Application of soybean GmWRKY75 gene in improvement of soybean agronomic traits

By cloning and overexpressing the soybean GmWRKY75 gene, the problem that traditional breeding methods are difficult to regulate soybean agronomic traits is solved, and the soybean plant height, number of main stem nodes, number of pods and yield of single plants has been significantly improved, and the yield of soybeans has been improved.

CN120193016AActive Publication Date: 2025-06-24XIANGHU LABORATORY +1

Patent Information

Application Number
CN202510686474.4
Authority / Receiving Office
CN · China
Patent Type
Applications(China)
Current Assignee / Owner
Filing Date
2025-05-27
Publication Date
2025-06-24
Estimated Expiration
2045-05-27

AI Technical Summary

Technical Problem

Traditional breeding methods are difficult to effectively regulate the plant height, number of main stem nodes, number of single grains and single plant yield of soybeans, limiting the yield potential and adaptability of soybeans.

Method used

By cloning and overexpressing the soybean GmWRKY75 gene, its ability to regulate downstream gene expression is used to increase the plant height, number of main stem nodes, number of pods and yield of single plants.

Benefits of technology

The plant height, number of main stem nodes, number of pods, number of single plants, number of grains and yield of single plants were significantly increased, and the yield and agronomic traits of soybeans were improved.

✦ Generated by Eureka AI based on patent content.

Smart Images

  • Figure CN120193016A_ABST
    Figure CN120193016A_ABST
Patent Text Reader

Abstract

The invention relates to an application of a soybean GmWRKY75 gene in improvement of agronomic characters of soybeans. In particular, the invention relates to application of the soybean GmWRKY75 gene in increasing the yield or the grain number of a single soybean plant and / or in soybean plant type improvement genetic breeding. The recombinant vector and the genetic engineering strain containing the soybean GmWRKY75 gene are applied to increase of single-plant yield or single-plant grain number of soybeans and / or soybean plant type improvement genetic breeding. And a method for increasing the yield of a soybean single plant or the grain number of the single plant and / or soybean plant type improvement genetic breeding by overexpressing the soybean GmWRKY75 gene and the like. Through cloning of the soybean GmWRKY75 gene and discovery of a new function, a new gene target and a new resource are provided for soybean plant type improvement genetic breeding.
Need to check novelty before this filing date? Find Prior Art

Description

Technical Field

[0001] The present invention belongs to the field of genetic engineering, and specifically relates to the application of the soybean GmWRKY75 gene in improving soybean agronomic traits, especially the application of the soybean WRKY75 gene in regulating soybean plant height, main stem node number, grain number per plant and yield per plant. Background Art

[0002] Soybean ( Glycine max ) As an important oil and protein crop in the world, improving its yield and plant type is the core goal of breeding research. Traits such as plant height, number of main stem nodes and single plant yield directly affect soybean's density tolerance, lodging resistance and light energy utilization, which in turn determine its adaptability and yield potential. For example, excessive plant height can easily lead to lodging, limiting the potential for dense planting; and although increasing the number of main stem nodes may increase the number of pods, it is necessary to balance the allocation of resources for nutrition and reproductive growth. Traditional breeding methods rely on phenotypic selection and are less efficient, while molecular design breeding can accelerate the process of plant type improvement by targeting and regulating key genes. Therefore, exploring the key transcription factors that regulate plant type and yield and analyzing their molecular mechanisms have become important directions in soybean breeding.

