Variants of SIRT6 for use in preventing and / or treating age-related diseases - Patents.com

Abstract

The present invention relates to an isolated nucleic acid molecule encoding a variant of Sirtuin 6 (SIRT6) having at least 75% identity with the sequence of SEQ ID NO: 1, the variant having at least one mutation selected in the group consisting of or including N308K and A313S substitutions with respect to the sequence of SEQ ID NO: 1. The present invention provides means for the regulation of aging and / or senescence and / or lifespan of an individual. The present invention further provides means for the repair of double-strand breaks in cells. Finally, the present invention also provides means for the prevention and / or treatment of age-related diseases.

Description

[Technical field]

[0001] STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT This invention was made with Government grants AG056278, AG027237, AG047200 awarded by the National Institutes of Health. The U.S. Government has certain rights in this invention.

[0002] FIELD OF THEINVENTION The present invention relates to survival, longevity, and age-related diseases. More particularly, the present invention relates to variants of Sirtuin 6 (SIRT6) and their therapeutic uses for modulating aging and for treating and / or preventing age-related diseases. [Background technology]

[0003] 2. Background of the Invention Living to 100 years of age has a strong genetic component and remains extremely rare, with an incidence in developed countries of at most 1 in 6000. So far, only APOE has been identified as a significant biomarker associated with human longevity from genome-wide association studies, likely due to an overall lack of statistical power.

[0004] However, a number of diseases referred to as age-associated diseases often occur as individuals age.

[0005] Examples of such age-related diseases include, for example, cardiovascular disease, stroke, hypertension, cancer, type 2 diabetes, Parkinson's disease, Alzheimer's disease and other dementias, chronic obstructive pulmonary disease (COPD), osteoarthritis, osteoporosis, cataracts, age-related macular degeneration, and hearing loss.

[0006] Age-related diseases are now believed to be the result of the body's diminished ability to repair DNA damage and maintain telomere integrity.

[0007] To date, a family of proteins called sirtuins (SIRTs) has been linked to various mechanisms involved in DNA damage repair, telomere integrity, aging, and longevity.

[0008] Among SIRT proteins, SIRT6, encoded by the SIRT6 gene, regulates the expression of deacetylated histone 3 lysine 9 (H3K9) and deacetylated histone 3 lysine 56 (H3K56) as well as telomere reverse transcriptase, which is required for telomere elongation, leading to the maintenance of telomere integrity. In addition, the SIRT6 gene has been shown to be recruited to damage sites and promote DNA repair through deacetylating repair proteins such as poly(ADP-ribose) polymerase (PARP)-1, Ku70, NBS, and Werner (WRN) helicase. In particular, SIRT6 acts as a transcriptional regulator to repress gene expression by stabilizing chromatin structure.

[0009] In addition, SIRT6 regulates cellular senescence through the deacetylation of various signaling molecules, such as FOXO and p53. SIRT6 regulates the RelA subunit of NFκB by modifying cellular senescence-related gene expression. Finally, SIRT6 also reduces cellular injury, thereby decreasing the damage that causes premature aging.

[0010] SIRT6 may therefore constitute a good target for preventing and / or treating age-related diseases. Summary of the Invention [Problem to be solved by the invention]

[0011] There is still a need to provide a means for preventing and / or treating age-related diseases.In particular, there is a need to prevent and / or treat aging-related disorders, particularly premature aging.There is also a need to improve DNA damage repair, which is involved in aging, including premature aging, and shortened longevity. [Means for solving the problem]

[0012] overview A first aspect of the present invention relates to an isolated nucleic acid molecule encoding a variant of Sirtuin 6 (SIRT6) having at least 75% identity to the sequence of SEQ ID NO:1, wherein the variant has at least one mutation selected from the group consisting of or including the substitution N308K and the substitution A313S with respect to the sequence of SEQ ID NO:1.

[0013] In some embodiments, the nucleic acid molecule is a nucleic acid molecule of a sequence selected from the group comprising or consisting of SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.

[0014] Another aspect of the present invention pertains to an isolated polypeptide encoded by a nucleic acid molecule defined herein.

[0015] In certain embodiments, the polypeptide is a polypeptide of a sequence selected from the group comprising or consisting of SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4.

[0016] A further aspect of the present invention relates to a vector comprising an isolated nucleic acid molecule as defined herein.

[0017] In some embodiments, the vector is a viral vector, in particular an adeno-associated viral vector (AAV), an exosome-associated AAV vector (exo-AAV), an adenoviral vector, a retroviral vector, or a herpes viral vector.

[0018] In one aspect, the present invention relates to a suspension comprising a vector as defined herein.

[0019] The present invention also relates to a cell expressing a polypeptide as defined herein, said cell being preferably transfected with an isolated nucleic acid molecule or vector as defined herein.

[0020] Another aspect of the present invention relates to a pharmaceutical composition comprising (i) an isolated nucleic acid molecule, or an isolated polypeptide, or a vector as defined herein, and (ii) a pharma- ceutically acceptable excipient.

[0021] The present invention relates to the use of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector as defined herein in modulating ageing and / or senescence and / or life span in an individual, preferably a mammalian individual, more preferably a human individual.

[0022] A further aspect of the invention relates to the use of an isolated nucleic acid molecule, or an isolated polypeptide, or a vector as defined herein, in the repair of double-strand breaks in cells, preferably mammalian cells, more preferably human cells.

[0023] In some embodiments, the present invention also relates to an isolated nucleic acid molecule, or an isolated polypeptide, or a vector as defined herein, for use in the prevention and / or treatment of age-related diseases.

[0024] In certain embodiments, the individual is a mammalian individual, preferably a human individual.

[0025] In some embodiments, the age-related disease is selected from the group including or consisting of progeria, Werner's syndrome, neurodegenerative diseases, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, eye disorders, cataracts, glaucoma, osteoporosis, thrombotic disorders, arthritis, hearing loss, and stroke.

[0026] In another aspect, the present invention also relates to a kit comprising (i) an isolated nucleic acid molecule, or an isolated polypeptide, or a vector as defined herein, and (ii) a means for administering the isolated nucleic acid molecule, the isolated polypeptide, or the vector.

[0027] definition In the present invention, the following terms have the following meanings.

[0028] When "about" is before a number, it means ±10% of the value of said number. It should be understood that the value to which the term "about" refers is specifically, and preferably also the exact value disclosed.

[0029] "Comprise" is intended to mean "contain," "encompass," and "include." In some embodiments, the term "comprise" also encompasses the term "consisting of."

[0030] "Sirtuin 6," also referred to as "SIRT6," is intended to refer to the polypeptide of Entrez Gene Number 51548, and relates, without limitation, to NAD-dependent protein deacetylase sirtuin 6, regulatory protein SIR2 homolog 6, SIR2-like protein 6, SIR2L6, Sirtuin (Silent Mating Type Information Regulation 2, S. cerevisiae, homolog) 6, Sirtuin (Silent Mating Type Information Regulation 2 homolog) 6, Sir2-related protein type 6, Sirtuin type 6, and EC.2.3.1.286.

[0031] "Isolated" refers to a nucleic acid molecule or polypeptide that has been removed from the initial biological environment that permitted its production, which in practice includes at least one cell, or one or more enzyme(s).

[0032] "Nucleic acid", also referred to as "polynucleotide", refers to any polyribonucleotide or polydeoxyribonucleotide, which may be unmodified RNA or DNA, or modified RNA or DNA. "Nucleic acid" or "polynucleotide" includes, but is not limited to, single-stranded and double-stranded DNA, DNA that is a mixture of single-stranded and double-stranded regions, single-stranded and double-stranded RNA, and RNA that is a mixture of single-stranded and double-stranded regions, hybrid molecules containing DNA and RNA that may be single-stranded or, more typically, double-stranded, or a mixture of single-stranded and double-stranded regions. In addition, "nucleic acid" or "polynucleotide" refers to RNA or DNA, or triple-stranded regions that contain both RNA and DNA. The term "nucleic acid" or "polynucleotide" also encompasses DNA or RNA that contains one or more modified bases, and DNA or RNA with backbones modified for stability or other reasons. "Modified" bases include, for example, tritylated bases, and unusual bases such as inosine. A variety of modifications may be made to DNA and RNA, and thus "nucleic acid" or "polynucleotide" encompasses chemically, enzymatically or metabolically modified forms of polynucleotides typically found in nature, as well as the chemical forms of DNA and RNA characteristic of viruses and cells. "Polynucleotide" also encompasses relatively short polynucleotides, often referred to as oligonucleotides.

[0033] "Polypeptide" refers to any peptide or protein containing two or more amino acids joined together by peptide bonds or modified peptide bonds, i.e., peptide isosteres. "Polypeptide" refers to both short chains, commonly referred to as peptides, oligopeptides or oligomers, and to longer chains, commonly referred to as proteins. Polypeptides may contain amino acid residues other than the 20 gene-encoded amino acid residues.

[0034] "Age-associated disease" refers to a physiological or pathological condition that correlates with advanced or premature aging in individuals and whose prevalence exceeds the average prevalence observed in the general population. Non-limiting examples of age-associated diseases include progeria, Werner's syndrome, neurodegenerative diseases, cardiovascular disease, stroke, hypertension, cancer, type 2 diabetes, Parkinson's disease, dementia, chronic obstructive pulmonary disease (COPD), osteoarthritis, osteoporosis, cataracts, age-related macular degeneration, hearing loss, and similar diseases.

[0035] "Suspension" refers to a liquid mixture in which active ingredients, such as a nucleic acid molecule, a polypeptide, or a vector according to the invention, are suspended in a liquid medium.

[0036] "Treating", "treatment" or "alleviation" refers to both therapeutic treatment and prophylactic or preventative measures, the purpose of which is to prevent or slow (attenuate) the target pathological condition or disorder, particularly age-related disease. Those in need of treatment include those who already have said disorder, as well as those who are prone to develop the disorder, or those in whom the disorder should be prevented. If an individual, after receiving a therapeutic amount of an active ingredient, particularly a nucleic acid molecule, polypeptide, or vector according to the present invention, shows an observable and / or measurable reduction or absence of one or more symptoms associated with age-related disease; shows a reduction in morbidity and mortality, and shows an improvement in quality of life issues, the individual is successfully treated with age-related disease. The above parameters for assessing the success of treatment and improvement in disease can be readily measured by routine procedures familiar to a physician or authorized personnel.

[0037] "Preventing" refers to preventing and / or reducing the chance of developing an age-related disease, or a disorder or condition associated with the deficiency or absence of organ, tissue or cellular function, or at least one adverse effect or symptom thereof.

[0038] "Therapeutically effective amount" refers to a level or amount of an active ingredient that aims to (1) delay or prevent the onset of an age-related disease, disorder or condition; (2) slow or stop the progression, aggravation or deterioration of one or more symptoms of an age-related disease, disorder or condition; (3) bring about a reversal of symptoms of an age-related disease, disorder or condition; (4) reduce the severity or occurrence of an age-related disease, disorder or condition; or (5) cure an age-related disease, disorder or condition, without causing significant negative or harmful side effects on the target. A therapeutically effective amount may be administered prior to the onset of an age-related disease, disorder or condition for prophylactic or preventative effects. Alternatively or additionally, a therapeutically effective amount may be administered after the onset of an age-related disease, disorder or condition for therapeutic effects. In one embodiment, a therapeutically effective amount of an active ingredient is an amount effective to reduce at least one symptom of an age-related disease, disorder or condition.

[0039] "Individual" refers to an animal, preferably a mammal, more preferably a human. In one embodiment, the individual is male. In another embodiment, the individual is female. In one embodiment, the individual may be a "patient", a warm-blooded animal, more preferably a human, awaiting or undergoing medical treatment, or having been / is / will be the subject of a medical procedure, or being monitored for the development of cancer. In one embodiment, the individual is an adult (e.g., a subject over 18 years of age). In another embodiment, the individual is a child (e.g., a subject under 18 years of age). [Brief description of the drawings]

