Repairing and moisturizing cosmetic based on recombinant type IV collagen and preparation method of repairing and moisturizing cosmetic

Abstract

The invention relates to the technical field of cosmetics, and particularly discloses a repairing and moisturizing cosmetic based on recombinant type IV collagen and a preparation method of the repairing and moisturizing cosmetic based on recombinant type IV collagen, and the repairing and moisturizing cosmetic comprises the following raw materials in parts by weight: 5-10 parts of recombinant type IV collagen; 3-6 parts of small molecular sodium hyaluronate; 1-3 parts of middle molecular sodium hyaluronate; 6 to 12 parts of glycerin; 4 to 8 parts of squalane; 1.5 to 3.5 parts of allantoin; 0.8 to 2 parts of vitamin E; 3 to 5 parts of cetostearyl alcohol; 3.5 to 6 parts of polydimethylsiloxane; 0.4 to 0.8 part of phenoxyethanol; 2 to 4 parts of phytosterol oleate; 3 to 6 parts of trehalose; according to the present invention, the recombinant type 4 collagen produced through the gene engineering technology can easily penetrate through the skin barrier, can be efficiently absorbed and utilized by skin cells, can provide deeper nourishing and repairing for the skin, can promote the regeneration and the repairing of the skin cells, and can enhance the skin barrier function. The skin can be moisturized durably and deeply, the problems of skin dryness, water shortage, fine wrinkles, looseness and the like are effectively improved, and the health state of the skin is improved.

Description

Technical Field

[0001] The present invention belongs to the technical field of cosmetics, and in particular relates to a repairing and moisturizing cosmetic based on recombinant type IV collagen and a preparation method thereof. Background Art

[0002] Collagen is the main structural component of the skin and plays a vital role in maintaining the elasticity and firmness of the skin. However, due to its large molecular weight, traditional collagen has a low skin absorption rate and may have allergic risks, which limits its widespread application in cosmetics. In recent years, the emergence of recombinant collagen technology has brought new breakthroughs to the cosmetics industry. Recombinant collagen is produced through genetic engineering technology and has the advantages of controllable molecular weight, high purity, and good biocompatibility. It can be more effectively absorbed and utilized by the skin to play a repair and moisturizing role.

[0003] However, with the accelerated pace of modern life and the intensification of environmental pollution, people's skin is facing more and more challenges, such as dryness, dehydration, fine lines, sagging and sensitivity, which are becoming increasingly serious. These problems not only affect the appearance of the skin, but may also damage the skin barrier function, which in turn causes more skin problems. Most of the cosmetics commonly used in the market currently use traditional collagen, which may carry potential allergens and increase the risk of skin allergies. This has largely limited its wide application in the field of cosmetics, and many products only temporarily improve the surface symptoms of skin problems, but fail to fundamentally solve the fundamental problems such as damaged skin barrier function and collagen loss.

[0004] Therefore, this patent proposes a repairing and moisturizing cosmetic based on recombinant type IV collagen, which has solved the limitations and safety issues in the current traditional collagen applications, as well as the problem of cosmetics improving skin elasticity and firmness and enhancing skin barrier function. Summary of the invention

[0005] The object of the present invention is to provide a repairing and moisturizing cosmetic based on recombinant type IV collagen and a preparation method thereof, so as to solve the problems raised in the above background technology.

[0006] To achieve the above purpose, the present invention provides the following technical solutions

[0007] A repairing and moisturizing cosmetic based on recombinant type IV collagen, comprising 5-10 parts of recombinant type IV collagen, 3-6 parts of small molecule sodium hyaluronate, 1-3 parts of medium molecule sodium hyaluronate, 6-12 parts of glycerin, 4-8 parts of squalane, 1.5-3.5 parts of allantoin, 0.8-2 parts of vitamin E, 3-5 parts of cetearyl alcohol, 3.5-6 parts of polydimethylsiloxane, 0.4-0.8 parts of phenoxyethanol, 2-4 parts of phytosteryl oleate, 3-6 parts of trehalose, 0.5-1.5 parts of AKG, and 0.3-0.8 parts of ergothioneine; and deionized water is added to 100 parts.