[0003] WRKY transcription factors are a family of regulatory factors unique to plants. Their core structure consists of a conserved WRKYGQK motif at the N-terminus and a zinc finger structure at the C-terminus. They can specifically bind to the W-box element (TTGAC(C / T)) in the promoter of the target gene, thereby regulating the expression of downstream genes. Studies have shown that the WRKY family is widely involved in plant stress resistance (such as disease resistance, drought tolerance, and low-phosphorus tolerance) and developmental regulation (such as senescence and secondary metabolism). For example, OsWRKY45 in rice enhances disease resistance through the salicylic acid signaling pathway; soybean GmWRKY6 and GmERF1 synergistically regulate root development and phosphorus absorption efficiency under low-phosphorus stress, indirectly affecting plant biomass. During plant growth, WRKY transcription factors not only participate in stress resistance responses, but also affect the final plant type by regulating traits such as branching and plant height. In terms of regulating branching, Arabidopsis AtWRKY71 / EXB1 can regulate plant growth through positive regulation. RAX1 In terms of regulating plant height, rice OsWRKY36 can increase the number of branches by controlling the initiation of axillary meristem (AM) and the growth of new shoots. SLR1 In addition, some WRKY transcription factors can also mediate plant dwarfing by reducing the production of BR (brassinosteroids) or inhibiting the expression of a series of genes involved in cell elongation.

[0004] These studies suggest that WRKY transcription factors play an important role in regulating plant architecture, but their specific functions in soybean and their regulatory mechanisms on plant height, main stem node number, and yield per plant require further investigation. Elucidating the functions of WRKY transcription factors in soybean could provide new molecular breeding strategies for improving soybean plant architecture and increasing yield. Summary of the Invention

[0005] To address the technical problems described in the background art, the present invention provides a method for using the soybean GmWRKY75 gene to improve soybean agronomic traits. Specifically, the present invention provides a method for using the soybean GmWRKY75 gene to increase yield per plant or number of grains per plant, and / or in genetic breeding for improving soybean plant architecture (e.g., increasing soybean plant height and / or number of main stem nodes).

[0006] In one aspect, the present invention provides an application of the soybean GmWRKY75 gene for increasing soybean yield per plant or number of grains per plant and / or in genetic breeding for improving soybean plant type, characterized in that the soybean GmWRKY75 gene is overexpressed, wherein the soybean GmWRKY75 gene encodes the amino acid sequence shown in SEQ ID NO: 2, and the plant type is improved by increasing the number of main stem nodes and / or increasing plant height.

[0007] In another aspect, the present invention provides an application of a recombinant vector containing the soybean GmWRKY75 gene for increasing soybean yield per plant or number of grains per plant and / or in genetic breeding for improving soybean plant type, characterized in that the soybean GmWRKY75 gene is overexpressed in a soybean plant, the soybean GmWRKY75 gene encodes the amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of main stem nodes and / or an increase in plant height.

[0008] In another aspect, the present invention provides an application of a genetically engineered bacterium for increasing soybean yield per plant or number of grains per plant and / or in genetic breeding for improving soybean plant type, characterized in that the genetically engineered bacterium comprises a recombinant vector containing the soybean GmWRKY75 gene, overexpresses the soybean GmWRKY75 gene, and the soybean GmWRKY75 gene encodes the amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of main stem nodes and / or an increase in plant height.

[0009] In another aspect, the present invention provides a method for increasing soybean yield per plant or number of grains per plant and / or improving soybean plant type through genetic breeding, characterized in that the method comprises: overexpressing the soybean GmWRKY75 gene, wherein the soybean GmWRKY75 gene encodes the amino acid sequence shown in SEQ ID NO: 2, and the plant type is improved by increasing the number of main stem nodes and / or increasing plant height.

[0010] In another aspect, the present invention provides a method for obtaining soybean plants with improved agronomic traits, characterized in that it comprises the following steps: (1) using genetically engineered bacteria to infect soybean cotyledonary nodes; and (2) Cultivating the infected callus into soybean plants; The genetically engineered bacteria comprises a recombinant vector containing the soybean GmWRKY75 gene, overexpressing the soybean GmWRKY75 gene, wherein the soybean GmWRKY75 gene encodes the amino acid sequence shown in SEQ ID NO: 2, and the improved agronomic traits are increased soybean yield per plant, number of grains per plant, number of main stem nodes and / or plant height.

[0011] In one aspect, the genetically engineered bacteria of the present invention infect the cotyledonary nodes of germinated soybean seeds.