[0040] [Figure 1] FIG. 1 is a scheme illustrating the screening strategy for variants within genomic maintenance (GM) genes in Ashkenazi Jewish (AJ) centenarians. [Diagram 2] Figure 2 is a plot showing the turnover rate of purified SIRT6 protein. SILAC analysis on HEK293 cells expressing SIRT6 variants. [Diagram 3] 3 is a graph showing the thermal stability of purified SIRT6 protein (WT: wild-type SIRT6 polypeptide; Cent: SIRT6 variant polypeptide with N308K and A313S mutations). Data represents two replicate experiments, each containing two technical replicates using SIRT6 from Roc and Ichor preparations. [Figure 4] Figures 4A-4B are a combination of graphs. Figure 4A shows the fluorescence lifetime τ measured from the FLT signal by fitting the data to equation 1 (see Methods). Each of the two different SIRT6 biosensors shows a decrease in fluorescence lifetime compared to the GFP-only control, indicating highly significant FRET. Compared to the biosensor with C-terminal GFP, the internal GFP biosensor shows a larger lifetime change (higher FRET, shorter distance R, and greater sensitivity of structure). The centSIRT6 of this biosensor was also tested. It shows a significant increase in lifetime τ (1.96 ± 0.02 ns) compared to wild-type SIRT6 (1.75 ± 0.01 ns). Error bars indicate SEM (n = 3-5). Figure 4B shows that the FRET efficiency E and distance R (in Angstroms Å) were determined from the lifetime data (equations 2 and 3 in Methods), revealing that the distance R, a measure of the internal GFP biosensor, is significantly 3.0 ± 0.4 Å larger for centSIRT6. [Diagram 5] Figures 5A-5B are a combination of graphs. Figure 5A shows the Michaelis-Menten kinetic parameters with different concentrations of myristoylated peptide. Figure 5B shows the Michaelis-Menten kinetic parameters with different concentrations of NAD+. Reactions were performed in triplicate. Closed circles: WT; closed squares: Cent. [Figure 6] FIG. 6 is a graph showing tryptophan fluorescence curves of SIRT6 variants with titrating concentrations of NAD+. [Figure 7]Figures 7A-7B are a combination of plots showing deacetylase activity at H3K9ac (Figure 7A) and H3K18ac (Figure 7B) residues with reduced activity in centSIRT6 alleles (deacetylase activity is inversely proportional to the relative abundance of acetylated compounds). Designer histones saturated with the corresponding acetylated histone residues were incubated with purified SIRT6 and 1 mM NAD+ for 1 hour, then resolved by SDS-PAGE gel and stained with acetyl-specific histone antibodies. All reactions were performed with n=3; error bars indicate sd. Statistics were calculated using a two-tailed Student's t-test. Asterisks indicate p<0.05. [Figure 8] Figures 8A-8B are a combination of plots showing deacetylation kinetics of SIRT6 variants at H3K9ac (Figure 8A) and H3K18ac (Figure 8B) residues. Designer histones were incubated with purified SIRT6 and 5 mM NAD+ for 1 hour, then resolved by SDS-PAGE and analyzed by immunoblotting with an acetyl-specific histone antibody. All reactions were performed with n=3; error bars indicate sd. Statistics were calculated using a two-tailed Student's t-test. Asterisks indicate p<0.05. [Figure 9] 9A-9B are a combination of plots showing in vitro deacetylation rates for H3K9ac (FIG. 9A) and H3K18ac (FIG. 8B) residues of purified SIRT6 protein with histones purified from HeLa cells. [Figure 10] Figure 10 is a plot showing quantitative mass spectrometry of histone H3 peptides purified from human cells expressing different SIRT6 alleles, revealing no difference in acetylation levels. Relative fraction represents the portion of peptides encompassing H3K9-17 compared to the sum of all peptide quantifications of the same region. The average and standard deviation of three different preparations are plotted. [Figure 11]Figure 11 is a photograph showing whole cell histone H3 acetylation levels in coumarate-induced SIRT6 human fibroblasts assessed by Western blot. Cu: coumarate; PQ: paraquat. The coumarate dose required for equivalent SIRT6 protein abundance was determined by Western blot and administered to each cell line accordingly. [Figure 12] Figure 12 is a plot showing autoribosylation of SIRT6 with radiolabeled NAD+. Recombinant SIRT6 was incubated with P32-labeled NAD+ and then run on SDS-PAGE. Signals were measured using a PhosphoImager. All experiments were repeated at least three times; error bars indicate sd. Significance was calculated by two-tailed Student's t-test. Asterisks indicate p<0.05. Asterisks indicate significance relative to HPRT control. [Figure 13] FIG. 13 is a plot showing autoribosylation of SIRT6 by titration of NAD+. Ribosylated wild-type SIRT6 (closed circle) and centSIRT6 (closed square) proteins were detected using mADPr-specific antibodies. The plot was fitted to the Michaelis-Menten equation by Kaleidagraph software. KmNAD was 142+29 for centSIRT6 and 106+45 for wild-type SIRT6, and the maximum signal was approximately 2-fold greater for centSIRT6 compared to wild-type SIRT6. [Figure 14] Figure 14 is a graph showing the activation of PARP1 by SIRT6 variants. SIRT6 protein was incubated with human PARP1 protein and then analyzed by immunoblotting with polyADPr antibody. The polyADPr activity of PARP1 results in a wide range of product sizes. Activity was evaluated by quantifying the polyADPr signal in all lanes for each sample. All experiments were repeated at least three times; error bars indicate sd. Significance was determined by two-tailed Student's t-test. Asterisks indicate p<0.05. Lower asterisks indicate significance relative to HPRT control. Upper asterisks indicate significance relative to wild-type SIRT6. [Figure 15] Figure 15 is a graph showing qRT-PCR analysis of LINE1 expression in coumarate-induced SIRT6 fibroblasts. Primers assessed both 5' (ORF1: black bars) and 3' (ORF2: hatched bars) LINE1 sequences from the LiMdA1 family of active LINE1 retrotransposons. Assessment of both regions was performed to mitigate contributions from partial insertion sequences in coding genes. All experiments were repeated at least three times. Error bars indicate sd. Significance was determined by two-tailed Student's t-test unless otherwise stated. Asterisks indicate p<0.05. [Figure 16] Figures 16A-16B are a combination of graphs showing stimulation of NHEJ (Figure 16A) and HR (Figure 16B) by SIRT6 variants. Reporter cell lines were co-transfected with SIRT6 expression plasmid, I-Sce1 plasmid, and DsRed transfection control. After 72 hours of recovery, reactivation of the GFP reporter was measured by flow cytometry. Stimulation of NHEJ or HR was calculated as the ratio of GFP+ positive cells / DsRed+ positive cells (radio). [Figure 17] Figure 17 is a graph showing basal γH2AX foci in coumarate-induced SIRT6 fibroblasts under non-induced (white bars) or induced (black bars) conditions. Foci were scored in at least 80 cells per condition. [Figure 18] Figure 18 is a plot showing DNA repair kinetics in coumarate-induced SIRT6 fibroblasts. Cells were grown on slides and irradiated with 2 Gy gamma rays, followed by immunostaining for γH2AX. Irradiation was performed when cells were 75% confluent on the slide. Cells were fixed and foci were scored at t=0.5, 2, 4, 6, and 24 hours after irradiation. Foci were scored in at least 80 cells per genotype at each time point. Asterisks indicate significant differences from wild-type SIRT6 (p<0.05). [Figure 19]Figures 19A-19B are a combination of plots showing oxidative stress resistance. Coumarate-induced SIRT6 fibroblasts were induced for SIRT6 expression and exposed to paraquat for 24 hours. Resistance was determined by apoptosis staining 48 hours after exposure. [Figure 20] Figures 20A-20C are combined graphs. Figure 20A shows the number of adherent cells after transfection with SIRT6 variants. Cells were transfected with SIRT6 plasmids encoding different SIRT6 alleles, and cell numbers were counted 72 hours later. HCA2 are normal human foreskin fibroblasts. a: control (CT); b: WT; c: N308K SIRT6 variant; d: A313S SIRT6 variant; e: Cent (N308K A313S variant). Asterisks indicate significant differences from wild-type SIRT6 (p<0.05). Figures 20B-20C show apoptosis staining of HT1080 (Figure 20B) and HeLa (Figure 20C) cancer cell lines 48 hours after transfection. Cells were stained with Annexin V / PI and analyzed by flow cytometry. Significance was determined by two-way ANOVA. All experiments were repeated at least three times. Error bars represent sd. Statistics were determined by two-tailed Student's t-test unless otherwise stated. Asterisks indicate p<0.05. [Figure 21] 21 is a photograph showing immunoprecipitation (IP) experiments with antibodies against SIRT6, LMNA, and mADPr of lysates from coumarate-induced fibroblasts expressing wild-type (WT) or centSIRT6 (Cent) alleles. SIRT6 expression was induced 48 hours prior to IP. IP experiments were repeated three times. A representative set of IPs is shown. [Figure 22] Figure 22 is a graph showing Western blot with an antibody to LMNA after SIRT6 IP, where centSIRT6 (Cent) shows enhanced interaction with LMNA compared to wild type SIRT6 (WT). Quantitation of the IP experiment shown in Figure 21. [Figure 23]Figure 23 is a graph showing a Western blot with an antibody to SIRT6 after LMNA IP from coumarate-induced SIRT6 fibroblasts, in which LMNA shows enhanced interaction with centSIRT6 (Cent) compared to wild type (WT). Quantitation of the IP experiment shown in Figure 21. [Figure 24] Figure 24 is a graph showing quantification of the IP experiment shown in Figure 21. Western blot with an antibody against mADPr residues after SIRT6 IP from coumarate-induced SIRT6 fibroblasts shows that centSIRT6 exhibits enhanced mADPr. [Diagram 25] Figure 25 is a graph showing quantification of the IP experiment shown in Figure 21. Western blot with an antibody to LMNA after IP with mADPr antibody using extracts from coumarate-induced SIRT6 fibroblasts shows that LMNA exhibits an enhanced mADPr signal in cells expressing centSIRT6 (Cent) compared to wild type (WT). [Figure 26] Figure 26 is a scheme showing the protein-protein interaction profile of SIRT6 and LMNA. SIRT6 and LMNA are shown in dark grey and highlighted as central points in two opposing interaction nodes. The third node (top center) shows the interaction partners shared by SIRT6 and LMNA. Proteins whose interactions were enhanced by centSIRT6 alleles are shown in light grey. Proteins that interacted equally with wild type and centSIRT6 alleles are uncolored. H15 is a special case because it showed increased interaction with centSIRT6 and decreased interaction with LMNA in the presence of centSIRT6 alleles. Proteins known to be ribosylated in previous reports are shown as hexagons. [Figure 27]Figures 27A-27B are combined histograms. Figure 27A shows SIRT6 expression in coumarate-induced telomerase-immortalized HCA2 human fibroblast cell lines. SIRT6 alleles were integrated into the genome of SIRT6 knockout HCA2 cells using the PiggyBac Transposon Vector System. Different doses of coumarate and the resulting SIRT6 abundance were used to determine the dose required to achieve equal SIRT6 expression in each cell line. Cells were normalized by counting and total protein. Subsequent experiments utilizing coumarate-induced SIRT6 fibroblast cells were controlled for SIRT6 abundance using these data. For each cell line, the boxes indicate the corresponding coumarate dosage for equivalent expression (WT=60 μg / ml, N308K=30 μg / ml, A313S=30 μg / ml, and Cent=7.5 μg / ml). These concentrations were used in experiments with these cells. FIG. 27B shows qRT-PCR expression analysis of SIRT6 using standardized doses of coumarate (doses correspond to boxes in FIG. 27A). [Figure 28] Figure 28 is a histogram showing the autoribosylation of SIRT6 with biotin-labeled NAD+.Recombinant SIRT6 is incubated with NAD+ conjugated with biotin residue, and then run on SDS-PAGE.Each allele is evaluated relative to the time point of 0 hours, and normalized to SIRT6 total protein loading control. [Figure 29]29A-29F are a combination of photographs, graphs and histograms showing the analysis of CRISPR human MSC cell lines. Figures 29A and 29B show DNA double strand repair efficiency in wild type and centSIRT6 ("Cent#1" and "Cent#2") hMSCs. DSB repair reporter constructs were integrated into hMSCs. After 72 hours of recovery, reactivation of GFP reporter was measured by flow cytometry. Stimulation of NHEJ or HR was calculated as the ratio of GFP+ positive cells / DsRed+ positive cells (radio). Figure 29C shows cell viability in MMS-treated wild type and centSIRT6 ("Cent") hMSCs. hMSCs were treated with MMS for 48 hours and cell viability was assessed by MTS assay. Data was normalized to the control group (0 mM). n=6. FIG. 29D shows immunofluorescence staining of 53BP1 in wild-type and centSIRT6 ("Cent") hMSCs with MMS treatment. The number of 53BP1 foci in nuclei of wild-type and centSIRT6 hMSCs with or without MMS (0.25 mM) treatment was quantified. More than 600 nuclei from 10 images were scored. FIG. 29E shows qRT-PCR analysis of SIRT6 expression in wild-type and centSIRT6 ("Cent#1" and "Cent#2") hMSCs (P2). Data are normalized to actin and expressed as mean±SEM, with NS representing not significant. FIG. 29F shows this quantification. Error bars represent sd. Significance was determined by two-tailed Student's t-test. Asterisks indicate p<0.05. [Diagram 30]Figures 30A-30C are a combination of photographs and histograms showing overexpression of SIRT6 (wild type, SIRT6 N308K or centSIRT6 ("Cent")) in human Werner syndrome immortalized fibroblasts. Figure 30A shows proliferation assays of the same cells using Hoechst fluorescent staining at 24, 48 and 72 hours. Data are shown as mean + SEM. Figure 30B shows telomere length assays that showed significant differences in all transfected cells compared to untransfected control cells (* = compared to control). Figure 30C shows that telomerase activity assays identified a significant decrease in the centSIRT6 group ("Cent") compared to untransfected control cells. [Diagram 31] Figures 31A-31B are a combination of photographs and histograms showing that SIRT6 overexpression (wild type, SIRT6 N308K or centSIRT6 ("Cent")) induces cell death in hepatocellular carcinoma cell lines 12 days after LV transfection and 3 days after hygromycin selection. Figure 31A shows that SIRT6 WT / SIRT6 N308K / centSIRT6 ("Cent") overexpression was lethal in human hepatocellular carcinoma (HCC) cells, with a greater effect observed with SIRT6 N308K / centSIRT6 ("Cent"). Figure 31B represents quantification of cell viability illustrated in Figure 31A. [Diagram 32] FIG. 32 is a graph showing that SIRT6 overexpression (wild type, SIRT6 N308K or centSIRT6 ("Cent")) increases differentiation of 3T3-L1 preadipocytes (quantification of immunofluorescence). [Diagram 33]Figures 33A-33E are a combination of photographs and histograms showing the effect of SIRT6 overexpression (wild type, SIRT6 N308K or centSIRT6 ("Cent")) in hepatic stellate cells (LX2). Figure 33A shows the viability of LX2 cells 24 hours after transfection of SIRT6 (WT or mutant). Figures 33B-33E show gene expression (mRNA) in LX2 cells with or without overexpression of SIRT6 after 24 h of TGF-β 20 ng treatment for vimentin (Figure 33B), TIMP1 (Figure 33C), COL1A1 (Figure 33D) and αSMA (Figure 33E) (N=4; *=p<0.05 compared to each control). [Diagram 34] Figures 34A-34C are a combination of histograms showing the effect of SIRT6 overexpression (WT, SIRT6 N308K, and centSIRT6 ("Cent")) in spheroids generated from immortalized human hepatocytes (IHH) and human hepatic stellate cells (LX2). Spheroids are formed from IHH cells and LX2 at 5% of the total cell mass. Figure 34A shows quantification of collagen I in IHH-LX2 spheroids overexpressing or not overexpressing centSIRT6 ("Cent") (immunofluorescence quantification). Figures 34B-34C show IHH-LX2 spheroid gene expression relative to GAPDH for αSMA, COL1A1, TIMP1, vimentin, and MMP2 in either the absence (Figure 34B) or presence (Figure 34C) of free fatty acids (FFAs) (*p<0.05; **p<0.05 vs. respective controls). p<0.01;*** p<0.001). DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0041] Detailed Description The present inventors herein used an alternative candidate function-associated approach to directly identify rare longevity gene variants enriched in the genomes of a cohort of Ashkenazi Jewish (AJ) centenarians.

[0042] Based on previous evidence of DNA damage as a driver of aging, we performed targeted sequencing of 301 genes involved in genome maintenance (GM), a major longevity assurance system, in 496 AJ centenarians and 572 controls.

[0043] Among the 10 GM genes containing nominally significant missense gene variants enriched in the genomes of centenarians, SIRT6, or deacylase and mono ADP-ribosyltransferase (mADPr) enzyme-6, was involved in both DNA double-strand break (DSB) repair and longevity in model organisms.

[0044] We selected two genetically linked variants (N308K and A313S) in the same allele for further functional analysis.Characterization of this SIRT6 centenarian allele (centSIRT6) demonstrated that it was a more potent suppressor of LINE1 retrotransposons, conferred enhanced stimulation of DNA DSB repair, and more robust cancer cell killing compared to the wild-type allele.

[0045] Surprisingly, centSIRT6 exhibited weaker deacetylase activity compared to the wild type. Conversely, its mADPr activity was strongly enhanced. FRET-based analysis demonstrated that centSIRT6 had a more open conformation. centSIRT6 showed stronger interaction with lamin A / C (LMNA), which correlated with enhanced ribosylation of LMNA.

[0046] The present invention relates to an isolated nucleic acid molecule encoding a variant of Sirtuin 6 (SIRT6) having at least 75% identity to the sequence of SEQ ID NO:1, wherein the variant has at least one mutation selected from the group consisting of, including, an N308K substitution, an A313S substitution, and an A313S substitution with respect to the sequence of SEQ ID NO:1.

[0047] As used herein, the phrase "at least 75% identity" encompasses 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% and 100% identity.

[0048] The level of identity of two polypeptides can be carried out by using any one of the known algorithms available in the state of the art. By way of example, the percentage of amino acid identity may be determined using the CLUSTAL W software (version 1.83), the parameters of which are set as follows: - For slow / exact alignment: (1) gap opening penalty: 10.00; (2) gap extension penalty: 0.1; (3) protein weight matrix; BLOSUM; - For fast / approximate alignment: (4) gap penalty: 3; (5) K-tuple (word) size: 1; (6) optimal number of diagonals: 5; (7) window size: 5; (8) evaluation method: percent.

[0049] In certain embodiments, the isolated nucleic acid molecule encodes a variant of SIRT6 having at least 80%, preferably at least 85%, more preferably at least 90%, more preferably at least 95%, and most preferably at least 96%, 97%, 98% or 99% identity to SEQ ID NO:1, wherein the variant has at least one mutation selected from the group consisting of, or including, an N308K substitution and an A313S substitution with respect to the sequence of SEQ ID NO:1.

