155 is mutated to G; (5) Compared with SEQ ID No. 5, the U at position 31 is mutated to C, and the A at position 154 is mutated to G; (6) Compared with SEQ ID No. 5, add U between the 155th U and the 156th G; (7) Compared with SEQ ID No. 5, the A at position 29 is mutated to C, the U at position 31 is mutated to C, the A at position 154 is mutated to G, and the U at position 155 is mutated to G; (8) Compared with SEQ ID No. 5, the A at position 74 is mutated to C, and the U at position 88 is mutated to G; (9) Compared with SEQ ID No. 5, the U at position 100 is mutated to C, and the A at position 119 is mutated to G; (10) Compared with SEQ ID No. 5, the U at position 105 is mutated to C, and the A at position 114 is mutated to G; (11) Compared with SEQ ID No. 5, the U at position 100 is mutated to C, the U at position 105 is mutated to C, the A at position 114 is mutated to G, and the A at position 119 is mutated to G; (12) Compared with SEQ ID No. 5, the U at position 124 is mutated to G, and the A at position 143 is mutated to C; (13) Compared with SEQ ID No. 5, A at position 126 is mutated to G and U at position 141 is mutated to C; (14) Compared with SEQ ID No. 5, add U between G in position 127 and G in position 128; (15) Compared with SEQ ID No. 5, the U at position 124 is mutated to G, the A at position 126 is mutated to G, the U at position 141 is mutated to C, and the A at position 143 is mutated to C; (16) Compared with SEQ ID No. 5, bases 198-201 are missing; (17) Compared with SEQ ID No. 5, bases 192-200 are missing; (18) Compared with SEQ ID No. 5, bases 205-209 are missing; (19) Compared with SEQ ID No. 5, bases 205-217 are missing; (20) Compared with SEQ ID No. 5, bases 205-222 are missing.

6. A CRISPR-Cas system, characterized in that, The system includes the Cas protein of claim 1 and a gRNA capable of binding to the Cas protein, the gRNA including a region for binding to the Cas protein and a targeting sequence for the target nucleic acid.

7. The CRISPR-Cas system according to claim 6, characterized in that, The gRNA is the gRNA described in claim 5.

8. A composition, characterized in that, The composition comprises: (i) A protein component selected from: the Cas protein of claim 1 or the fusion protein of claim 2; (ii) A nucleic acid component selected from: gRNA, or nucleic acid encoding said gRNA, or precursor RNA of said gRNA, or precursor RNA nucleic acid encoding said gRNA, said gRNA including a region that binds to the Cas protein of claim 1 and a targeting sequence of the targeting nucleic acid; The protein components and nucleic acid components combine to form a complex.

9. The composition according to claim 8, characterized in that, The gRNA is the gRNA described in claim 5.

10. An engineered host cell, wherein the host cell is a non-animal or non-plant cell, characterized in that, The host cell comprises the Cas protein of claim 1, or the fusion protein of claim 2, or the polynucleotide of claim 3, or the vector of claim 4, or the gRNA of claim 5, or the CRISPR-Cas system of any one of claims 6-7, or the composition of any one of claims 8-9.

11. The Cas protein of claim 1, or the fusion protein of claim 2, or the polynucleotide of claim 3, or the vector of claim 4, or the gRNA of claim 5, or the CRISPR-Cas system of any one of claims 6-7, or the composition of any one of claims 8-9, or the application of the host cell of claim 10 in gene editing and nucleic acid detection, wherein the application is for purposes other than disease diagnosis and treatment; Alternatively, in the preparation of formulations or kits for use in: gene editing, nucleic acid detection.

12. A method for editing, targeting, or cleaving a target nucleic acid, the method being a method for non-disease diagnosis and treatment purposes, the method comprising contacting the target nucleic acid with the Cas protein of claim 1, or the fusion protein of claim 2, or the polynucleotide of claim 3, or the vector of claim 4, or the gRNA of claim 5, or the CRISPR-Cas system of any one of claims 6-7, or the composition of any one of claims 8-9, or the host cell of claim 10.

Citation Information

Patent Citations

  • Mutated Cas protein and application thereof

    CN116286739A

  • Cas enzyme and application thereof

    CN116716277A