[0008] Preferably, the raw materials include the following parts by weight: 8 parts of recombinant type IV collagen; 5 parts of small molecule sodium hyaluronate; 2 parts of medium molecule sodium hyaluronate; 10 parts of glycerin; 6 parts of squalane; 2.5 parts of allantoin; 1.5 parts of vitamin E; 4 parts of cetearyl alcohol; 5 parts of polydimethylsiloxane; 0.6 parts of phenoxyethanol; 3 parts of phytosteryl oleate; 5 parts of trehalose; 0.5 parts of AKG; 0.5 parts of ergothioneine, and deionized water is added to 100 parts.

[0009] Preferably, the small molecule sodium hyaluronate has a molecular weight of less than 100 kDa, and the medium molecule sodium hyaluronate has a molecular weight of 100 kDa-1500 kDa.

[0010] A method for preparing a repairing and moisturizing cosmetic based on recombinant type IV collagen comprises the following steps:

[0011] S1. Raw material processing:

[0012] Take 8 parts of recombinant type IV collagen, 2.5 parts of allantoin, and 5 parts of trehalose, respectively, slowly add them into 30 parts of deionized water, and stir them at 200 rpm with a magnetic stirrer for 10 minutes until they are completely pre-dispersed and set aside;

[0013] S2, aqueous phase preparation:

[0014] Add the remaining deionized water to the water phase pot, turn on the stirrer, set the stirring speed to 400 rpm, and heat to 72°C by steam; add the pre-dispersed allantoin solution, 5 parts of small molecule sodium hyaluronate, and 2 parts of medium molecule sodium hyaluronate in sequence while stirring, keep the stirring speed unchanged, and stir for 12 minutes to form a transparent water phase;

[0015] S3, oil phase preparation:

[0016] Add 4 parts of cetearyl alcohol, 5 parts of dimethicone, 6 parts of squalane, and 3 parts of phytosteryl oleate into the oil phase pot, turn on the stirrer, set the stirring speed to 300 rpm, and heat to 72°C with steam, stir for 8 minutes to form a uniform oil phase;

[0017] S4, emulsification process:

[0018] Slowly pour the oil phase into the water phase, turn on the homogenizer for homogenization and emulsification, the homogenization speed is 4000 rpm, and the emulsification time is 18 minutes. During the homogenization process, pause the homogenizer every 2 minutes, dip a small amount of emulsion with a glass rod, and observe whether there are obvious oil droplets or particles on a white background. If there are, continue homogenizing until a uniform and delicate emulsion is formed;

[0019] S5. Cooling and adding active ingredients:

[0020] After emulsification is completed, stop heating, start cooling water circulation, and reduce the emulsion temperature to 42°C within 15 minutes; under stirring, add the pre-dispersed recombinant type IV collagen solution, 1.5 parts of tocopherol, 0.6 parts of phenoxyethanol, 10 parts of glycerol, 0.5 parts of AKG, and 0.5 parts of ergothioneine in sequence at a stirring speed of 250 rpm, and continue stirring for 12 minutes to ensure that the ingredients are evenly dispersed in the emulsion;

[0021] S6, Discharging and Packaging:

[0022] After stirring evenly, use a special pH meter, viscometer, etc. to conduct quality inspection. The pH value is between 5.5-6.5, the viscosity is between 5000-8000mPa·s, and a Brookfield viscometer is used. The rotor model is LV-4, the speed is 60 rpm, the temperature is 25°C, and the appearance is a uniform, fine, odorless, non-stratified milky white emulsion. These indicators meet the quality standards.

[0023] After passing the test, the product is naturally cooled to room temperature, transported through a pipeline to a packaging container that has been disinfected with ultraviolet light, and packaged according to the packaging specification of 50 ml per bottle.