[0050] Within the scope of the present invention, the sequence of SEQ ID NO: 1 refers to the sequence of 361 amino acid residues of wild-type SIRT6 polypeptide. Indeed, the substitutions N308K and A313S refer to the mutations of the codons encoding the naturally occurring Asn (N) amino acid residue at position 308 in SIRT6 polypeptide and the Ser (S) amino acid residue at position 313 in SIRT6 polypeptide, respectively.

[0051] Within the scope of the present invention, the sequence SEQ ID NO: 5 refers to the 1,068 nucleotide (bp) sequence of the wild-type SIRT6 polypeptide.

[0052] In some embodiments, the naturally occurring Asn (N) amino acid residue at position 308 in a SIRT6 polypeptide is encoded by the codon "aac" at positions 922-924 of SEQ ID NO: 5. In some embodiments, the naturally occurring Ser (S) amino acid residue at position 313 in a SIRT6 polypeptide is encoded by the codon "gcc" at positions 937-939 of SEQ ID NO: 5.

[0053] In a particular embodiment, the N308K substitution is represented by a mutation of the codon "aac" at positions 922-924 of SEQ ID NO: 5 to the codon "aag" or to the codon "aaa", preferably to the codon "aag". In other words, the N308K substitution is represented by a mutation of the nucleotide "c" at position 924 of SEQ ID NO: 5 to the nucleotide "g" or to the nucleotide "a", preferably to the nucleotide "g".

[0054] In a particular embodiment, the A313S substitution is represented by a mutation of the codon "gcc" at positions 937 to 939 of SEQ ID NO:5 to a codon selected from the group consisting of the codons "tcc", "tct", "tca" and "tcg", preferably the codon "tcc". In other words, the A313S substitution is represented by one or two mutations (which may be multiple) selected from the group consisting of: a mutation of nucleotide "g" at position 937 of SEQ ID NO:5 to nucleotide "t"; a mutation of nucleotide "g" at position 937 of SEQ ID NO:5 to nucleotide "t" and of nucleotide "c" at position 939 of SEQ ID NO:5 to nucleotide "t"; a mutation of nucleotide "g" at position 937 of SEQ ID NO:5 to nucleotide "t" and of nucleotide "c" at position 939 of SEQ ID NO:5 to nucleotide "a"; and a mutation of nucleotide "g" at position 937 of SEQ ID NO:5 to nucleotide "t" and of nucleotide "c" at position 939 of SEQ ID NO:5 to nucleotide "g".

[0055] In some embodiments, the nucleic acid molecule is a nucleic acid molecule of a sequence selected from the group comprising or consisting of SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.

[0056] As used herein, the sequence of SEQ ID NO:6 refers to the nucleic acid sequence of a variant of SIRT6 having an N308K substitution, specifically a mutation of the codon "aac" at positions 922-924 of SEQ ID NO:5 to the codon "aag."

[0057] As used herein, the sequence of SEQ ID NO:7 refers to the nucleic acid sequence of a variant of SIRT6 having an A313S substitution, specifically a mutation of the codon "gcc" at positions 922-924 of SEQ ID NO:5 to the codon "tcc".

[0058] As used herein, the sequence of SEQ ID NO:8 refers to the nucleic acid sequence of a variant of SIRT6 having an N308K and an A313S substitution, in particular a mutation of the codon "aac" at positions 922-924 of SEQ ID NO:5 to the codon "aag", and a mutation of the codon "gcc" at positions 922-924 of SEQ ID NO:5 to the codon "tcc".

[0059] In some embodiments, the variant of SIRT6 encoded by the isolated nucleic acid molecule defined herein has deacylase and / or mono ADP-ribosyltransferase (mADPr) activity.

[0060] In practice, the deacylase activity and mono ADP ribosyltransferase (mADPr) activity can be assayed according to any suitable method from the state of the art or a method adapted therefrom. By way of example, the deacylase activity can be measured by the reaction of NAD + , MgCl2, DTT in vitro, and performing Western blot analysis using anti-H3K9ac and anti-H3K18ac antibodies. By way of example, mono ADP-ribosyltransferase (mADPr) activity can be assayed by contacting the SIRT6 variant with histones in the presence of ZnCl2, MgCl2, DTT, and performing Western blot analysis using anti-H3K9ac and anti-H3K18ac antibodies. +SIRT6 variants can be assayed by contacting PARP1 in vitro in the presence of , DTT, salmon sperm DNA, and performing Western blot analysis using an anti-PADPR antibody.

[0061] In certain embodiments, the variant of SIRT6 has at most about 90%, preferably at most about 50%, more preferably at most about 25% deacylase activity compared to wild-type SIRT6 (sequence of SEQ ID NO: 1). Within the scope of the present invention, the expression "at most about 90%" includes about 90%, 85%, 80%, 75%, 70%, 65%, 60%, 55%, 50%, 45%, 40%, 35%, 30%, 25%, 20%, 15%, 10%, 5%, 1% or less.

[0062] In some embodiments, the variant of SIRT6 has at least 100%, preferably at least about 200%, more preferably at least about 300% mono ADP-ribosyltransferase (mADPr) activity compared to wild-type SIRT6 (sequence of SEQ ID NO: 1). Within the scope of the present invention, the expression "at least about 100%" includes about 100%, 120%, 140%, 160%, 180%, 200%, 220%, 240%, 260%, 280%, 300%, 350%, 400%, 450%, 500%, 550%, 600%, 650%, 700%, 750% or more.

[0063] Another aspect of the present invention relates to an isolated polypeptide encoded by a nucleic acid molecule according to the present invention.

[0064] The present invention relates to an isolated polypeptide that is a variant of SIRT6 having at least 75% identity with the sequence of SEQ ID NO:1, said variant having at least one mutation selected from the group consisting of or including the substitution N308K and the substitution A313S with respect to the sequence of SEQ ID NO:1.

[0065] As used herein, the phrase "at least 75% identity" encompasses 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% and 99% identity.

[0066] In certain embodiments, the isolated polypeptide that is a variant of SIRT6 has at least 80%, preferably at least 85%, more preferably at least 90%, more preferably at least 95%, and most preferably at least 96%, 97%, 98% or 99% identity with the sequence of SEQ ID NO:1, and the variant has at least one mutation selected from the group consisting of or including the substitution N308K and the substitution A313S with respect to the sequence of SEQ ID NO:1.

[0067] In some embodiments, the polypeptide is a polypeptide of a sequence selected from the group comprising or consisting of SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4.

[0068] As used herein, the sequence of SEQ ID NO:2 refers to the amino acid sequence of a variant of SIRT6 having an N308K substitution. In some embodiments, the polypeptide of sequence SEQ ID NO:2 is encoded by a nucleic acid molecule of sequence SEQ ID NO:6.

[0069] As used herein, the sequence of SEQ ID NO: 3 refers to the amino acid sequence of a variant of SIRT6 having an A313S substitution. In some embodiments, the polypeptide of the sequence of SEQ ID NO: 3 is encoded by a nucleic acid molecule of the sequence of SEQ ID NO: 7.

[0070] As used herein, the sequence of SEQ ID NO: 4 refers to the amino acid sequence of a variant of SIRT6 having N308K and A313S substitutions. In some embodiments, the polypeptide of the sequence of SEQ ID NO: 4 is encoded by a nucleic acid molecule of the sequence of SEQ ID NO: 8.

[0071] In certain embodiments, the polypeptide is a recombinant polypeptide. As used herein, the term "recombinant polypeptide" refers to a polypeptide that is encoded by an engineered nucleic acid and synthesized by transformation of said engineered nucleic acid into a microorganism or transfection into a eukaryotic cell of interest.

[0072] A further aspect of the present invention relates to a vector comprising the isolated nucleic acid molecule according to the present invention.

[0073] In some embodiments, the vector is a minicircle nucleic acid, a plasmid, a cosmid, or a bacterial artificial chromosome.

[0074] As used herein, the term "minicircle nucleic acid" encompasses non-viral vectors that simply contain a gene expression cassette and do not contain viral and / or bacterial backbone DNA elements from standard plasmids.

[0075] The term "plasmid" as used herein is intended to refer to a small extragenomic DNA molecule most commonly found as a circular double-stranded DNA molecule that can be used as a cloning vector in molecular biology to make and / or modify copies of DNA fragments up to about 15 kb (i.e., 15,000 base pairs). Plasmids can also be used as expression vectors to produce large amounts of a protein of interest encoded by a nucleic acid sequence found within the plasmid downstream of a promoter sequence.

[0076] As used herein, the term "cosmid" refers to a hybrid plasmid that contains cos sequences from lambda phage to allow packaging of the cosmid into the phage head and subsequent infection of bacterial cells; cosmids can be circularized and replicated as plasmids. Cosmids are typically used as cloning vectors for DNA fragments in the size range of about 32-52 kb.

[0077] As used herein, the term "bacterial artificial chromosome" or "BAC" refers to an extragenomic nucleic acid molecule based on a functional fertility plasmid that allows for equal division of said extragenomic DNA molecule after bacterial cell division. BACs are typically used as cloning vectors for DNA fragments in the size range of about 150-350 kb.

[0078] In fact, the vector containing the nucleic acid molecule encoding the variant of SIRT6 can be in the form of a plasmid, in particular resulting from cloning the nucleic acid of interest into a nucleic acid vector. In some embodiments, non-limiting suitable nucleic acid vectors are pBluescript vector, pET vector, pETduet vector, pGBM vector, pBAD vector, pUC vector. In one embodiment, the plasmid is a low copy number plasmid. In one embodiment, the plasmid is a high copy number plasmid.

[0079] In some embodiments, the vector is a viral vector.In some embodiments, the viral vector comprises or is selected from the group consisting of adenovirus; adeno-associated virus (AAV); exosome-associated AAV (exo-AAV); alphavirus; herpesvirus; retrovirus, such as lentivirus or non-integrating lentivirus; vaccinia virus; baculovirus; or virus-like particle, such as particle derived from retrovirus, such as Hepatitis B virus, Parvoviridae; Retroviridae; Flaviviridae; Paramyxoviridae or bacteriophage.

[0080] In certain embodiments, the vector is a viral vector, in particular an adeno-associated viral vector (AAV), an exosome-associated AAV vector (exo-AAV), an adenoviral vector, a retroviral vector, or a herpes viral vector.

[0081] In some embodiments, the adeno-associated viral vector (AAV) is AAV serotype 2 or AAV serotype 5.

[0082] In certain embodiments, vector, particularly viral vector, is exo-AAV vector.As used herein, exo-AAV refers to adeno-associated virus (AAV) vector or its part is associated with extracellular vesicle (also called exosome), and AAV vector is partially fused, embedded or internalized in extracellular vesicle.Extracellular vesicle may express specific protein or marker, for example for targeting purpose.

[0083] In certain embodiments, vectors, particularly viral vectors, do not cross the blood-brain barrier.In some alternative embodiments, vectors, particularly viral vectors, cross the blood-brain barrier.In practice, the choice of viral vectors may depend on the organ or tissue to be targeted.For example, in the case of brain cancer, neurodegenerative disease, Alzheimer's disease and Progeria, vectors that cross the blood-brain barrier may be selected.On the contrary, in the case of obesity, cardiovascular disease, type 2 diabetes, hypercholesterolemia, and ophthalmological disease, vectors that do not cross the blood-brain barrier may be selected.

[0084] In practice, the assessment of whether a vector, particularly a viral vector, crosses the blood / brain barrier can be carried out by any suitable method recognized in the state of the art or adapted therefrom. By way of example, this assessment can be carried out by one of two gold standard experimental measures of blood / brain barrier permeability: (1) LogBB, which is intended to measure the concentration of a compound in the brain divided by the concentration in the blood; and (2) LogPS, which measures the product of permeability and surface area.

[0085] In some embodiments, vectors, particularly viral vectors, comprise a promoter sequence suitable for gene expression in a mammalian individual, preferably a human individual.

[0086] Non-limiting examples of promoter sequences suitable for gene expression in a mammalian individual, preferably a human individual, include the CMV (human cytomegalovirus) promoter, the EF1a (human elongation factor 1 alpha) promoter, the SV40 (simian vacuolating virus 40) promoter, the PGK1 (phosphoglycerate kinase) promoter, the Ubc (human ubiquitin C) promoter, and the like.

[0087] In a particular embodiment, the promoter sequence is preferably a CMV promoter.

[0088] In some embodiments, the vector, in particular the viral vector, further comprises a nucleic acid sequence that facilitates the nuclear localization of the polypeptide encoded by the nucleic acid molecule according to the invention into the target recipient cell. Indeed, these nuclear localization signals (NLS) have been much discussed in the state of the art.

[0089] In certain embodiments, vectors, particularly viral vectors, may contain S / MAR (scaffold / matrix attachment region) nucleic acid sequences. As used herein, S / MAR nucleic acid sequences, also referred to as SAR (for scaffold attachment region) or MAR (for matrix attachment region), are intended to refer to nucleic acid sequences found in nature within the DNA of eukaryotic cell chromosomes and facilitating attachment to the nuclear matrix. In some embodiments, S / MAR nucleic acid sequences may serve as origins of replication. In fact, vectors containing S / MAR nucleic acid sequences may behave as extrachromosomal elements in transfected cells and may be advantageously transmitted to progeny. By way of example, suitable S / MAR nucleic acid sequences may be determined as described in Narwade et al. (Nucleic Acids Research, 2019; 47(14):7247-7261).

[0090] In one aspect, the present invention relates to a suspension comprising a vector according to the present invention.

[0091] In some embodiments, the suspension further comprises a fluid comprising one or more components selected from the group consisting of water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and combinations thereof.

[0092] In certain embodiments, the suspension is formulated for intravenous infusion. In practice, suspensions formulated for intravenous infusion may include saline (e.g., 0.9% NaCl); lactated Ringer's solution; 5% dextrose; colloids such as albumin; and the like; and any combination thereof.

[0093] In one aspect, the invention relates to a cell expressing a polypeptide, the cell being preferably transfected with an isolated nucleic acid molecule or vector according to the invention.

[0094] In certain embodiments, the cell is a eukaryotic cell, preferably an animal cell, more preferably a mammalian cell. As used herein, "mammalian cell" includes non-human mammalian cells and human cells. In some embodiments, the cell is a human cell.

[0095] In some embodiments, the cell is selected from the group including or consisting of a nerve cell, a bone cell, a breast cell, a red blood cell, a white blood cell, a cartilage cell, an epithelial cell, an endothelial cell, a skin cell, a muscle cell, a bladder cell, a kidney cell, a liver cell, a prostate cell, a cervical cell, an ovarian cell, a lung cell, a retinal cell, a conjunctival cell, a corneal cell, an adipocyte, and the like.

[0096] It should be understood that the cell according to the present invention is transfected with the isolated nucleic acid molecule according to the present invention, or is transduced with the isolated nucleic acid molecule according to the present invention, or is in contact with a vector or suspension containing the nucleic acid molecule according to the present invention.The cell therefore contains the nucleic acid molecule, either integrated or not integrated into the genome.In fact, since the vector is an expression system, the nucleic acid molecule encoding the variant of SIRT6 is present in the cell in its final location, i.e. in the cell nucleus and cytoplasm, in a form that allows expression.