[0012] In another aspect, the present invention provides the use of soybean GmWRKY75 transcription factor in increasing soybean yield per plant or number of grains per plant and / or in genetic breeding for improving soybean plant type. The amino acid sequence of the soybean GmWRKY75 transcription factor is shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of main stem nodes and / or an increase in plant height.

[0013] Preferably, the coding sequence of the soybean GmWRKY75 gene of the present invention is shown in SEQ ID NO: 1.

[0014] Preferably, the vector of the present invention is a pBA002-3xFlag vector.

[0015] Preferably, the genetically engineered bacteria of the present invention is Agrobacterium. More preferably, the genetically engineered bacteria of the present invention is Agrobacterium EHA105.

[0016] The advantages of the present invention lie in cloning the soybean GmWRKY75 gene, which is involved in regulating soybean plant height, number of main stem nodes, number of pods per plant, yield per plant, and / or number of grains per plant, in soybeans. Overexpression of the GmWRKY75 gene in soybeans resulted in significant increases in plant height, number of main stem nodes, number of pods per plant, yield per plant, and number of grains per plant compared to wild-type plants. The cloning of the soybean GmWRKY75 gene and the discovery of its novel function provide new gene targets and resources for genetic breeding to increase soybean yield and improve plant architecture. BRIEF DESCRIPTION OF THE DRAWINGS

[0017] Figure 1 Schematic diagram of the construction of soybean GmWRKY75 overexpression vector.

[0018] Figure 2The expression levels of the GmWRKY75 gene in mature plants and seedlings of the wild type (W82) and GmWRKY75 overexpression lines (OE1, OE2, and OE3) are shown.

[0019] Figure 3 To identify the phenotypes of plant height, number of main stem nodes, number of pods per plant, number of grains per plant and yield per plant of the wild type (W82) and GmWRKY75 overexpression lines (OE1, OE2, OE3). DETAILED DESCRIPTION

[0020] The following examples are provided to facilitate a better understanding of the present invention, but are not intended to limit the present invention. The experimental methods in the following examples, unless otherwise specified, are conventional methods. The test materials used in the following examples, unless otherwise specified, were purchased from conventional biochemical reagent manufacturers.

[0021] Example 1. Construction of recombinant plasmid Using Primer1 (SEQ ID NO: 3) and Primer2 (SEQ ID NO: 4) as primers and wild-type soybean Williams 82 (hereinafter referred to as W82) root cDNA as template, PCR amplification was performed to obtain the coding sequence (CDS) fragment of the target gene GmWRKY75 (excluding the stop codon). The following primers were designed: Primer1: 5'-GAGAACACGGGGGACTCTAGATTGGTGTTGGGTTGATTTCG-3' (SEQ ID NO: 3); Primer2: 5'-ATCTTTGTAATCCATCTCGAGGCAGAAGGGAGTGTATATTTGCATCT-3' (SEQ ID NO: 4).

[0022] PCR amplification was performed in a Bio-Rad T100 thermal cycler. The reaction system (50 μL) consisted of 25 μL of 2× Hieff CanacePlus PCR Master Mix, 2 μL of Primer 1 (10 μM), 2 μL of Primer 2 (10 μM), 1 μL of template cDNA (200 ng / μL), and 20 μL of ddH2O. The protocol was as follows: initial denaturation at 98°C for 3 min; 35 cycles of denaturation at 98°C for 10 s, annealing at 60°C for 20 s, and extension at 72°C for 30 s; extension at 72°C for 5 min; and storage at 25°C.

[0023] The pBA002-3xFlag vector was digested with restriction endonucleases XbaI and XhoI. The digestion reaction mixture (50 μL) included 5 μg of vector plasmid, 1 μL of XbaI, 1 μL of XhoI, and 5 μL of 10xNEB Buffer. Add ddH2O to 50 μL. Mix well and incubate at 37°C for 3 h.