[0024] Compared with the prior art, the present invention has the following beneficial effects:

[0025] The present invention is based on the repairing and moisturizing cosmetics of recombinant type IV collagen. The recombinant type IV collagen produced by genetic engineering technology realizes the precise regulation of molecular weight, making it easier to penetrate the skin barrier and be efficiently absorbed and utilized by skin cells, which greatly improves the actual utility of collagen in cosmetics and provides deeper nourishment and repair for the skin. At the same time, the recombinant type IV collagen has high purity and excellent biocompatibility, and almost does not contain any potential allergens, thereby significantly reducing the risk of skin allergies, making the cosmetics of the present invention more suitable for people with sensitive skin and broadening the scope of application of the product. And the recombinant type IV collagen in the inventive cosmetics can penetrate into the bottom layer of the skin, promote the regeneration and repair of skin cells, and enhance the skin barrier function. At the same time, the synergistic effect with other moisturizing ingredients allows the skin to be moisturized in a lasting and deep manner, effectively improving problems such as dry skin, dehydration, fine lines, and sagging, and improving the health of the skin.

[0026] At the same time, the present invention adds AKG and ergothioneine anti-aging ingredients, and has a more comprehensive mechanism of action in anti-aging. From the cell energy metabolism level (AKG) to the antioxidant protection level (ergothioneine), it cooperates with recombinant type IV collagen and other raw materials to fight skin aging in multiple dimensions, and can better promote collagen synthesis, enhance skin barrier, and reduce free radical damage, so that the skin is more compact, moist, and shiny, and achieves better effects in terms of repairing moisturizing and anti-aging, which greatly exceeds the anti-aging effect of moisturizing cosmetics formed by the single mixing of traditional ergothioneine and AKG. DETAILED DESCRIPTION

[0027] The following will be combined with the embodiments of the present invention to clearly and completely describe the technical solutions in the embodiments of the present invention. Obviously, the described embodiments are only part of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by ordinary technicians in this field without creative work are within the scope of protection of the present invention.

[0028] Embodiment 1:

[0029] A repairing and moisturizing cosmetic based on recombinant type IV collagen: Recombinant type IV collagen: 8g

[0030] Small molecule sodium hyaluronate (molecular weight less than 100kDa): 5g; medium molecule sodium hyaluronate (molecular weight 100kDa-1500kDa): 2g; glycerin: 10g; squalane: 6g; allantoin: 2.5g; tocopherol (vitamin E): 1.5g; cetearyl alcohol: 4g; polydimethylsiloxane: 5g; phenoxyethanol: 0.6g; phytosteryl oleate: 3g; trehalose: 5g; AKG 0.5g; ergothioneine: 0.5g; deionized water is added to 100 parts, deionized water: replenished to 100g.

[0031] Instrument preparation: water phase pot, oil phase pot (both equipped with heating and stirring devices), homogenizer, magnetic stirrer, steam generator, cooling water circulation device, pH meter (model: PHS-3C), viscometer (Brookfield viscometer, LV-4 rotor), ultraviolet disinfection lamp, aseptic filling equipment, 50ml packaging bottle (sterilized).

[0032] A preparation method of a repairing and moisturizing cosmetic based on recombinant type IV collagen:

[0033] 1. Raw material pretreatment

[0034] Check the appearance and smell of all raw materials, and verify the batch quality inspection report to confirm that there are no quality issues.

[0035] In three clean beakers, 8 g of recombinant type IV collagen, 2.5 g of allantoin, and 5 g of trehalose were placed respectively, and 10 g of deionized water was added to each beaker. The mixture was placed on a magnetic stirrer and stirred at 200 rpm for 10 minutes to obtain a pre-dispersed uniform solution for use.

[0036] 2. Preparation of aqueous phase

[0037] Add 64.5 g of deionized water into the water phase pot, turn on the stirrer, adjust to 400 rpm, and heat with a steam generator to raise the water temperature to 72° C. within 10 minutes.

[0038] Slowly add the pre-dispersed allantoin solution, and then add 5g of small molecule sodium hyaluronate and 2g of medium molecule sodium hyaluronate in sequence, keep stirring, and continue stirring for 12 minutes. Observe with the naked eye that the aqueous phase is uniform and transparent without undissolved particles.

[0039] 3. Oil phase preparation

[0040] Add 4g of cetearyl alcohol, 5g of polydimethylsiloxane, 6g of squalane, and 3g of phytosteryl oleate to the oil phase pot, turn on the agitator, set the stirring speed to 300 rpm, use steam heating to raise the temperature to 72°C in 7 minutes, and continue stirring for 1 minute to allow the oil-soluble ingredients to fully blend.