[0097] Another aspect of the invention relates to a pharmaceutical composition comprising (i) an isolated nucleic acid molecule, or an isolated polypeptide, or a vector according to the invention, and (ii) a pharma- ceutically acceptable excipient.

[0098] In some embodiments, suitable pharmaceutically acceptable carriers according to the present invention include any conventional solvent, dispersion medium, filler, solid carrier, aqueous solution, coating, antibacterial and antifungal agent, isotonic and absorption delaying agent, and the like.In certain embodiments, suitable pharmaceutically acceptable carriers can include water, saline, phosphate buffered saline, dextrose, glycerol, ethanol, and mixtures thereof.In some embodiments, pharmaceutically acceptable carriers may further include minor amounts of auxiliary substances, such as wetting or emulsifying agents, preservatives or buffers, which increase the shelf life or effectiveness of cells.The preparation and use of pharmaceutically acceptable carriers are well known in the art.

[0099] One aspect of the present invention relates to the use of an isolated nucleic acid molecule or an isolated polypeptide or a vector according to the present invention in modulating ageing and / or senescence and / or life span in an individual, preferably a mammalian individual, more preferably a human individual.

[0100] The term "modulating senescence" as used herein is intended to refer to a process that slows, reduces or stops the aging mechanism, in particular premature aging.

[0101] The term "modulating survival time" as used herein is intended to refer to the process of increasing or improving survival time, in other words, increasing or improving life span.

[0102] The present invention further relates to a method for modulating ageing and / or senescence and / or life span in an individual in need thereof, preferably a mammalian individual, more preferably a human individual, comprising the administration of a therapeutically effective amount of the isolated nucleic acid molecule or the isolated polypeptide or vector according to the invention.

[0103] A further aspect of the invention relates to the use of the isolated nucleic acid molecule or the isolated polypeptide or the vector according to the invention in the repair of double strand breaks in cells, preferably mammalian cells, more preferably human cells.

[0104] The present invention also relates to a method for repairing double strand breaks in a cell, preferably a mammalian cell, more preferably a human cell, comprising the administration of a therapeutically effective amount of the isolated nucleic acid molecule or the isolated polypeptide or vector according to the invention.

[0105] As used herein, "double-stranded break repair" refers to the process of repairing DNA damage that occurs in both strands of double-stranded DNA nucleic acid breaks, allowing DNA integrity to be restored.In practice, double-stranded break repair includes repair mechanisms such as non-homologous end joining (NHEJ) and homology-directed repair (HR).

[0106] In practice, the efficiency of double-strand break repair can be evaluated by any suitable method from the state of the art or a method adapted therefrom. By way of example, the efficiency of double-strand break repair can be evaluated by the method described in Seluanov et al. (J Vis Exp, 2010; doi:10.3791 / 2002).

[0107] Within the scope of the present invention, the nucleic acid molecule, polypeptide, vector, suspension or pharmaceutical composition according to the invention is intended to increase, improve or favour the efficiency of DSB repair in a target cell compared to the efficiency of DSB repair in the absence of any treatment as a reference level.

[0108] As used herein, the term "increasing, improving or reversing the efficiency of DSB repair" encompasses an increase of at least 1.2-fold compared to a reference level. Within the scope of the present invention, the term "at least 1.2-fold" includes an increase of at least 1.2-fold, including 1.2-fold, 1.3-fold, 1.4-fold, 1.5-fold, 1.6-fold, 1.7-fold, 1.8-fold, 1.9-fold, 2.0-fold, 2.2-fold, 2.4-fold, 2.6-fold, 2.8-fold, 3.0-fold, 3.2-fold, 3.4-fold, 3.6-fold, 3.8-fold, 4.0-fold, 4.5-fold, 5.0-fold, 5.5-fold, 6.0-fold, 6.5-fold, 7.0-fold, 7.5-fold, 8.0-fold, 8.5-fold, 9.0 ... .0x, 7.5x, 8.0x, 8.5x, 9.0x, 9.5x, 10x, 15x, 20x, 25x, 30x, 35x, 40x, 45x, 50x, 60x, 70x, 80x, 90x, 100x, 200x, 300x, 400x, 500x, 600x, 700x, 800x, 900x, 1,000x, or more.

[0109] In another aspect, the present invention relates to the isolated nucleic acid molecule or the isolated polypeptide or the vector according to the present invention for use in the prevention and / or treatment of age-related diseases.

[0110] The present invention also relates to the use of an isolated nucleic acid molecule or an isolated polypeptide or a vector according to the invention for the preparation or manufacture of a medicament for the prevention and / or treatment of age-related diseases.

[0111] In some further embodiments, the present invention relates to a method for preventing and / or treating age-related diseases in an individual in need thereof, comprising administration of a therapeutically effective amount of the isolated nucleic acid molecule or isolated polypeptide or vector according to the present invention.

[0112] In certain embodiments, the individual in need thereof is a mammalian individual, preferably a human individual.

[0113] In some embodiments, the age-related disease is selected from the group including or consisting of progeria, Werner's syndrome, neurodegenerative diseases, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, eye disorders, cataracts, glaucoma, osteoporosis, thrombotic disorders, arthritis, hearing loss and stroke.

[0114] In one embodiment, the age-related disease is progeria or Werner's syndrome.

[0115] In some embodiments, the age-related disease is cancer. In certain embodiments, the cancer is a hematological cancer or a solid cancer.

[0116] As used herein, the term "blood cancer," also referred to as "cancer of the blood," includes any cancer involving uncontrolled proliferation of blood cells, particularly white blood cells. Blood cancers include leukemia, lymphoma (Hodgkin's and non-Hodgkin's lymphoma), and myeloma.

[0117] In certain embodiments, the cancer is a hematological cancer, hi some embodiments, the cancer is a hematological cancer selected from the group consisting of Hodgkin's disease, immunoblastic lymphadenopathy, lymphoma, chronic lymphocytic leukemia, acute leukemia, and the like.

[0118] As used herein, the term "solid tumor" includes any cancer (also called a malignant tumor) that forms a discrete tumor mass, as opposed to a cancer (or malignant tumor) that diffusely infiltrates tissue without forming a mass.

[0119] In certain embodiments, the cancer is a solid cancer. In some embodiments, the solid cancer is selected from the group consisting of fibrosarcoma, melanoma, breast cancer, colon cancer, renal cancer, adrenocortical carcinoma, testicular teratoma, skin sarcoma, fibrosarcoma, lung cancer, adenocarcinoma, liver cancer (i.e., hepatoma), glioblastoma, prostate cancer, ovarian cancer, and pancreatic cancer.

[0120] In some embodiments, the age-related disease is selected from the group including or consisting of Hutchinson-Gilford progeria, Werner syndrome, Alzheimer's disease and cancer.

[0121] In some embodiments, the age-related disease is selected from the group including or consisting of Hutchinson-Gilford progeria, Werner syndrome, Alzheimer's disease, and fibrosarcoma.

[0122] In some embodiments, the age-related disease is selected from the group including or consisting of Hutchinson-Gilford progeria, Werner syndrome, Alzheimer's disease, and liver cancer.

[0123] In one embodiment, the age-related disease is liver cancer. In one embodiment, the age-related disease is fibrosarcoma.

[0124] In certain embodiments, the progeria is Hutchinson-Gilford progeria.

[0125] In one embodiment, the age-related disease is Werner's syndrome.

[0126] In some embodiments, a nucleic acid molecule, polypeptide, vector, suspension, or pharmaceutical composition according to the invention should be administered to an individual in need thereof by any suitable route, i.e., by dermal administration, orally, topically, or parenterally, for example by injection, including subcutaneous, intravenous, intraarterial, intramuscular, intraocular, and intra-auricular administration.

[0127] In certain embodiments, the nucleic acid molecules, polypeptides, vectors, suspensions, or pharmaceutical compositions according to the present invention must be administered to an individual in need thereof by dermal administration. In certain embodiments, the nucleic acid molecules, polypeptides, vectors, suspensions, or pharmaceutical compositions according to the present invention are associated with a composition that allows and / or facilitates dermal administration, for example by increasing skin tropism or increasing skin barrier permeability. In some embodiments, dermal administration allows for prolonged release of the nucleic acid molecules, polypeptides, vectors, suspensions, or pharmaceutical compositions according to the present invention.

[0128] In a particular embodiment, the nucleic acid molecule, polypeptide, vector, suspension or pharmaceutical composition according to the invention must be administered to an individual in need thereof by intravenous administration, in particular by intravenous infusion or injection.

[0129] Within the scope of the present invention, the therapeutically effective amount of the nucleic acid molecule, polypeptide, vector, suspension or pharmaceutical composition according to the present invention to be administered may be determined by a physician or an authorized person skilled in the art and may be adapted accordingly during the time course of treatment.

[0130] In certain embodiments, the therapeutically effective amount to be administered may depend on various parameters, including the material selected for administration, whether the administration is a single dose or multiple doses, as well as individual parameters, including age, physical condition, size, weight, sex, and the severity of the age-related disease to be treated.

[0131] In a specific embodiment, a therapeutically effective amount of the isolated polypeptide or pharmaceutical composition comprising the isolated polypeptide and a drug according to the present invention may be within the range of about 0.001 mg to about 3,000 mg per dosage unit, preferably about 0.05 mg to about 100 mg per dosage unit.

[0132] Within the scope of the present invention, the expression "about 0.001 mg to about 3,000 mg" means about 0.001 mg, 0.002 mg, 0.003 mg, 0.004 mg, 0.005 mg, 0.006 mg, 0.007 mg, 0.008 mg, 0.009 mg, 0.01 mg, 0.02 mg, 0.03 mg, 0.04 mg, 0.05 mg, 0.06 mg, 0.07 mg, 0.08 mg, 0.09 mg, 0. ... 2mg, 0.3mg, 0.4mg, 0.5mg, 0.6mg, 0.7mg, 0.8mg, 0.9mg, 1mg, 2mg, 3mg, 4mg, 5mg, 6mg, 7mg, 8mg, 9mg, 10mg, 20mg, 30mg, 40mg, 50mg, 60mg, 70mg, 80mg, 90mg, 100mg, 150mg, 200mg, 250mg, 300mg, 350mg, 400mg, 450mg, 500mg, 550 mg, 600mg, 650mg, 700mg, 750mg, 800mg, 850mg, 900mg, 950mg, 1,000mg, 1,100mg, 1,150mg, 1,200mg, 1,250mg, 1 ,300mg, 1,350mg, 1,400mg, 1,450mg, 1,500mg, 1,550mg, 1,600mg, 1,650mg, 1,700mg, 1,750mg, 1,800mg, 1,850 mg, 1,900mg, 1,950mg, 2,000mg, 2,100mg, 2,150mg, 2,200mg, 2,250mg, 2,300mg, 2,350mg, 2,400mg, 2,450mg, 2,500mg, 2,550mg, 2,600mg, 2,650mg, 2,700mg, 2,750mg, 2,800mg, 2,850mg, 2,900mg, 2,950mg and 3,000mg.

[0133] In certain embodiments, an isolated polypeptide or a pharmaceutical composition comprising an isolated polypeptide according to the present invention may be at a dosage level sufficient to deliver from about 0.001 mg / kg to about 100 mg / kg of a subject's body weight, from about 0.01 mg / kg to about 50 mg / kg of a subject's body weight, preferably from about 0.1 mg / kg to about 40 mg / kg of a subject's body weight, preferably from about 0.5 mg / kg to about 30 mg / kg of a subject's body weight, from about 0.01 mg / kg to about 10 mg / kg of a subject's body weight, from about 0.1 mg / kg to about 10 mg / kg of a subject's body weight, and more preferably from about 1 mg / kg to about 25 mg / kg of a subject's body weight per day. Within the scope of the present invention, the expression "about 0.001 mg / kg to about 100 mg / kg" means about 0.001 mg / kg, 0.002 mg / kg, 0.003 mg / kg, 0.004 mg / kg, 0.005 mg / kg, 0.006 mg / kg, 0.007 mg / kg, 0.008 mg / kg, 0.009 mg / kg, 0.01 mg / kg, 0.02 mg / kg, 0.03 mg / kg, 0.04 mg / kg, 0.05 mg / kg, 0.06 mg / kg, 0.07 mg / kg, 0.08 mg / kg, 0. ... .1mg / kg, 0.2mg / kg, 0.3mg / kg, 0.4mg / kg, 0.5mg / kg, 0.6mg / kg, 0.7mg / kg, 0.8mg / kg, 0.9mg / kg, 1mg / kg, 2mg / kg, 3mg / kg, 4mg / kg, 5mg / kg, 6mg / kg, 7mg / kg, 8mg / kg, 9mg / kg, 10mg / kg, 20mg / kg, 30mg / kg, 40mg / kg, 50mg / kg, 60mg / kg, 70mg / kg, 80mg / kg, 90mg / kg and 100mg / kg.

[0134] In some embodiments, a therapeutically effective amount of an isolated nucleic acid molecule, vector, or pharmaceutical composition according to the invention is about 10 1 ~about 10 15 In practice, the therapeutically effective dose is about 10 1 , 5×10 1 , 10 2 , 5×10 2 , 10 3 , 5×10 3 , 10 4, 5×10 4 , 10 5 , 5×10 5 , 10 6 , 5×10 6 , 10 7 , 5×10 7 , 10 8 , 5×10 8 , 10 9 , 5×10 9 , 10 10 , 5×10 10 , 10 11 , 5×10 11 , 10 12 , 5×10 12 , 10 13 , 5×10 13 , 10 14 , 5×10 14 and 10 15 In certain embodiments, the therapeutically effective amount is about 10 1 , 5×10 1 , 10 2 , 5×10 2 , 10 3 , 5×10 3 , 10 4 , 5×10 4 , 10 5 , 5×10 5 , 10 6 , 5×10 6 , 10 7 , 5×10 7 , 10 8 , 5×10 8 , 10 9 , 5×10 9 , 10 10 , 5×10 10 , 10 11 , 5×10 11 , 10 12 , 5×10 12 , 10 13 , 5×10 13 , 10 14 , 5×10 14 and 10 15 Copy / cm 3 Including about 10 1 ~about 10 15 Copy / cm 3 In some embodiments, the therapeutically effective amount is about 101 , 5×10 1 , 10 2 , 5×10 2 , 10 3 , 5×10 3 , 10 4 , 5×10 4 , 10 5 , 5×10 5 , 10 6 , 5×10 6 , 10 7 , 5×10 7 , 10 8 , 5×10 8 , 10 9 , 5×10 9 , 10 10 , 5×10 10 , 10 11 , 5×10 11 , 10 12 , 5×10 12 , 10 13 , 5×10 13 , 10 14 , 5×10 14 and 10 15 Copies / Dose included, approximately 10 1 ~about 10 15 Copies / dose.

[0135] In a particular embodiment, the isolated nucleic acid molecule, isolated polypeptide, vector, suspension or pharmaceutical composition according to the invention must be co-administered or sequentially administered with a drug suitable for preventing and / or treating an age-related disease, in particular a disease selected in the group consisting of progeria, Werner's syndrome, neurodegenerative diseases, Alzheimer's disease, cancer, cardiovascular diseases, obesity, type 2 diabetes, hypercholesterolemia, hypertension, eye disorders, cataracts, glaucoma, osteoporosis, thrombotic disorders, arthritis, hearing loss and stroke.

[0136] As used herein, the term "co-administered" refers to simultaneous administration of active ingredients. As used herein, the term "sequential administration" refers to administration of a first active ingredient before or after administration of a second active ingredient.