[0024] After recovery and purification of the PCR amplification product and pBA002 vector digestion product, the linearized vector and PCR fragment were recombined using recombinase. The reaction system (10 μL) was as follows: 5 μL of 2x MultiF Seamless Assembly Mix, 2 μL of linearized vector, 1 μL of PCR fragment, and ddH2O added to 10 μL. The reaction was incubated at 50°C in a metal bath for 30 min and then placed on ice.

[0025] The recombinant product was transformed into Escherichia coli DH5α competent cells and cultured at 37°C overnight. Colony PCR was performed using Primer1 and Primer3 as primers, and positive single clones were selected for sequencing.

[0026] Primer 3: 5'-CGATCGGGGAAATTCGAGCTC-3' (SEQ ID NO: 5) The above primer Primer1 (SEQ ID NO: 3) binds to the beginning of the CDS sequence of the GmWRKY75 gene, and Primer3 (SEQ ID NO: 5) is located in the pBA002-3xFlag vector sequence.

[0027] Sequencing results showed that the GmWRKY75 gene fragment obtained by PCR had the nucleotide sequence shown in SEQ ID NO: 1, which encodes a protein consisting of 188 amino acid residues (SEQ ID NO: 2). The obtained recombinant vector was named pBA002-GmWRKY75-3xFlag ( Figure 1 ).

[0028] GmWRKY75 gene fragment (SEQ ID NO: 1) ATGGAGAATTATTCCATGTTGTTCTCTGTTTCCAATTCCTCAAGCTACCCAATTGGAGTTGGAAGCTCTCAAATTGGTTATAGTGGTCAAAGCTCCAATGCGTTTCTTGGTCTAAGGCCTAGTAATGAATTAGCTAGTGAT GATCATGAGAAGAGACAAGGTGGTGGTGATGGCAATATGTTAATGTCTCAGATCAGTGGTGGTAGCATTAATGTGAGTGATGAGTTAGGTGGTTCGGGAAATAGTAACAATAATAAAAAGAAAGGAGAGAAAAAGGTTAGAA AGCCTAGATATGCTTTTCAAACAAGGAGCCAGGTTGATATTCTTGATGATGGTTACCGATGGAGGAAGTATGGCCAAAAAGCTGTTAAAAACAACAAATTTCCAAGGAGCTACTACAGGTGCACGCATCAAGGGTGCAATGT GAAGAAGCAAGTGCAACGCTTAACCAAAGACGAAGGAGTAGTGGTAACCACTTATGAGGGAGTGCACACACACCCAATTGAGAAGACAACAGATAACTTTGAGCACATTTTGAGTCAGATGCAAATATACACTCCCTTCTGA Amino acid sequence encoded by the GmWRKY75 gene fragment of SEQ ID NO: 1 (SEQ ID NO: 2) MENYSMLFSVSNSSSYPIGVGSSQIGYSGQSSNAFLGLRPSNELASDDHEKRQGGGDGNMLMSQISGGSINVSDELGGSGNSNNNKKKGEKKVRKPRYAFQTRSQVDILDDGYRWRKYGQKAVKNNKFPRSYYRCTHQGCNVKKQVQRLTKDEGVVVTTYEGVHTHPIEKTTDNFEHILSQMQIYTPF Example 2: Obtaining and identifying soybean transgenic plants overexpressing the GmWRKY75 gene This example uses an Agrobacterium EHA105-mediated genetic transformation method to transfer the soybean GmWRKY75 gene overexpression vector constructed in Example 1 into soybean cotyledonary nodes to obtain soybean GmWRKY75 gene overexpression plants, which specifically includes the following steps: 1. Obtaining recombinant Agrobacterium The pBA002-GmWRKY75-3xFlag plasmid was mixed with Agrobacterium tumefaciens EHA105 competent cells and incubated on ice for 5 min. pBA002-GmWRKY75-3xFlag was transformed into Agrobacterium tumefaciens EHA105 competent cells by electroporation (1500 V, 5 ms) to obtain the recombinant strain. The recombinant strain identified by colony PCR was named EHA-pBA002-GmWRKY75-3xFlag.