[0041] 4. Emulsification process

[0042] Slowly pour the oil phase into the water phase pot, turn on the homogenizer, set the homogenization speed to 4000 rpm, and start the emulsification timer. Pause the homogenizer every 2 minutes, dip a small amount of emulsion with a glass rod, and observe it under the light. If oil droplets or particles are found, continue homogenizing. Emulsify for a total of 18 minutes until the emulsion is uniform and fine.

[0043] 5. Cooling and adding active ingredients

[0044] After emulsification is completed, turn off the steam heating, turn on the cooling water circulation device, and let the emulsion cool down to 42°C within 15 minutes.

[0045] Adjust the stirring speed to 250 rpm, and add the pre-dispersed recombinant type IV collagen solution, 1.5 g tocopherol, 0.6 g phenoxyethanol, 10 g glycerol, 0.5 g AKG, and 0.5 g ergothioneine in sequence, and continue stirring for 12 minutes to ensure that the ingredients are evenly dispersed.

[0046] 6. Discharging and packaging

[0047] After stirring evenly, measure the pH value of the product with a pH meter, which should be between 5.5-6.5; measure the viscosity with a Brookfield viscometer (LV-4 rotor, 60 rpm, 25°C), which should be between 5000-8000 mPa·s; observe the appearance of a uniform, odorless, non-stratified milky white emulsion, and all indicators are qualified.

[0048] Allow the product to cool naturally to room temperature, start the aseptic filling equipment, fill the product into a 50ml bottle sterilized by ultraviolet light, and seal it to obtain the finished product.

[0049] The entire production process is carried out in a constant temperature and humidity workshop (temperature 22-26°C, relative humidity 40%-60%). Operators wear sterile work clothes, hats, masks and gloves, and follow the GMP standards for cosmetics production throughout the process to prevent contamination.

[0050] Embodiment 2:

[0051] A repairing and moisturizing cosmetic based on recombinant type IV collagen, comprising the following raw materials:

[0052] Recombinant type IV collagen: 6g; small molecule sodium hyaluronate (molecular weight less than 100kDa): 4g

[0053] Medium molecular weight sodium hyaluronate (molecular weight 100kDa-1500kDa): 1.5g; glycerin: 8g; squalane: 5g; allantoin: 2g; tocopherol (vitamin E): 1g; cetearyl alcohol: 3.5g; polydimethylsiloxane: 4g; phenoxyethanol: 0.5g; phytosteryl oleate: 2.5g; trehalose: 4g; AKG 0.5g; ergothioneine: 0.5g, deionized water: make up to 100g

[0054] Instruments and equipment:

[0055] Stainless steel reactor (with heating, stirring and temperature control functions, can be used as both water phase pot and oil phase pot)

[0056] High shear homogenizer, electronic balance, digital constant temperature water bath, desktop centrifuge (for rapid detection of emulsion stability), acidity meter (accuracy 0.01), rotational viscometer, ozone disinfection cabinet, automatic filling machine, 30ml packaging bottle (pre-ozone disinfection)

[0057] A preparation method of a repairing and moisturizing cosmetic based on recombinant type IV collagen:

[0058] 1. Raw material pretreatment

[0059] Weigh the raw materials one by one, use tools such as a magnifying glass to check whether there are impurities, discoloration and other abnormalities in the raw materials, and check the raw material qualification certification documents.

[0060] Take 6 g of recombinant type IV collagen, 2 g of allantoin, and 4 g of trehalose, place them in three clean plastic cups respectively, add 8 g of deionized water to each, use an electric stirring rod to stir at a speed of 180 rpm for 8 minutes to fully pre-disperse the raw materials, and set aside.

[0061] 2. Preparation of aqueous phase

[0062] 73.5 g of deionized water was added to the stainless steel reactor, the stirring function was turned on, the stirring speed was set to 350 rpm, and the temperature was raised to 73° C. within 12 minutes using the reactor's own heating device.

[0063] Add the pre-dispersed allantoin solution, 4g of small molecule sodium hyaluronate, and 1.5g of medium molecule sodium hyaluronate in sequence, maintain the stirring speed, and continue stirring for 13 minutes. During this period, observe the aqueous phase until the solution is clear and transparent with no visible insoluble matter.