[0137] Another aspect of the invention relates to a kit comprising (i) an isolated nucleic acid, isolated polypeptide molecule, vector, or suspension according to the invention, and (ii) a means for administering the isolated nucleic acid molecule, isolated polypeptide, vector, or suspension.

[0138] In some embodiments, the means for administering the isolated nucleic acid molecule, isolated polypeptide, vector, or suspension comprises a syringe or catheter.

[0139] Another aspect of the invention relates to a method of increasing adipogenic differentiation in a subject comprising administering an effective amount of a polypeptide or a nucleic acid molecule encoding the polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to an amino acid sequence comprising or selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to a nucleic acid sequence comprising or selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.

[0140] Another aspect of the invention relates to an in vitro method for increasing adipogenic differentiation of a cell or cell population, comprising exposing the cell or cell population to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid molecule encoding, an amino acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell or cell population is a preadipogenic cell.

[0141] Another aspect of the invention relates to a method of reducing α-SMA expression in a subject comprising administering an effective amount of a polypeptide, or a nucleic acid molecule encoding it, having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to an amino acid sequence comprising or selected from the group consisting of SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to a nucleic acid sequence comprising or selected from the group consisting of SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:8.

[0142] Another aspect of the invention relates to an in vitro method for reducing α-SMA expression in a cell or cell population, comprising exposing the cell or cell population to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid molecule encoding, an amino acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell or cell population is a preadipocyte.

[0143] Another aspect of the invention relates to a method of decreasing collagen expression in a subject comprising administering an effective amount of a polypeptide or a nucleic acid molecule encoding the polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to an amino acid sequence comprising or selected from the group consisting of SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to a nucleic acid sequence comprising or selected from the group consisting of SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8.

[0144] In some embodiments, the collagen comprises or is selected from the group consisting of type I collagen, type II collagen, type III collagen, type V collagen, and type IX collagen. In some embodiments, the collagen is type I collagen. In some embodiments, the type I collagen is type I alpha 1 collagen or type I alpha 2 collagen. In some embodiments, the type I collagen is type I alpha 1 collagen and is encoded by the COL1A1 gene.

[0145] Another aspect of the invention relates to an in vitro method for reducing collagen expression in a cell or cell population, comprising exposing the cell or cell population to an effective amount of a polypeptide having at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid molecule encoding, an amino acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 2, SEQ ID NO: 3 and SEQ ID NO: 4. In some embodiments, the nucleic acid molecule has at least 75%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, 99%, 99.5 or 100% sequence identity to, or a nucleic acid sequence comprising, or selected from the group consisting of, SEQ ID NO: 6, SEQ ID NO: 7 and SEQ ID NO: 8. In some embodiments, the cell or cell population is a preadipocyte.

[0146] In some embodiments, the collagen comprises or is selected from the group consisting of type I collagen, type II collagen, type III collagen, type V collagen, and type IX collagen. In some embodiments, the collagen is type I collagen. In some embodiments, the type I collagen is type I alpha 1 collagen or type I alpha 2 collagen. In some embodiments, the type I collagen is type I alpha 1 collagen and is encoded by the COL1A1 gene.

[0147] Working Example The invention and disclosure are further illustrated by the following examples.

[0148] Example 1 1. Materials and Methods 1.1. Test subjects and sample collection The study population consisted of 1068 Ashkenazi Jewish (AJ) samples previously collected as part of the Longevity Study at the Albert Einstein College of Medicine: 496 AJ centenarians and 572 AJ controls. Centenarians were defined as healthy individuals living independently at age 95 years or older, and controls were defined as individuals with no family history of rare longevity, and whose parents survived to age 85 years or younger. Written informed consent was obtained in accordance with the policies of the Committee on Clinical Investigations at the Albert Einstein College of Medicine. Genomic DNA was extracted from blood samples and amplified using the Illustra GenomiPhi V2 DNA Amplification kit (GE healthcare Life Sciences®).

[0149] 1.2.2 Rounds of targeted sequencing In stage 1, 301 candidate genes involved in genome maintenance were selected and sequenced in 51 centenarians and 51 controls. The full list of 301 candidate genes is provided in Table 1. [Table 1] TIFF2024518665000003.tif85165

[0150] The SureSelectXT target enrichment platform (Agilent®) was applied to design and capture genomic regions covering exons, exon-intron junctions, and 2 kb proximal promoter sequences of candidate genome-maintained genes. Individually indexed libraries were sequenced by Illumina® HiSeq2000. Sequence reads were aligned using BWA and variants were called by GATK. All variants in the 102 samples were characterized and functionally annotated using ANNOVAR. To prioritize candidate genes, UMINP (univariate minP) gene-based permutation association (n=100) was performed, and 122 genes showing a nominal p-value of less than 0.05 were identified, considering the effect of at least one significant single variant (Table 2). [Table 2] TIFF2024518665000005.tif90163

[0151] Gene ontology (GO) enrichment analysis was performed using the clusterProfiler package to identify significant gene enrichment in 122 UMINPs in DNA double-strand break repair functions.

[0152] In stage 2, 106 candidate genes involved in DNA double-strand break repair were selected and sequenced in 496 centenarians and 572 controls. A list of the 106 DSB repair genes is provided in Table 3. [Table 3]

[0153] Target capture sequencing was performed pooling 25 samples. Briefly, 25 samples from the same group were pooled together at the same molar concentration, and a total of 20 centenarian pools and 23 control pools were used to create indexed libraries according to the Illumina® TruSeq DNA sample preparation low-throughput (LT) protocol. The captured libraries were further created using SeqCap EZ Choice Enrichment Kit (Roche®) to enrich genomic regions covering exons, exon-intron junctions, and 2kb proximal promoter sequences of candidate DSB genes, and sequenced by Illumina® HiSeq2000. Sequence reads were aligned using BWA, and variants were called using CRISP (Comprehensive Read analysis for Identification of Single Nucleotide Polymorphisms), a software developed specifically for calling variants in pooled DNA sequence data. All variants in 1068 samples were characterized and functionally annotated using ANNOVAR. To test for longevity associations, we performed different subtypes of SKAT analysis, including SKAT (Sequencing Kernel Association Test) for rare variants, SKAT-C (common and rare) for all variants, and SKAT-O (enriched in centenarians or controls only) for directional variants (Table 4). [Table 4]

[0154] 1.3.Cell lines HEK293 SIRT6 overexpression lines were generated by transfecting HEK293 cells with a linear CMV-SIRT6 plasmid via jetPRIME transfection reagent and selecting stably integrated clones. To generate normal human fibroblasts expressing WT and centenarian alleles of SIRT6 under the control of a coumat-inducible promoter (coumatSIRT6 fibroblasts), constructs containing SIRT6 alleles under the control of the coumat promoter were integrated into the genome of telomerase-immortalized SIRT6-KO human HCA2 foreskin fibroblasts via the PiggyBac Transposon Vector System. Endogenous SIRT6 was knocked out in these cells using CRISPR / Cas-9. NHEJ and HR reporter assays were performed with the telomerase-immortalized HCA2 human fibroblast cell line containing the integrated reporter constructs (I9A and H15C). Antitumor activity was evaluated using HT1080 and HeLa cell lines.

[0155] 1.4.Cell lines All cell lines were maintained in a humidified incubator with 5% CO2, 5% O2 at 37°C. Cells were grown in Eagle's minimum essential medium with 15% fetal bovine serum and 1x penicillin / streptomycin, except for HEK293, HT1080 and HeLa cells, which were cultured in DMEM with D-glucose and L-glutamine. Cell lines are routinely tested for mycoplasma contamination.

[0156] 1.5.Western Blot Cells and reactions were harvested using 2x Laemmli's solution and incubated on ice for 15 minutes while passing samples through a large gauge needle several times and vortexing every 5 minutes. Samples were then spun down at 14,000 RPM to remove cell debris and the supernatant transferred to a new tube. Samples were heated in boiling water for 20 minutes, then centrifuged at 14,000 RPM for 1 minute and loaded onto a BioRad® Criterion 4-20% gel. After transfer to a PDVF membrane and blocking (5% milk powder) for 2 hours at RT (room temperature), the membrane was incubated with antibody in 2.5% blocking buffer overnight at 4°C. The membrane was washed 3 times for 10 minutes with TBST, then secondary antibody in 1x TBST was added for a 2 hour incubation at RT. The membrane was washed 3 times for 10 minutes with TBST before imaging.

[0157] The following antibodies were used: H3 (Abcam® ab500) - 1:5,000, H3K9ac (Abcam® ab4441) - 1:1,000, H3K18ac (Abcam® ab1191) - 1:1,000, β-tubulin (Abcam® ab6046) - 1:10,000, SIRT6 (Cell Signaling® #12486)-1:1,000, AbD33204 (rabbit, REF)-1:500, Lamin A / C-1:1,000 (Abcam® ab108595, Millipore® 05-714), γH2AX (Millipore® 05-636), PARP1 (Abcam® ab227244)-1:1,000, mADPr 1:500 (AbD33204 and AbD33205).

[0158] 1.6. Immunoprecipitation (IP) Cells were seeded and grown with the same dose of coumarate for 48 hours before IP. Briefly, cells were harvested via trypsin and centrifugation, then lysed with IP buffer (20 mM HEPES pH=8, 0.2 mM EDTA, 5% glycerol, 150 mM NaCl, 1% NP40) + COMplete® protease inhibitors for 10 minutes on ice. The lysate was sonicated for 10 pulses at 25% power, after which cell debris was pelleted by centrifugation at 13000 RPM for 10 minutes at 4°C. The supernatant was transferred to a new tube and pre-cleared with A / G Sepharose beads on a rotor for 1 hour at 4°C. The beads were removed by centrifugation, and the cleared sample was transferred to a new tube. 50 μl of sample was saved as input control. Samples were incubated overnight at 4° C. with antibody (SIRT6; Cell Signaling®) #12486 3 μg; PARP1-Abcam® ab227244; Lamin A / C-Millipore® 05-714; AbD33204, AbD33205, then incubated with 30 μl 25% Sepharose at 4° C. for 2 hours. Samples were pelleted by centrifugation and beads were washed 5 times with IP buffer. Final resuspension in 100 μl IP buffer.

[0159] 1.7.DNA repair assay Both NHEJ and HR efficiency were assessed as previously described in Seluanov et al. (J Vis Exp, 2010; doi:10.3791 / 2002). Briefly, I-Sce1, SIRT6 or HPRT control, and dsRED plasmids were transfected into telomerase-immortalized human foreskin fibroblasts containing chromosomally integrated NHEJ or HR reporter cassettes (I19A or H15C) cells. Cells were left to recover for 3 days and then analyzed by flow cytometry. Efficiency was calculated as the ratio of GFP events to dsRED events.

[0160] 1.8.Transfection Transfection was performed by seeding cells at a density of 500,000 cells / 10 cm plate 2 days prior to transfection. Transfection was performed using Amaxa® Nucleafector with normal human dermal fibroblast transfection solution according to the manufacturer's protocol. For transfection of cancer cells, JetPRIME transfection reagent was used to deliver plasmids to cells.

[0161] 1.9. Quantitative RT-PCR Total RNA was isolated from cells at 80% confluency using Trizol reagent and then treated with DNase. cDNA was synthesized using Superscript III (Life Technologies®) cDNA kit with OligodT primer. qRT-PCR was performed with BioRad® CFX Connect Real Time instrument and SYBR™ Green Master Mix (BioRad®) using cDRA 30ng / reaction at 3x reactions / sample. All primer sets (see Table 5 below) were tested for specificity and efficiency. Actin was assayed using Quantum mRNA Actin Universal primer (Thermo Fisher Scientific® AM1720). [Table 5]

[0162] 1.10. Immunofluorescence and Apoptosis γH2AX immunostaining was performed as previously described in Mao et al. (Science, 2011; Vol. 332:1443-1446). Anti-γH2AX antibody was purchased from Millipore® (05-636). Fibroblast apoptosis was measured using the Annexin V Staining Kit (Roche®).

[0163] 1.11. Gamma irradiation Cells were grown to 75% confluency and then treated on the coated slides. A Cs-137 irradiator was used to deliver 2 Gy of radiation to the cells. The cells were transferred to a container at 37°C and the medium was replaced after exposure.

[0164] 1.12. Paraquat treatment Cells were maintained at 75% confluency, at which point fresh medium lacking sodium pyruvate and containing paraquat was added. Cells were maintained in the treated medium for 24 hours and then replaced with fresh medium lacking sodium pyruvate. After 48 hours of treatment, cells were stained and assessed for apoptosis.

[0165] SIRT6 protein purification His-tagged SIRT6 cDNA was cloned into pET11a vector and transformed into Rosetta-Gami E. coli cells. Cells were grown in the presence of antibodies and then harvested after induction of protein production with 0.5 mM IPTG for 2 hours. Cells were pelleted by centrifugation and lysed with a solution of 50 mM Tris-HCl (pH=7.5), 300 mM NaCl, 10% glycerol and 10 mM imidazole with EDTA-free protease inhibitor (Sigma-Aldrich® #8849) and 1 mg / ml egg white lysozyme for 1 hour on ice, then sonicated in a Branson apparatus. After removal of cell debris by centrifugation, the lysate was incubated overnight with Ni2+-NTA agarose. The solution containing the beads was placed in a gravity column and washed with lysis solution, followed by 2 volumes of wash buffer (lysis buffer + 30 mM imidazole). Finally, the protein was eluted with elution buffer (lysis buffer + 500 mM imidazole) and fractions were collected. Protein concentration was assessed by bicinchoninic acid (BCA) assay and run on an SDS-PAGE gel. The 3-4 most concentrated fractions were pooled and dialyzed against storage buffer (50 mM Tris-HCl pH=7.5, 150 mM NaCl, 1 mM DTT, 5% glycerol).

[0166] 1.14. Stable isotope labeling of amino acids in cell culture (SILAC) Turnover experiments were performed using HEK293 cell lines stably expressing SIRT6 WT or centSIRT6. Cells were supplemented with 10% dialyzed FBS (Gibco®), L-glutamine, L-arginine, and 10% ethanol. 13 C6 15 N4 (Cambridge Isotopes®), and L-lysine 13 C6 15 Cells were cultured in SILAC-grade MEM (Thermo Fisher Scientific®) supplemented with N2 (Cambrige Isotopes®) for 1 week until confluent. The medium was replaced with regular culture medium and cell pellets were harvested at 0, 2, 4, 6, 8, 12 and 24 h after medium replacement. Cell pellets were dissolved in a buffer containing 8 M urea, 75 mm NaCl, 50 mM Tris pH 8.5 with a protease inhibitor cocktail (Roche®). The pellets were vortexed for 30 seconds and sonicated five times for 10 seconds with a 1 minute pause in ice between sonication steps. The lysates were centrifuged at 15,000×g for 10 minutes, after which the supernatant was collected.

[0167] SIRT6 deacylation activity The substrate for this reaction was a synthetic TNF-derived peptide originally developed by Schuster et al. (Sci Rep, 2016; Vol. 6:22643) and synthesized by Genscript®. Reactions were performed with 150 mM NaCl, 20 mM Tris, 5% glycerol, 1 mM β-mercaptoethanol, 2 μM SIRT6, and substrate concentrations ranging from 7 to 1000 μM NAD+ and 2 to 88 μM peptide. Reactions were performed at 37°C and fluorescence was measured using a 310 / 405 nm excitation / emission spectrum on a Tecan Spark 20M plate reader. Readings were taken every 30 seconds and initial rates were calculated from the relative fluorescence increase over a minimum of 6 minutes.