[0029] 2. Obtaining Transgenic Plants The germination medium, YEP medium, co-cultivation medium, recovery solid medium, screening medium, elongation solid medium and rooting medium in this step are all conventional commercially available medium.

[0030] The specific method is: (1) Induction Select healthy, mature soybean seeds and sterilize them using chlorine gas (100 mL of sodium hypochlorite (8% effective concentration) plus 5 mL of concentrated hydrochloric acid) for 16-20 hours. This procedure should be performed in a fume hood. After sterilization, air-blow the seeds for 24 hours in a clean bench to dissipate any residual chlorine. Seal the petri dish containing the sterilized soybeans and store at 4°C until ready for use.

[0031] (2) Pre-culture: Inoculate the sterilized seeds with the hilum facing downward on the germination medium, place in a 25°C incubator, and culture in the dark for 1 day.

[0032] (3) Preparation of Agrobacterium tumefaciens culture Agrobacterium EHA-pBA002-GmWRKY75-3xFlag carrying the target gene plasmid was plated onto YEP medium for initial activation. After 48 hours of culture, the cells were harvested and reactivated on fresh medium. After 24 hours of culture, the cells were harvested and placed in infection medium, vortexed, and the OD value of the culture solution was adjusted to 0.5 using a spectrophotometer.

[0033] (4) Infection Split the germinated soybeans in half with a scalpel blade to create two pods. Remove the excess hypocotyl 3-4 mm from the hypocotyl. Gently score the hypocotyl 5-7 times with a razor blade at the cotyledonary node. After scoring, add the prepared bacterial solution and infect for 30 minutes. Discard the infection solution and place the explants on co-cultivation medium lined with filter paper. Incubate at 25°C in the dark for 3-5 days.

[0034] (5) Recovery culture After co-cultivation, select the explants that grow well and are free of contamination, cut off the ends of the embryonic axes, insert them into the recovery solid culture medium, and resume culture for 7-10 days.

[0035] (6) Screening and culture The explants that grew clustered shoots after recovery culture were inoculated onto screening medium and cultured under 16 h / 8 h light / dark conditions for 21 days.

[0036] (7) Elongation culture After screening, the well-growing buds were transferred to a new elongation medium and cultured under a 16 h / 8 h light / dark cycle for 21 days.

[0037] (8) Rooting culture When the shoots grew to approximately 5 cm, they were transferred to rooting medium for further screening. Cultured under a 16 h / 8 h light / dark cycle for 21 days.

[0038] (9) Hardening of seedlings Remove the seedlings from the culture medium, clean the culture medium from the roots, and transplant them into a seedling tray filled with nutrient soil. Incubate at 27°C under a 16 h / 8 h light / dark cycle for 3-4 weeks to obtain T0 plants.

[0039] 3. Identification of transgenic plants 1. Identification of GmWRKY75 overexpressing plants (1) PCR molecular identification Genomic DNA extracted from the T0 generation plants obtained in step 2 was used as a template for PCR amplification using Primer1 (SEQ ID NO: 3) and Primer3 (SEQ ID NO: 5) from Example 1. The PCR product was detected by 1% agarose gel electrophoresis. The target band, approximately 700 bp in size, was detected in positive plants but not in negative plants.

[0040] (2) Bar test strip identification Take the newly grown leaves of T0 generation plants about 0.5-1 cm 2 Place the leaves in a 1.5 mL centrifuge tube and grind them with a grinding rod. Add 200 μL of the extract and mix thoroughly. Insert the rapid test strip into the mixture according to the marked direction and observe the results after 5 minutes. If both the test band and the control band appear, the test is positive; if only the control band appears, the test is negative.