[0064] 3. Oil phase preparation

[0065] Put 3.5g of cetearyl alcohol, 4g of polydimethylsiloxane, 5g of squalane and 2.5g of phytosteryl oleate into a stainless steel reactor, start stirring, set the stirring rate to 250 rpm, turn on heating, and heat to 73°C in 9 minutes. Continue stirring for 3 minutes to ensure uniform mixing of the oil phase components.

[0066] 4. Emulsification process

[0067] Turn on the high shear homogenizer, slowly inject the oil phase into the water phase, set the homogenizer speed to 3500 rpm, and emulsify for 16 minutes. During the emulsification period, take 5 ml of the emulsion sample every 3 minutes and place it in a desktop centrifuge, centrifuge at 3000 rpm for 3 minutes. If there is no obvious oil layer or precipitation at the bottom of the centrifuge tube, the emulsification is considered qualified.

[0068] 5. Cooling and adding active ingredients

[0069] After emulsification was completed, the heating device was turned off and the cooling water circulation of the reactor was turned on to allow the system temperature to drop to 43°C within 18 minutes.

[0070] Adjust the stirring speed to 220 rpm, and add the pre-dispersed recombinant type IV collagen solution, 1 g tocopherol, 0.5 g phenoxyethanol, 8 g glycerin, 0.5 g AKG, and 0.5 g ergothioneine in sequence, and then stir for 13 minutes to ensure that all ingredients are evenly dispersed and blended.

[0071] 6. Discharging and packaging

[0072] Use an acidity meter to test the pH value of the emulsion, which must be in the range of 5.2-6.2; use a rotational viscometer to measure the viscosity, with a target value of 4000-7000mPa·s; observe with the naked eye that the emulsion should have a uniform texture, uniform color, no odor, and no stratification. It is considered qualified only when all indicators meet the standards.

[0073] The qualified emulsion is naturally cooled to room temperature, and filled into 30ml packaging bottles treated with ozone disinfection cabinet by automatic filling machine. After the packaging process is completed, the finished product can be stored in the warehouse.

[0074] The entire production process is carried out in an environmentally controlled workshop with the temperature maintained at 23-25°C and the relative humidity controlled at 45%-55%. Operators strictly follow aseptic operating procedures, wear clean protective clothing, masks, hats and gloves to ensure product quality.

[0075] Embodiment three:

[0076] A repairing and moisturizing cosmetic based on recombinant type IV collagen:

[0077] Raw material preparation: recombinant type IV collagen: 10g; small molecule sodium hyaluronate (molecular weight less than 100kDa): 6g; medium molecule sodium hyaluronate (molecular weight 100kDa-1500kDa): 3g; glycerin: 12g; squalane: 8g; allantoin: 3.5g; tocopherol (vitamin E): 2g; cetearyl alcohol: 5g; polydimethylsiloxane: 6g; phenoxyethanol: 0.8g; phytosteryl oleate: 4g; trehalose: 6g; AKG 0.6g; ergothioneine: 0.8g, deionized water: make up to 100g

[0078] Instruments and Equipment

[0079] Glass water phase kettle and oil phase kettle, equipped with accurate thermometer and speed regulating stirrer

[0080] Laboratory high-pressure homogenizer, precision electronic balance (accuracy 0.001g), electric constant temperature water bath

[0081] Laser particle size analyzer (for detecting emulsion particle size), acidity meter (model: Mettler-Toledo FE28), capillary viscometer, UV sterilization tunnel (for packaging bottle sterilization), semi-automatic filling equipment.

[0082] A preparation method of a repairing and moisturizing cosmetic based on recombinant type IV collagen:

[0083] 1. Raw material pretreatment

[0084] Use a precision electronic balance to accurately weigh each raw material, place it on a white tray, and use a strong flashlight to check whether the raw materials contain foreign matter, lumps, etc., and check the quality inspection report of the raw materials at the same time.

[0085] Take 10 g of recombinant type IV collagen, 3.5 g of allantoin, and 6 g of trehalose respectively, place them in a clean glass beaker, add 15 g of deionized water to each, and stir them on a magnetic stirrer at 220 rpm for 12 minutes to obtain a uniform pre-dispersion liquid for use.