[0168] 1.16.Histone Analysis Histones were purified from CoumatoSIRT6 fibroblasts (SIRT6 KO primary human foreskin fibroblasts constitutively expressing the catalytic subunit of telomerase and various alleles of SIRT6 via a Coumato-inducible promoter) by using an established acid extraction method followed by propionylation of lysines prior to trypsin digestion to enhance coverage. After samples were separated by nano-LC using EpiProfile® or after 1 minute acquisition and analysis by EpiProfileLite® following direct fusion, a data-independent analysis (DIA) mass spectrometry (MS) method was used to quantify modified peptides.

[0169] 1.17. Analysis of SIRT6 and LMNA protein-protein interactions by mass spectrometry C-SIRT6 fibroblasts were used to compare the interaction with centSIRT6 and wild-type SIRT6. Nuclear extracts were prepared using hypotonic lysis buffer. Approximately 2.5 × 10 7Nuclei isolated from cells were resuspended in 1 ml of extraction buffer (50 mM TrisHCl pH 7.5, 150 mM NaCl, 10% glycerol, 5 mM DTT, 0.25% NP-40, 1x Roche® Complete protease inhibitors plus kinase / phosphatase inhibitors 1 mM NaVO4, 10 mM beta-glycerophosphate, 1 mM sodium pyrophosphate, 1 mM NaF) and disrupted by passing through a 27-gauge needle followed by sonication in a Branson® sonicator on ice (3 pulses at a constant 20% power). Samples were then filtered through a 0.2 μm MWCO filter to remove any insoluble material (and reduce non-specific binding). Protein was quantified using the BCA assay and equal amounts of wild-type SIRT6 and centSIRT6 derived extracts were split into 5 tubes each. Triplicate extracts received 4 μg anti-SIRT6 antibody (Cell Signaling® #1248) or anti-Lamin A (Lamin A / C-Millipore® 05-714) and 75 μl Mitenyi® Protein G μMACS magnetic particles. Duplicate samples were mixed with normal rabbit IgG (Cell Signaling® #2729) as a control for non-specific binding to the particles. Samples were rotated for 6 hours at 4° C. before being separated magnetically. Samples were washed with an additional 3 ml extraction buffer and eluted with 100 μl boiling elution buffer (5% SDS with 5 mM Tris-HCl pH 7.5). After SDS removal and trypsin digestion on S-columns (Protifi®; Huntington, NY), peptides were resuspended in MS grade water and labeled with tandem mass tags (TMT 10-plex Thermo Fisher Scientific®). Samples were digested and peptides resolved by nanoelectrospray ionization on an Orbitrap Fusion Lumos MS instrument (Thermo Fisher Scientific®) in positive ion mode using a 30 cm homemade column packed with 1.8 μm C-18 beads.Solvent A was 0.1% formic acid and solvent B was 100% acetonitrile (CAN) with 0.1% formic acid. The length of the run was 2 h with a 90 min gradient. CID (35% collision energy) was used for MS2 fractionation. HCD (60% collision energy) was used for MS3 detection of the TMT group. Other details of the measurement parameters can be found in the embedded measurement report of the raw data file uploaded to the ProteomeXchange database. Peptide assignments were made using Proteome Discoverer and Sequest and MS3 ions were used for quantification. False discovery rates (FDR) were estimated using Decoy Database Search with Target FDR (strict) set to 0.01 and Target FDR (relaxed) set to 0.05. Validation was based on q values. In the consensus step, ions with a co-isolation threshold above 30% were excluded. Normalization between replicates was achieved using a total protein approach, where the number of peptides for a single protein is divided by the sum of all proteins in a lane. Proteins that appeared in specific antibodies (either anti-SIRT6 or anti-lamin A) compared to normal IgG serum using a Student's t-test were considered interactions. Similarly, proteins showing higher levels in centSIRT6 compared to wild-type SIRT6 were based on p<0.05.

[0170] 1.18. SIRT6-NAD+ binding by tryptophan fluorescence 1 μM SIRT6 protein in 50 μl of buffer (50 mM Tris-HCl pH=7.5 and 150 mM NaCl) was mixed in the range of NAD+ (0-2 mM). Samples were then placed in a 384 Corning® flat bottom black plate and analyzed on a Tecan Spark® 20M plate reader. Fluorescence was measured from 300-400 nm in 2 nm steps using 280 nm excitation. Background quenching by NAD+ of 7 M urea denatured SIRT6 was subtracted from the spectra as previously described by Pan et al. (J Phys Chem B, 2011; Vol. 115:3245-3253).

[0171] 1.19. Deacetylase Assay SIRT6 protein (3 μg) was added to 0.5 μg histones and 1 or 5 mM NAD + , 30 mM Tris-HCl pH=8, 4 mM MgCl2, 1 mM DTT and ddH2O to 50 μl. All reagents were prepared on ice and transferred to 37°C for the duration of the incubation. The reaction was quenched by direct application of 1 volume of 2x Laemmli buffer containing BME. Samples were boiled for 15 min and then run for Western analysis using anti-H3K9ac and anti-H3K18ac antibodies.

[0172] 1.20.PARP1 Ribosylase Assay 5 μg of SIRT6 protein was mixed with 100 fm PARP1, 20 mM Tris-HCl pH=8, 10 μM ZnCl2, 10 mM MgCl2, 10% glycerol, 300 μM NAD+, 1 mM DTT, 0.1 μg / ml salmon sperm DNA and ddH2O to 50 μl. All reagents were prepared on ice and transferred to 37°C for 30 minutes. The reaction was quenched by direct application of 1 volume of 2x Laemmli buffer containing BME. Samples were boiled for 15 minutes and then run in a Western analysis using anti-PADPR antibody.

[0173] 1.21. Auto-ribosylation assay SIRT6 3μg, 50mM Tris-HCl pH=7.5, 1mM DTT, 10μM ZnCl2, 150mM NaCl, 25μM NAD+, 1μl [ 32 P]-NAD+ (800 Ci / mmol, 5 mCi / ml; Perkin Elmer® BLU023x250UC) and ddH2O to 20 μl. All reagents were mixed in the master mix on ice except for SIRT6. The master mix was aliquoted into reaction tubes and SIRT6 was added and incubated at 37°C for 3 hours. The reaction was quenched with 1 volume of 2x Laemmli buffer with BME. Samples were boiled and then run on an SDS-PAGE gel and transferred to a PDPF membrane. Autoribosylation was assayed using a phosphorimager.

[0174] 1.22.Thermal stability 4 μM SIRT6 protein was mixed with 1× SYPRO™ Orange dye in storage buffer (50 mM Tris-HCl pH=7.5, 150 mM NaCl, 1 mM DTT, 5% glycerol) to 50 μl. Samples were loaded into a qRT-PCR plate and run on a BioRad® CFX Connect Real Time instrument using a melting curve protocol (30°C to 75°C, 0.5°C steps at 10 second intervals).

[0175] 1.23.FRET Mutagenesis to generate the centenarian mutant (N308K / A313S) was performed using the NEB Q5 site-directed mutagenesis kit following the protocol for primer design.

[0176] HEK293-6E cells were transfected with 293fectin® reagent according to the manufacturer's instructions (Thermo Fisher Scientific®). The SIRT6 biosensor was expressed using the mammalian expression vector pTT5 (National Research Council, Canada). After 2 days of culture, approximately 30 million cells were generated creating a transiently transfected cell line expressing the biosensor at high levels. The cell line was maintained using F17 medium (Sigma Aldrich®) + (200 nM / mL) GlutaMAX®.

[0177] On each FRET assay day, approximately 30 million cells from each transfection were harvested, washed three times with PBS without Mg or Ca (Thermo Fischer Scientific®; Waltham, MA) by centrifugation at 300×g, filtered using a 70 μm cell strainer (Corning®; Corning, NY), and diluted to 1-2 million cells / mL using a Countess™ automated cell counter (Invitrogen®; Carlsbad, CA). On each experimental day, cell viability was assessed using a trypan blue assay. After resuspension and dilution in PBS, cells were continuously and gently stirred with a magnetic stir bar at room temperature to keep the cells in suspension and prevent clumping.

[0178] A detailed description of the fluorescence measurement apparatus has been previously published in Schaaf et al. (SLAS Discov, 2017; Vol.22:262-273). For FLT measurements, the observed fluorescence waveform was deconvoluted to determine the instrument response function F(t) (Equation 1), and the average energy transfer efficiency E was calculated using the donor τ D and donor-acceptor τ DA The mean FLT of each molecule was calculated, and the donor-acceptor distance R was calculated using Equation 3.

number

[0179] 1.24. Quantitative and statistical analysis Unless otherwise stated, Student's t-test was used to determine statistical significance between groups. All tests were two-sided, and p-values ​​below the 0.05 threshold were considered significant. Cell culture experiments were performed in triplicate using at least two independently derived cell lines for each genotype, unless otherwise stated. In vitro assays were performed in triplicate using two or more separate protein isolation preparations.

[0180] result Although there is evidence that genome maintenance (GM) is a major longevity assurance system, with genetic deletions of GM genes leading to reduced life span and premature aging in humans and mice, and a correlation between more efficient DNA repair and longer maximum life span across animal species, the role of GM in extreme longevity in humans has not previously been systematically tested.

[0181] To address whether GM plays a role in extreme human longevity, we assembled a panel of 301 genome maintenance genes (Table 1) in pathways including nucleotide excision repair (NER), base excision repair (BER), mismatch repair (MMR), homologous recombination (HR), non-homologous end joining (NHEJ), and telomere maintenance, as well as genes involved in regulating these pathways.

[0182] We then performed two rounds of targeted sequencing to identify rare variants in these genes in DNA from peripheral blood of Ashkenazi Jewish (AJ) centenarians and AJ individuals aged 60–70 years who were unrelated to the proband and had no centenarian relatives (Figure 1). In the first round, we sequenced 51 AJ centenarians and 51 AJ controls and identified 122 genes that showed association with longevity (Table 2). Gene ontology analysis showed that these genes were enriched for DNA double-strand break (DSB) repair function. DSB repair genes were then sequenced in a larger population of 496 AJ centenarians and 572 controls (Table 4).

[0183] Of particular interest was SIRT6, a gene that is functionally related to DSB repair as well as longevity in model organisms. SIRT6 knockout mice exhibit premature aging and genomic instability, whereas mice overexpressing SIRT6 exhibit extended survival (see Mostoslavsky et al.; Cell, 2006; Vol. 124:315-329). Higher SIRT6 activity is associated with more efficient DSB repair and longer maximum survival across mammalian species. At the molecular level, SIRT6 is involved in DNA repair, telomere maintenance, silencing of repetitive elements including LINE1 retrotransposons, regulation of glucose homeostasis, inflammation and pluripotency, and tumor suppression.

[0184] The SIRT6 allele found to be abundant in centenarians contains two missenses within the highly flexible C-terminus, converting polar asparagine 308 to a charged lysine (N308K) and hydrophobic alanine 313 to a polar serine (A313S). Genotyping in centenarian carriers confirmed that these two SIRT6 variants exist as a linked double variant, which we named centSIRT6. This allele was extremely rare (allele frequency as low as 0.001%) in whole-exome sequence data from 50,726 adult participants of predominantly European origin from the Geisinger Health System. We next tested whether centenarian SIRT6 alleles alter the biological activity of the SIRT6 protein.

[0185] SILAC analysis of HEK293 cells expressing different SIRT6 alleles showed no difference in protein turnover rates between WT and centSIRT6 (Figure 2). To evaluate the biochemical properties of the different SIRT6 alleles, recombinant forms of each allele were purified. Consistent with the similar in vivo half-lives of wild-type and centSIRT6, no significant differences in the thermal stability of SIRT6 alleles in vitro were observed (Figure 3), suggesting that centSIRT6 does not significantly alter folding or peripheral stability. Because centSIRT6 mutations alter the polarity and charge of residues, we used SIRT6 FRET biosensors fused to the middle and C-terminus of SIRT6 to evaluate for more subtle changes to protein structure that centSIRT6 mutations may cause (Figure 4A-4B). centSIRT6 reduced FRET by ΔE = 6.4 ± 0.1% compared to wild-type SIRT6, corresponding to a 3.0 ± 0.4 Å increase in the donor-acceptor distance R. This increase indicates that the centSIRT6 mutation shifts SIRT6 structure toward a more open conformation.

[0186] SIRT6 deacylase activity was tested on myristoylated peptides to determine the Km of wild type and centSIRT6 for NAG+ and peptides. The centenarian allele exhibited slightly reduced activity (Vmax) compared to the wild type (p=0.02) (Figures 5A-5B), but the Km was not significantly different between wild type and centSIRT6 for both substrates (Table 6). [Table 6]

[0187] Quenching of the intrinsic Trp fluorescence of SIRT6 by NAD+ binding also demonstrated that centSIRT6 has a similar affinity for NAD+ as the wild-type allele (Figure 6). Collectively, these data indicate that centSIRT6 confers a slight reduction in deacylase catalytic efficiency (defined by Vmax / Km) (Table 6).

[0188] centSIRT6 exhibited significantly lower deacetylase activity in recombinant nucleosomes containing saturated H3K9ac and H3K18ac modifications (Figures 7A and 7B). In addition, centSIRT6 alleles exhibited significantly slower histone deacetylase kinetics (Figures 8A-8B). Similar to synthetic histones, centSIRT6 deacetylated both H3K9ac and H3K18a residues in nucleosomes purified from HeLa cells at a significantly lower rate compared to wild-type SIRT6 (Figures 9A-9B). Taken together, the combined data from deacylase and histone deacetylase experiments indicate that centSIRT6 variants have reduced deacylase / deacetylase activity.

[0189] To examine the effect of centSIRT6 alleles on histone deacetylase activity in vivo, telomerase-immortalized human HCA2 fibroblast cell lines were generated in a SIRT6 KO background containing the kumarate switch promoter driving expression of SIRT6 WT, N308K, A313S, and centSIRT6 alleles (KumarateSIRT6 fibroblasts). Each cell line was induced with kumarate to drive the same level of SIRT6 expression (Figures 27A-27B). Histone post-translational modifications from purified histones were quantified from these cells by mass spectrometry using peptide standards as previously described (Sidoli et al. Journal of visualized experiments: JoVE, 2016; doi:10.3791 / 54112). Cells expressing centSIRT6, N308K, and A313S SIRT6 alleles showed similar global histone post-translational modification (PTM) levels at all sites known to be SIRT6 substrates, including H3K9ac, H3K18ac, and H3K56ac (Figure 10). Similarly, global levels of H3K9ac and H3K56ac measured by Western blot did not show significant changes when challenged with paraquat-induced oxidative injury (Figure 11). These results suggest that the reduced deacylation activity of centSIRT6 is compensated for by additional protein factors or PTMs that help maintain SIRT6 deacetylation activity near wild-type levels in vivo.