[0041] (3) Herbicide resistance identification The above steps (1) and (2) are for identifying T0 generation transgenic seedlings. T0 generation positive seedlings are planted in a culture room and seeds are harvested. The seeds are planted in an outdoor transgenic planting base to reproduce two generations (T1 generation and T2 generation). The transgenic identification method is: W82 wild-type plants and transgenic plants are sprayed or smeared with glufosinate (dilute the 10% stock solution 200 times and add 0.1% (v / v) Tween) at the same time. After one week, the transgenic plants remain normal, while the leaves of W82 (or the separated non-transgenic plants) begin to turn yellow and wilt. The transgenic lines that all plants show glufosinate resistance in the T2 generation are identified as homozygous lines.

[0042] (4) Detection of GmWRKY75 gene expression The leaves of the homozygous transgenic GmWRKY75 lines identified and screened in (3) were frozen in liquid nitrogen and ground thoroughly. RNA was extracted using the Trizol method. An appropriate amount of RNA was used to obtain cDNA using a reverse transcription kit as a template for qRT-PCR detection. An appropriate amount of template cDNA was taken, and the GmTubulin gene was used as an internal reference gene. The expression level of the GmWRKY75 gene was detected in a Bio-Rad fluorescent quantitative PCR instrument CFX96 using the Genious 2×SYBR Green FastqPCR Mix (No ROX Premixed) (RK21205; AB Clonal) kit. The sequences of the quantitative detection primers for the GmTubulin gene (Primer4 and Primer5) and the quantitative detection primers for the GmWRKY75 gene (Primer6 and Primer7) used are as follows: Primer4: 5'-CTACACCGTTGGCAAAGAGA-3' (SEQ ID NO: 6); Primer5: 5'-GAAGACGAGGAAGCCTTGTAG-3' (SEQ ID NO: 7).

[0043] Primer6: 5'-CGTGCCGTTTACGACACCAT-3' (SEQ ID NO: 8); Primer7: 5'-AATATAAATGGCGGGGGCGG-3' (SEQ ID NO: 9).

[0044] The relative expression was calculated using the 2-ΔΔCt method. Figure 2 As shown, taking the relative expression level of GmWRKY75 to GmTubulin in W82 leaves as 1, the relative expression levels of GmWRKY75 genes in the three overexpression lines (OE1-3) were significantly increased.

[0045] Example 3: Identification of agronomic traits of soybean transgenic plants overexpressing the GmWRKY75 gene W82 (as a control) and homozygous lines overexpressing the GmWRKY75 gene (OE1-3) were planted under natural conditions. The control and overexpression homozygous lines were intercropped to reduce errors. The plant height, number of main stem nodes, number of pods per plant, number of grains per plant, and yield per plant of the plants at maturity under natural conditions were observed. Phenotypic data of 20 plants were collected for each system and photographed. The results are shown in the figure below. Figure 2 、 3 shown.

[0046] Results showed that compared with W82, the three overexpression lines (OE1-3) showed significantly improved plant height, number of main stem nodes, number of pods per plant, number of grains per plant, and yield per plant. The average plant height of W82 was 42.3 cm, while the overexpression lines (OE1-3) exceeded 57 cm. The average number of main stem nodes of W82 was 10.85, while the overexpression lines (OE1-3) had an average number of main stem nodes of 13.6-14.3. The average number of pods per plant of W82 was 24.35, while the overexpression lines (OE1-3) had an average number of pods per plant of 32.45-41.5. The average yield per plant of W82 was 14.3 g, while the overexpression lines (OE1-3) had an average yield of 17.4-19.8 g. These results indicate that the soybean GmWRKY75 gene overexpression line can significantly increase soybean plant height, number of main stem nodes, number of pods per plant, number of grains per plant and yield per plant, thereby helping to increase soybean yield.

[0047] The technical features of the above-mentioned embodiments can be combined arbitrarily. In order to make the description concise, not all possible combinations of the technical features in the above-mentioned embodiments are described. However, as long as there is no contradiction in the combination of these technical features, they should be considered to be within the scope of this specification.