[0086] 2. Preparation of Aqueous Phase

[0087] Pour an appropriate amount of deionized water into the aqueous phase kettle to make the total amount reach 100 g, turn on the stirrer, adjust the speed to 500 rpm, heat it in an electric constant temperature water bath, and raise the water temperature to 75°C within 15 minutes.

[0088] Carefully pour in the pre-dispersed allantoin solution, then add 6g of small molecule sodium hyaluronate and 3g of medium molecule sodium hyaluronate, keep stirring, and continue stirring for 15 minutes until the water phase is clear and free of impurities, and all ingredients are completely dissolved.

[0089] 3. Oil Phase Preparation

[0090] Put 5g of cetearyl alcohol, 6g of polydimethylsiloxane, 8g of squalane, and 4g of phytosteryl oleate into the oil phase kettle, turn on the agitator, set the stirring speed to 200 rpm, heat it in the same constant temperature water bath, raise the temperature to 75°C in 8 minutes, and then stir for 5 minutes to ensure that the oil phase is fully mixed.

[0091] 4. Emulsification process

[0092] Slowly pour the oil phase into the water phase kettle, turn on the laboratory high-pressure homogenizer, set the homogenization pressure to 80MPa, and homogenize for 20 minutes. During this period, use a laser particle size analyzer to detect the emulsion particle size every 5 minutes, and the average particle size is required to be less than 500nm to ensure that the emulsion is fine and uniform.

[0093] Cooling and adding active ingredients

[0094] After homogenization, remove the constant temperature water bath, place the water phase kettle in a cold water bath, and lower the emulsion temperature to 45°C within 20 minutes.

[0095] Adjust the stirring speed to 300 rpm, and add the pre-dispersed recombinant type IV collagen solution, 2 g tocopherol, 0.8 g phenoxyethanol, 12 g glycerol, 0.6 g AKG, and 0.8 g ergothioneine in sequence, and continue stirring for 15 minutes to ensure that the ingredients are evenly dispersed.

[0096] 5. Discharging and packaging

[0097] Use an acidometer to measure the pH value of the emulsion, which should be between 5.8-6.8; use a capillary viscometer to measure the viscosity, which should be between 6000-9000mPa·s; observe the appearance of the emulsion, which should be uniform, without precipitation and odor. After passing the test, let the emulsion cool naturally to room temperature.

[0098] The packaging bottles are placed in a UV sterilization tunnel for 30 minutes, and then the emulsion is filled into the packaging bottles using semi-automatic filling equipment to seal the product.

[0099] The entire production workshop maintains a temperature of 24-26°C and a relative humidity of 50%-60%. Operators wear sterile work clothes, hoods, masks and gloves, and follow cosmetic production standards to prevent microbial contamination.

[0100] The recombinant type IV collagen of the present invention is specifically a recombinant plasmid construct based on pET-30b(+) plasmid, comprising a 1041bp gene fragment, which is inserted between the NdeI and H i nd III restriction sites and carries kanamycin resistance. The gene fragment encodes a protein composed of multiple repeated amino acid sequence units, the expected molecular weight of the protein encoded by the gene fragment is 34316.84, the theoretical isoelectric point of the protein encoded by the gene fragment is 9.65, and the nucleic acid sequence inserted in the plasmid, the amino acid sequence encoded by the nucleic acid sequence is a repetitive pattern, which is multiple

[0101] A series connection of the "GEFYFDLRLKGDKGVKGDKGNPGWPGAPGVPGPKGDPGFQGMPGIGGS" unit.

[0102] It will be appreciated that in the development of any actual implementation, as in any engineering or design project, numerous implementation-specific decisions may be made. Such a development effort may be complex and time-consuming, but will be a routine task of design, fabrication, and production for those of ordinary skill having the benefit of this disclosure without undue experimentation.

[0103] It should be noted that the above embodiments are only used to illustrate the technical solutions of the present invention rather than to limit it. Although the present invention has been described in detail with reference to the preferred embodiments, those skilled in the art should understand that the technical solutions of the present invention may be modified or replaced by equivalents without departing from the spirit and scope of the technical solutions of the present invention, which should all be included in the scope of the claims of the present invention.