[0190] In addition to deacetylation activity, SIRT6 has mono-ADP-ribosylation (mADPr) activity that can mono-ADP-ribosylate itself and other proteins. mADPr activity is crucial for the role of SIRT6 in DNA damage response and LINE1 repression. To evaluate mADPr activity, two known SIRT6 substrates were used: PARP1 and SIRT6 itself. centSIRT6 demonstrated a significantly higher auto-ribosylation rate with radiolabeled NAD+ than wild-type SIRT6 (Figure 12). Single SNAP alleles and combined centSIRT6 exhibited a similar increase in auto-mADPr compared to wild-type, suggesting a non-cumulative overall increase between the two SNPs (Figures 12 and 28). Following this, titration of NAD+ was used to test auto-ribosylation efficiency utilizing an antibody with specificity for the mADPr residue (Bonfiglio et al.; Cell, 2020; Vol. 183:1086-1102). Similar to radiolabeled NAD+, centSIRT6 exhibited a nearly two-fold higher maximum mADPr activity and a higher Km NAD of 142+29 compared to 106+45 for wild-type SIRT6 (Figure 13). Thus, the overall efficiency defined by mADPmax / Kapp NAD was 0.037 for centSIRT6 compared to 0.023 for wild-type SIRT6, a nearly two-fold difference. In trans, mADPr activity was assessed by incubation with human PARP1, which was previously shown to be ribosylated by SIRT6. Similar to autoribosylation, centSIRT6 exhibited higher PARP1 ribosylation activity (Figure 14). Curiously, although both single mutants had high activity, the A313S allele was more similar to centSIRT6 than N308K (Figure 14). These data indicate that centSIRT6 exhibits enhanced mADPr activity.

[0191] Lack of silencing of these elements contributes to age-associated sterile inflammation and drives premature aging-like phenotypes in SIRT6 KO mice. To assess the ability of centSIRT6 to silence LINE1 transposons, we used coumarate-induced fibroblasts expressing SIRT6 alleles. qRT-PCR analysis of both 5' and 3' biased regions of the evolutionarily active family of LINE1s showed that both enhanced LINE1 repression compared to wild-type SIRT6, as did the N308K allele (Figure 15). The A313S allele showed a slight trend towards stronger repression, but did not show significant improvement over wild-type SIRT6 when assessed for 3' bias. These results indicate that centSIRT6 is more efficient in silencing LINE1 elements that are functionally implicated in longevity.

[0192] To quantify the differences between SIRT6 alleles in promoting DSB repair, an in vivo GFP-based assay was used that measures non-homologous end joining (NHEJ) and homologous recombination (HR) repair of chromosomal DSBs induced by I-SceI enzyme. Different alleles of SIRT6 were transiently expressed in an NHEJ and HR reporter telomerase-immortalized human foreskin fibroblast cell line. We found that the same amount of centSIRT6 stimulated NHEJ and HR 2.5-fold and 2-fold greater, respectively, than wild-type SIRT6 (Figures 16A-16B). Similarly, we observed that in coumatoSIRT6 fibroblasts expressing centSIRT6, the basal level of γH2AX foci was reduced by 50% compared to the levels observed with either the single allele or wild-type SIRT6 (Figure 17). Taken together, these data indicate that centSIRT6 alleles induce enhanced DNA repair activity.

[0193] We next compared whether different SIRT6 alleles have different effects on stress. Utilizing coumarate-SIRT6 fibroblasts, cells were exposed to γ-radiation and DSB resolution was assessed over time via γH2AX immunostaining. Although both wild-type and centSIRT6-expressing cells had similar levels of γH2AX foci immediately after exposure, the centSIRT6-expressing cell line showed improved recovery rates (Figure 18). Furthermore, we found that centSIRT6-expressing cells were more resistant to oxidative stress-induced apoptosis (Figures 19A-19B). In contrast, in the absence of coumarate induction, all cell lines showed no significant difference in survival rate after oxidative stress (Figure 19A). Taken together, these results indicate that centSIRT6 improves DSB repair and resistance to DNA damage.

[0194] To further confirm that centSIRT6 enhances genome maintenance, knock-in human embryonic stem cells carrying the centSIRT6 allele were generated. Two centenarian mutations were introduced using CRISPR CAS9 and confirmed by sequencing. Two independent knock-in clones were generated and differentiated into MSCs. MSCs were then transfected with linear NHEJ and HR GFP reporters. Cells harboring the centSIRT6 allele exhibited high repair efficiency (Figures 29A-29B). These cells also showed increased viability and reduced 53BP1 foci numbers when treated with methyl methanesulfonate (MMS), a potent DNA damaging agent (Figures 29C-29D). Interestingly, centSIRT6 knock-in cells showed higher protein and mRNA levels of SIRT6 (Figures 29E-29F), suggesting that the centenarian mutation increases mRNA stability in addition to modulating SIRT6 enzymatic activity. Because it was not possible to compare the same levels of SIRT6 in CRISPR knock-in cells, most of the in vivo assays relied on Kumart cells.

[0195] To evaluate the tumor cell killing ability of centSIRT6 alleles, SIRT6 alleles were transfected into two common tumor cell lines, namely HT1080 fibroblastoma cells and HeLa cells. centSIRT6 showed approximately 2-fold lower adherent viable cells in both cancer cell lines (Figure 20A). centSIRT6 alleles elicited at least 2-fold higher apoptosis levels than wild-type SIRT6 alleles (Figures 20B-20C). These data indicate that centSIRT6 confers more robust antitumor activity than its wild-type counterpart.

[0196] Because centSIRT6 mutations are located in the flexible C-terminus of SIRT6 and may affect protein-protein interactions, the interactions of centSIRT6 and wild-type alleles were compared. Antibodies against SIRT6 were used to immunoprecipitate SIRT6-interacting proteins from coumatoSIRT6 fibroblasts and analyze them by mass spectrometry with tandem mass tags (TMT), which allows for accurate quantification. Multiple interacting proteins were enriched with the centSIRT6 allele (Table 7). [Table 7]

[0197] Proteins were prepared from a coumarate-induced SIRT6 cell line and immunoprecipitated with SIRT6 antibody, rabbit pre-immune serum was used as a control. Samples were labeled with tandem mass tags prior to analysis by mass spectrometry.

[0198] The most prominent proteins that showed stronger interactions with centSIRT6 than with wild-type SIRT6 were LMNA and vimentin (VIME), which showed 38 and 40 peptides, respectively. Both of these proteins are known to interact with SIRT6, and LMNA has been shown to stimulate SIRT6 activity. No loss or gain of interactions was evident in the centSIRT6 set, indicating that the effect of the novel allele may be to enhance existing SIRT6 function.

[0199] LMNA is a nuclear scaffolding protein that plays a pivotal role in nuclear organization and is also involved in aging. LMNA SNPs were identified in human centenarians, where abnormal processing of LMNA results in the human premature aging syndrome, Hutchinson-Gilford progeria. Fibroblasts isolated from centenarians were also shown to have high levels of LMNA precursor, suggesting that regulated LMNA function is associated with both premature aging and exceptional longevity. To confirm the mass spectrometry data on the interaction of SIRT6 with LMNA, co-IP was performed with SIRT6 antibody followed by Western blot with LMNA antibody using co-SIRT6 fibroblasts. centSIRT6 was indeed found to associate with LMNA more strongly than the wild-type SIRT6 allele (Figures 21 and 22), and the effect was reciprocal as assessed by co-IP with LMNA antibody followed by Western blot with SIRT6 antibody (Figures 21 and 23). Taken together, these results demonstrate that centSIRT6 interacts with LMNA more potently than its wild-type counterpart.

[0200] Given the enhanced mADPr activity of the centSIRT6 allele, we next assessed the ribosylation status of LMNA using mADPr antibodies. SIRT6 IP performed on coumatoSIRT6 fibroblasts using mADPr-specific antibodies showed that centSIRT6 was more ribosylated in vivo (Figure 24), as demonstrated in vitro with purified SIRT6 protein (Figure 13). IP with mADPr-specific antibodies and subsequent Western blot with anti-LMNA antibodies revealed increased ribosylation of LMNA in the presence of centSIRT6 alleles (Figure 25). LMNA has been reported to be ADP-ribosylated at multiple residues in vivo.

[0201] We hypothesized that centSIRT6 alleles may affect the interaction of LMNA with other proteins. To test this, we immunoprecipitated LMNA from coumato fibroblasts expressing either wild-type SIRT6 or centSIRT6 alleles and performed quantitative protein interaction analysis using TMT labeling and subsequent mass spectrometry. Although many proteins showed similar interactions with LMNA, a large group of proteins showed enhanced interactions with LMNA in the presence of centSIRT6, regardless of the SIRT6 allele present (Figure 26). LMINA interaction partners enhanced by centSIRT6 include ELAVL1, FUS, PCBP2, SAFB, SRSF1, SRSF3, TFIP11, THRAP3, BCLAF1, and U2AFBP, all proteins that facilitate the link between DNA damage response and RNA processing. Many of the proteins identified in the SIRT6 and LMINA IPs are ADP-ribosylated (represented by hexagons in FIG. 26), suggesting that ADP-ribosylation by SIRT6 or SIRT6-activated PARP1 may play a role in mediating these interactions. Together, these data indicate that centSIRT6 has an enhanced ability to promote DNA repair and repress LINE1 elements, which may be mediated by enhanced mADPr activity and a stronger interaction with LMNA.

[0202] Consideration The discovery of beneficial SIRT6 mutations associated with enhanced mADP activity in centenarian cohorts suggests that elevated SIRT6 activity benefits human longevity. Elevated SIRT6 activity correlates with longer life span in model organisms, but which of SIRT6's enzymatic activities is central to longevity remains to be determined. Interestingly, lack of SIRT6 deacetylase activity in humans or SIRT6 knockout in monkeys results in severe developmental phenotypes rather than premature aging, suggesting that, at least in primates, SIRT6 deacetylase activity is required for development but not necessarily for adult longevity. An altered balance between deacetylase and mADPr enzymatic activity leads to enhanced SIRT6 functions in DNA repair, LINE1 repression and cancer cell killing, which require mADPr activity. The centSIRT6 variants also exhibit enhanced binding to LMNA, which may further promote its function in DNA repair and chromatin organization through direct stimulation of SIRT6 enzymatic activity and by coordinated interactions with LMNA and other LMNA complex components.

[0203] Example 2 Materials and Methods cell culture 3T3-L1, LX2, HepG2, Hep3b (all purchased from American Type Culture Collection-ATCC, Manassas) and WSF (purchased from Coriell Institute for Medical Research, NJ) cells were cultured in 10% fetal bovine serum (F9665, Sigma-Aldrich), 15 mM Hepes buffer (L0180, Biowest), GlutaMAX™ Supplement (100×, 35050-038, Gibco), 100 U / ml penicillin and 100 mg / ml streptomycin solution (L0022, Biowest), 100 nM sodium pyruvate (11360, Gibco), and non-essential amino acids (NEAA Cells were grown in basal medium consisting of high glucose (4.5 g / l) DMEM (LM-D1108 / 500, Biosera) supplemented with TrypLE Express (1×, Gibco) at 37° C. in 5% CO2 / humidified atmosphere. Medium was routinely changed every 2 days and cells were subcultured using TrypLE Express (1×, Gibco) upon reaching 90% confluence.

[0204] IHH cells were purchased from American Type Culture Collection (ATCC, Manassas, VA) and cultured in Williams' E medium (12551032, Gibco) containing 2 g / l glucose and supplemented with 10% fetal bovine serum, 100 U / ml penicillin and 100 μg / ml streptomycin solution, 20 mU / ml insulin, and 50 nM dexamethasone in 5% CO2 / humidified atmosphere at 37° C. Cell culture medium was changed every 2 days and subcultured using TrypLE Express when the cells reached 90% confluency.

[0205] For the purpose of microscopic analysis, all appropriate cell lines were seeded on glass coverslips coated with 0.2% gelatin without further modification of the standard culture protocol. For the evaluation of the effect of SIRT6 variants and their overexpression on tissue fibrosis, appropriate cell lines were treated or not with recombinant TGF-β1 protein (100-21C, Peprotech, USA) at concentrations of 10 and 20 ng / ml, as a potent inducer of the fibrogenic process.

[0206] Lentiviral infection and establishment of SIRT6 cell lines After reaching confluence, the cells were isolated and grown on a plate with a surface area of ​​2 cm. 2 50 x 10 cells were seeded into a 24-well plate. 4 Cells were seeded at 1000 x 1000 cells / well. Immediately after seeding, cells were infected with lentiviruses containing the SIRT6 constructs: LV2-EMPTY-IresKat2S, LV2-SIRT6(wt)-IresKat2S, LV2-SIRT6(N308K)-IresKat2S and LV2-SIRT6(centSIRT6)-IresKat2S at an MOI of 1-2 in basal DMEM medium supplemented with 4 μg / mL polybrene transfection reagent (TR-1003, Sigma-Aldrich). Cells were cultured with the lentiviral constructs for a period of 24 h, after which fresh medium was added and cells were cultured for an additional 48 h. Cells were then treated with selection medium consisting of basal DMEM medium containing 500 μg / mL hygromycin (H3274, Merck) for 5 days (medium was replaced with fresh medium every other day). After selection, the remaining cells were expanded and checked for the presence of fluorescent Kat2S signal by fluorescence microscopy at ex / em 588 / 635. SIRT6 overexpression was confirmed by Western blot.

[0207] Differentiation into 3T3-L1 adipocytes Differentiation of 3T3-L1 adipocytes was induced 2 days after seeding at 100% confluency by incubating the cells for a period of 72 h in differentiation medium consisting of standard basal high glucose DMEM medium additionally supplemented with 500 μM IBMX (I5879, Sigma-Aldrich), 1 μM rosiglitazone (I5879, Sigma-Aldrich), 250 nM dexamethasone (D4902, Sigma-Aldrich), 10 nM 3,3′,5′-triiodo-L-thyronine (T6397, Sigma-Aldrich), 17 μM D-pantothenic acid (21210, Sigma-Aldrich), 10 μg / ml human transferrin (T8158, Sigma-Aldrich) and 1 μg / ml insulin (I9278, Sigma-Aldrich). Cells are then maintained in maintenance medium consisting of basal high glucose DMEM medium supplemented only with 25 nM dexamethasone and 0.1 μg / ml insulin for a period of at least 4 days. Adipocyte differentiation and / or intracellular lipid accumulation were assessed using fluorescent labeling with BODIPY dye (1 μg / ml) for 30 minutes (ex / em 493 / 503) and 1 μg / mL DAPI counterstain for 30 minutes. Fluorescence was then captured using an Aglient BioTek FL×800 microplate fluorescence reader equipped with appropriate excitation / emission filters.

[0208] Cell viability assay Cells were seeded at 2000 viable cells / well in 96-well plates, and after 24, 48, and 72 hours, the culture medium was removed and replaced with medium containing 1 μg / mL Hoechst dye for nuclear staining. After 20 min of incubation at 37 °C, cells were washed twice with PBS, and the fluorescent signals were measured with an Aglient BioTek FL×800 microplate fluorescence reader at ex / em 355 / 488. The ratio of signals at different time points to T0 was used as the relative percentage of viable cells.