[0048] The above-described embodiments merely illustrate several implementations of the present invention, and while their descriptions are relatively specific and detailed, they should not be construed as limiting the scope of the patent. It should be noted that a person skilled in the art would be able to make numerous variations and improvements without departing from the spirit of the present invention, all of which fall within the scope of protection of the present invention. Therefore, the scope of protection of the patent for this invention shall be determined by the appended claims.

[0049] The above is only a preferred embodiment of the present invention. It should be pointed out that for ordinary technicians in this technical field, several improvements and modifications can be made without departing from the principles of the present invention. These improvements and modifications should also be regarded as within the scope of protection of the present invention.

Claims

1. Use of the soybean GmWRKY75 gene in increasing the yield per plant or the number of seeds per plant of soybeans and / or in the genetic breeding for improving the plant type of soybeans, characterized in that, Overexpress the soybean GmWRKY75 gene, wherein the soybean GmWRKY75 gene encodes an amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of nodes on the main stem and / or an increase in plant height.

2. Use of a recombinant vector containing the soybean GmWRKY75 gene in increasing the yield per plant or the number of grains per plant of soybeans and / or in genetic breeding for improving the plant type of soybeans, characterized in that, Overexpress the soybean GmWRKY75 gene, the soybean GmWRKY75 gene encodes an amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of nodes on the main stem and / or an increase in plant height.

3. Use of a genetically engineered bacterium in increasing the yield per plant or the number of grains per plant of soybeans and / or in genetic breeding for improving the plant type of soybeans, characterized in that, The genetically engineered bacterium contains a recombinant vector containing the soybean GmWRKY75 gene, overexpress the soybean GmWRKY75 gene, the soybean GmWRKY75 gene encodes an amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of nodes on the main stem and / or an increase in plant height.

4. A method for increasing the yield per plant or the number of grains per plant of soybeans and / or improving the genetic breeding of soybean plant type, characterized in that, The method includes: overexpressing the soybean GmWRKY75 gene, the soybean GmWRKY75 gene encodes an amino acid sequence shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of nodes on the main stem and / or an increase in plant height.

5. A method for obtaining a soybean plant with improved agronomic traits, characterized in that, Comprising the following treatment steps: (1) Infecting the cotyledon nodes of soybean with the genetically engineered bacterium; and (2) Culturing the infected callus into a soybean plant; Wherein the genetically engineered bacterium contains a recombinant vector containing the soybean GmWRKY75 gene, overexpress the soybean GmWRKY75 gene, the soybean GmWRKY75 gene encodes an amino acid sequence shown in SEQ ID NO: 2, and the improved agronomic traits are an increase in the yield per plant, the number of grains per plant, the number of nodes on the main stem and / or the plant height of soybean.

6. The application according to any one of claims 1 to 3 or the method according to claim 4 or 5, characterized in that The coding sequence of the soybean GmWRKY75 gene is shown in SEQ ID NO:

1.

7. Application of the soybean GmWRKY75 transcription factor in increasing the yield per plant or the number of grains per plant of soybean and / or in genetic breeding for improving the soybean plant type, the amino acid sequence of the soybean GmWRKY75 transcription factor is shown in SEQ ID NO: 2, and the plant type improvement is an increase in the number of nodes on the main stem and / or an increase in plant height.

Citation Information

Patent Citations

  • Compositions and methods comprising endophytic bacterium for application to target plants to increase plant growth, and increase resistance to abiotic and biotic stressors

    CA2975486A1

  • Soybean phosphorus starvation transcription factor GmWRKY75, encoded protein and application of phosphorus starvation transcription factor GmWRKY75

    CN106244594A

  • Protein related to soybean plant height, single plant pod number and single plant grain number and biological material and application thereof

    CN117551689A

  • Application of GmWRKY180 gene in improvement of plant phosphorus starvation stress tolerance

    CN118562853A

  • Application of soybean GmWRKY40 gene in soybean breeding

    CN119592583A

Cited By

  • Application of soybean GmTHIC gene in increasing thiamine content and enhancing salt tolerance

    CN120924591A