Claims

1. A repairing and moisturizing cosmetic based on recombinant type IV collagen, characterized in that: The invention comprises the following raw materials in parts by weight: 5-10 parts of recombinant type IV collagen; 3-6 parts of low-molecule sodium hyaluronate; 1-3 parts of medium-molecule sodium hyaluronate; 6-12 parts of glycerin; 4-8 parts of squalane; 1.5-3.5 parts of allantoin; 0.8-2 parts of vitamin E; 3-5 parts of cetearyl alcohol; 3.5-6 parts of polydimethylsiloxane; 0.4-0.8 parts of phenoxyethanol; 2-4 parts of phytosteryl oleate; 3-6 parts of trehalose; 0.5-1.5 parts of AKG; 0.3-0.8 parts of ergothioneine; add deionized water to 100 parts.

2. A repairing and moisturizing cosmetic based on recombinant type IV collagen according to claim 1, characterized in that: The invention comprises the following raw materials in parts by weight: 8 parts of recombinant type IV collagen; 5 parts of low-molecule sodium hyaluronate; 2 parts of medium-molecule sodium hyaluronate; 10 parts of glycerin; 6 parts of squalane; 2.5 parts of allantoin; 1.5 parts of vitamin E; 4 parts of cetearyl alcohol; 5 parts of polydimethylsiloxane; 0.6 parts of phenoxyethanol; 3 parts of phytosteryl oleate; 5 parts of trehalose; 0.5 parts of AKG; 0.5 parts of ergothioneine, add deionized water to 100 parts.

3. A repairing and moisturizing cosmetic based on recombinant type IV collagen according to claim 1, characterized in that: The small molecule sodium hyaluronate has a molecular weight of less than 100 kDa, and the medium molecule sodium hyaluronate has a molecular weight of 100 kDa-1500 kDa.

4. The method for preparing a repairing and moisturizing cosmetic based on recombinant type IV collagen according to claim 1, characterized in that: The following steps are involved: S1. Raw material processing: Take 8 parts of recombinant type IV collagen, 2.5 parts of allantoin, and 5 parts of trehalose, respectively, slowly add them into 30 parts of deionized water, use a magnetic stirrer to stir at 200 rpm for 10 minutes, and set aside; S2, aqueous phase preparation: Add the remaining deionized water to the water phase pot, turn on the stirrer, set the stirring speed to 400 rpm, and heat to 72°C by steam; add the pre-dispersed allantoin solution, 5 parts of small molecule sodium hyaluronate, and 2 parts of medium molecule sodium hyaluronate in sequence while stirring, keep the stirring speed unchanged, and stir for 12 minutes to form a transparent water phase; S3, oil phase preparation: Add 4 parts of cetearyl alcohol, 5 parts of dimethicone, 6 parts of squalane, and 3 parts of phytosteryl oleate into the oil phase pot, turn on the stirrer, set the stirring speed to 300 rpm, and heat to 72°C with steam, stir for 8 minutes to form a uniform oil phase; S4, emulsification process: Slowly pour the oil phase into the water phase, turn on the homogenizer for homogenization and emulsification, the homogenization speed is 4000 rpm, the emulsification time is 18 minutes, and during the homogenization process, the homogenizer is paused every 2 minutes until an emulsion is formed; S5. Cooling and adding active ingredients: After emulsification is completed, stop heating, start cooling water circulation, and reduce the emulsion temperature to 42°C within 15 minutes; under stirring, add the pre-dispersed recombinant type IV collagen solution, 1.5 parts of tocopherol, 0.6 parts of phenoxyethanol, 10 parts of glycerol, 0.5 parts of AKG, and 0.5 parts of ergothioneine in sequence at a stirring speed of 250 rpm, and continue stirring for 12 minutes; S6, Discharging and Packaging: After stirring evenly, use a special pH meter, viscometer, etc. to conduct quality inspection. The pH value is between 5.5-6.5, the viscosity is between 5000-8000mPa·s, and the Brookfield viscometer is used. The rotor model is LV-4, the speed is 60 rpm, and the temperature is 25°C. The appearance is a delicate, odorless, non-stratified milky white emulsion. After passing the inspection, the product is naturally cooled to room temperature, transported through a pipeline to a packaging container that has been disinfected with ultraviolet rays, and packaged according to the packaging specification of 50 ml per bottle.