[0209] Gene expression measurements Genomic RNA was isolated using RNeasy mini Kit (74106, Qiagen, Germany) by column separation technique according to the manufacturer's instructions. At least four biological replicates were prepared for each treatment group. After quantification of isolated total RNA on NanoDrop 1000 spectrophotometer (ThermoFisher Scientific), 1 μg of total isolated RNA was used to prepare cDNA using High-Capacity cDNA Reverse Transcription Kit (4368814, ThermoFisher Scientific). Real-time PCR was performed with at least two technical replicates using StepOnePlus™ Real-Time PCR System (Applied Biosystems) and SYBR™ Select Master Mix (4472908, ThermoFisher Scientific). PCR reactions were kept in 10 μl volume and 250 ng cDNA / well was used as input amount. Primer sequences used in this study are listed in Table 8. [Table 8]

[0210] Telomere length Quantitative RT-PCR was used to determine the changes in the average telomere length of LV-transfected WSF cells and non-treated WSF based on ScienCell's Relative Human Telomere Length Quantification qPCR Assay Kit (#8909). The kit directly compares the average telomere length of the samples. The telomere primer set recognizes and amplifies the telomere sequence. The single copy reference (SCR) primer set recognizes and amplifies a 100 bp long region on human chromosome 17 to serve as a reference for data normalization. Carefully designed primers ensure (i) high efficiency for reliable quantification, and (ii) no nonspecific amplification. Each primer set has been validated by qPCR using melting curve analysis, and gel electrophoresis for amplification specificity, and template serial dilution for amplification efficiency. Genomic DNA (gDNA) was isolated using the Qiagen DNA Isolation Kit (Qiagen, Heiden, Germany). Each PCR reaction contained genomic DNA sample (0.01 μg / μL), telomere primers, 2× qPCR master mix, and nuclease-free water. Primer-probe real-time PCR was performed using the StepOnePlus™ Real-Time PCR System (Applied Biosystems). All reactions were performed in duplicate, and template controls were included in each run. Amplification was performed under the following conditions: denaturation at 95°C for 10 min, followed by 32 cycles of denaturation at 95°C for 20 s, annealing at 52°C for 20 s, and extension at 72°C for 45 s. Average telomere length was calculated according to the manufacturer's instructions.

[0211] Quantification of telomerase activity Relative telomerase activity of LV WSF transfected cell lines and normal WSF cells was assessed by qPCR on a StepOnePlus™ Real-Time PCR System (Applied Biosystems) using a SYBR® Green assay kit (Telomerase Activity Quantification qPCR Assay Kit [TAQ] from ScienCell, Carlsbad, CA, USA) according to the manufacturer's recommendations. Three million cells were harvested for each sample. Two controls were used in each experiment: telomerase negative and positive cell lysate (Cat#8928e). PCR was performed in a final volume of 20 μL using 1 μL post-telomerase reaction sample, 2 μL TPS, 10 μL 2×qPCR FastStart Essential Green Master Mix (Roche Diagnostics International) and 7 μL nuclease-free water. PCR conditions were as follows: 95°C for 10 min, followed by 36 cycles of 95°C for 20 s, 52°C for 20 s, and 72°C for 45 s. All reactions were performed in triplicate. Data analysis was performed according to the manufacturer's instructions.

[0212] Immunoblotting analysis Cells were harvested from culture plates using TrypLE Express, washed with 1x PBS, and centrifuged at 300g. After discarding the supernatant, the resulting pellet was resuspended in 1x Rippa lysis buffer (20-188, Millipore, USA) supplemented with Halt™ Protease and Phosphatase Inhibitor Cocktail (100x, Thermo Fisher) and lysed for 30 min on ice (4°C) with vigorous vortexing every 10 min. After centrifugation at 10,000g for 10 min, the supernatant was transferred to a new vial and the protein concentration was measured by Pierce™ BCA Protein Assay Kit (23225, Thermo Fisher) according to the manufacturer's instructions. Equal amounts of protein samples (at least 20 μg) were mixed with 1× Laemmli sample buffer (1610747, 4×, Bio-Rad), boiled at 95° C. for 5 min, and cooled in ice. After that, equal amounts of protein (40 μl) were loaded onto 10% Mini-PROTEAN® TGX Stain-Free™ Protein Gels (4568034, Bio-Rad) and separated by electrophoresis measured at 120 Volts for 45 min. Protein transfer was performed on PVDF membranes using a Trans-Blot Turbo RTA Mini 0.45 μm LF PVDF Transfer Kit (1704274, Bio-Rad) and a Bio-Rad Trans-Blot Turbo Transfer System at 1,3 A and 25 V for 10 min. The membranes were then blocked with 5% bovine serum albumin (BSA, P6154, BioWest) in TBST buffer (20 mM Tris-HCl pH 7.6, 140 mM NaCl, 0.1% Tween 20) for at least 30 min and incubated with specific primary antibodies (see below) diluted at appropriate dilutions in TBST blocking solution. Following three washes with TBST buffer, the membranes were incubated with horseradish peroxidase-conjugated secondary antibodies diluted in TBST blocking buffer.After three additional washes with TBST, proteins were developed with Clarity Western ECL Substrate (1705061, Bio-Rad) and signals were detected with a Bio-Rad ChemiDoc XRS+ imaging system. For quantitative measurements, scanned membranes were analyzed using Image Lab™ software (Bio-Rad).

[0213] Antibodies used in this study: Cell Signaling Technology (MA, USA) - rabbit anti-Akt (1:1000), rabbit anti-phospho-Akt (Ser473) (1:1000), rabbit anti-vimentin (1:1000), rabbit anti-histone H3 (D1H2, 1:1000); Abcam (UK) - mouse anti-β-actin HRP conjugated antibody (AC-15; 1:2000), mouse anti-GAPDH monoclonal HRP conjugated antibody (1:2000), rabbit anti-collagen I (1:1000), rabbit anti-αSMA (1:1000), rabbit anti-SIRT6 antibody (1:1000, EPR18463); ThermoFischer Scientific (CA, USA) - mouse IgG1 GAPDH monoclonal HRP conjugated antibody (1:2000), secondary sheep anti-rabbit IgG HRP binding (1:2000).

[0214] 3D spheroid culture For the generation of cell spheroids, cells were seeded at 10000 viable cells / well in BIOFLOAT™ 96-well round-bottom ultra-low attachment plates for cell culture. Each IHH LV-transfected cell line (CTL / EMPTY, WT, N308K and centSIRT6) was co-cultured with either normal LX2 cells or overexpressed centSirt6 LX2 cells at a ratio of 20:1 to regenerate in physiological proportions within the liver parenchyma, where hepatocytes are the predominant cell type and only 5% hepatic stellate cells are included. Spheroids were grown in basal high glucose DMEM medium supplemented as described above. Plates were incubated at 37°C in a humidified atmosphere of 5% CO2 for 3 days, after which spheroids were maintained in culture for 48 hours with and without treatment with free fatty acid solution (FFA, L9655, Sigma-Aldrich). Spheroids were then harvested, washed twice with PBS, fixed in 4% paraformaldehyde + eosin solution for 20 min, incubated in 10% sucrose for 20 min, and incorporated into tissue freezing medium (14020108926, Leica Biosystems, USA) for sectioning and subsequent immunohistological analysis.

[0215] Histological immunostaining The embedded and flash-frozen spheroid samples in tissue freezing medium were cut at 7 μm by Cryotome (Leica Microsystems) at -20°C and stored at -80°C for further use. To evaluate the effect of SIRT6 variants and their overexpression on liver tissue fibrogenesis, spheroid tissue sections were immunolabeled to detect collagen 1A. Slides were washed once with 1×PBS, dissolved in tissue freezing medium, and blocked with 1×PBS supplemented with 0.2% Tween-20 and 5% BSA. Primary antibody rabbit anti-collagen I (1:500, ab34710, Abcam) was diluted in DAKO antibody diluent (S202230-2, Agilent technologies) and incubated overnight in a humidified chamber at laboratory temperature. After three consecutive washes with 1×PBS, a mix of secondary antibody (1:500) donkey anti-rabbit IgG coupled with Alexa Fluor™ 647 was applied and incubated for at least 1 hour. After three washes with 1x PBS, slides were counterstained with DAPI (1 μg / ml) solution for 15 min and mounted with Mowiol hardening medium. After hardening (overnight at 4°C), images were acquired with an Axio scan Z.1 (ZEISS) equipped with a Hamamatsu ORCA-Flash 4.0 camera and all immunofluorescence images were evaluated using the ImageJ software (NIH, USA) analysis program. At least five spheroids per condition / cell line were used in three consecutive independent experiments and fibrillogenesis, i.e. collagen 1A abundance, in spheroid samples was evaluated as % of the total spheroid area outlined by DAPI fluorescence at 100x magnification.

[0216] result SIRT6 wild-type or SIRT6 carrying one or two mutations associated with exceptional longevity in humans (SIRT6 N308K, centSIRT6) were overexpressed in various cell lines to assess how this affected specific cellular functions.

[0217] Werner syndrome model In human Werner syndrome immortalized fibroblasts, SIRT6 WT / SIRT6 N308K / centSIRT6 did not affect cell viability, proliferation, or telomere length (Figures 30A-30B), but centSIRT6 reduced telomerase activity (Figure 30C).

[0218] Although it may seem counterproductive, Werner syndrome immortalized fibroblasts are a poorly characterized immortalized cell line that may have oncogenic potential, therefore, without being bound by any theory, reducing telomerase activity would be of beneficial effect if this were the case.

[0219] Human hepatocellular carcinoma model In human hepatocellular carcinoma (HCC) cells, SIRT6 WT / SIRT6 N308K / centSIRT6 overexpression was lethal, and a greater effect was observed in SIRT6 N308K / centSIRT6 (Figures 31A-31B). Therefore, mutant SIRT6 may be useful for cancer treatment.

[0220] adipogenic differentiation It has been reported that SIRT6 deficiency leads to hypoglycemia and impaired energy homeostasis, suggesting that SIRT6 may play an important role in regulating adipocyte differentiation. Aging adipocytes, especially under high-fat diet intake, become hypertrophied, insulin resistant, and produce a wide pattern of proinflammatory cytokines that contribute to increased circulating triglycerides and free fatty acids, while affecting other organs and resulting in comorbidities typically associated with obesity. On the other hand, increased adipogenesis allows the formation of new adipocytes that are more sensitive to insulin, exhibiting elevated fat storage capacity and increased levels of adipokines, contributing to metabolic homeostasis and reduced levels of inflammation.

[0221] Herein, the results demonstrate that SIRT6 plays a role in increasing adipogenic differentiation (Figure 32), which is consistent with the protein's role in energy homeostasis. SIRT6 mutants (SIRT6 N308K and centSIRT6) retain this property, which is important for the treatment of aging and age-related diseases.

[0222] Hepatic stellate cell model α-SMA expression is considered a reliable marker of hepatic stellate cell (HSC) activation and a critical biomarker of liver fibrosis. In the liver, HSCs play a central role in physiological tissue repair and the development of fibrosis, transdifferentiating from "quiescent" HSCs to a myofibroblastic phenotype in response to transforming growth factor beta (TGF-β), inflammatory processes and ROS.

[0223] SIRT6 WT / SIRT6 N308K / centSIRT6 overexpression did not affect cell viability or proliferation (Figure 33A). Activation of LX2 by TGF-beta blocks lentiviral infection-induced activation of several fibrogenic markers (vimentin, TIMP1) regardless of genotype (Figures 33B-33C). Collagen mRNA expression was increased by TGF-beta and was not affected by SIRT6 WT / SIRT6 N308K / centSIRT6 overexpression (Figure 33D). However, centSIRT6 significantly reduced the mRNA expression of aSMA, a key fibrogenic marker (Figure 33E).

[0224] The lower gene expression levels of α-SMA in centSIRT6 LX2 compared with controls suggests a potential antifibrotic effect of centSIRT6 in preventing liver fibrosis and / or promoting its degradation.

[0225] Liver spheroid model Collagen (COL1A), together with α-SMA, represents one of the key fibrosis markers, and its production in the liver is increased mainly by activated hepatic stellate cells.

[0226] Spheroids formed from IHH cells and LX2 (human hepatic stellate cells) at 5% of the total cell mass were generated. Spheroids were treated or not with free fatty acids (FFA) and collagen production was assessed by immunofluorescence (Figure 34A).

[0227] In IHH / LX2 spheroids containing centSIRT6-transfected IHH, a decrease in the amount of internal collagen was observed compared to the control (empty group), suggesting that IHH centSIRT6 inhibits collagen production at a basal level in the absence of stress factors (Figure 34B).

[0228] It is known that exposure to free fatty acids (FFA) promotes oxidative stress and indirectly activates LX2 to increase collagen biosynthesis. Surprisingly, in the presence of FFA, increased levels of internal collagen were observed in IHH centSIRT6 spheroids compared to controls (Figure 34C). The elevated free fatty acid levels accompanied by enhanced beta-oxidation induced by centSIRT6 overexpression may overcome the inhibitory effect on collagen production exerted by centSIRT6 overexpression observed at basal levels, providing more ATP required for fibroblasts to acquire a myofibroblast phenotype.

[0229] Sequences used herein SEQ ID NO:1 - Wild-type SIRT6 amino acid sequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRAC RGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

[0230] SEQ ID NO:2 - SIRT6 N308K variant amino acid sequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRAC RGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRIKGSIPAGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

[0231] SEQ ID NO:3 - SIRT6 A313S variant amino acid sequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRAC RGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRINGSIPSGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

[0232] SEQ ID NO:4 - SIRT6 N308K A313S variant (centSIRT6) amino acid sequence MSVNYAAGLSPYADKGKCGLPEIFDPPEELERKVWELARLVWQSSSVVFHTGAGISTASGIPDFRGPHGVWTMEERGLAPKFDTTFESARPTQTHMALVQLERVGLLRFLVSQNVDGLHVRSGFPRDKLAELHGNMFVEECAKCKTQYVRDTVVGTMGLKATGRLCTVAKARGLRAC RGELRDTILDWEDSLPDRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHLGLEIPAWDGPRVLERALPPLPRPPTPKLEPKEESPTRIKGSIPSGPKQEPCAQHNGSEPASPKRERPTSPAPHRPPKRVKAKAVPS

[0233] SEQ ID NO:5 - Wild type SIRT6 nucleic acid sequence

[0234] SEQ ID NO:6 - SIRT6 N308K variant nucleic acid sequence

[0235] SEQ ID NO:7 - SIRT6 A313S variant nucleic acid sequence

[0236] SEQ ID NO:8 - SIRT6 N308K A313S variant (centSIRT6) nucleic acid sequence

[0237] SEQ ID NO:9 - LINE1 ORF1 forward primer atggcgaaaggcaaacgtaag

[0238] SEQ ID NO:10 - LINE1 ORF1 reverse primer attttcggttgtgttggggtg

[0239] SEQ ID NO:11 - LINE1 ORF2 forward primer gcaggggttgcaatcctagtc

[0240] SEQ ID NO:12 - LINE1 ORF2 reverse primer ctgggtgctcctgtattgggt

[0241] SEQ ID NO:13 - αSMA forward primer aaaagacagctacgtgggtga

[0242] SEQ ID NO:14 - αSMA reverse primer gccatgttctatcgggtacttc

[0243] SEQ ID NO:15 - COL1A1 forward primer gtgcgatgacgtgatctgtga

[0244] SEQ ID NO:16 - COL1A1 reverse primer cggtggtttcttggtcggt

[0245] SEQ ID NO:17 - TIMP1 forward primer accaccttataccagcgttatga

[0246] SEQ ID NO:18 - TIMP1 reverse primer ggtgtagacgaaccggatgtc

[0247] SEQ ID NO:19 - Vimentin forward primer agtccactgagtaccggagac

[0248] SEQ ID NO:20 - Vimentin reverse primer catttcacgcatctggcgttc

[0249] SEQ ID NO:21 - MMP2 forward primer tacaggatcattggctacacacc

[0250] SEQ ID NO:22 - MMP2 reverse primer ggtcacatcgctccagact

[0251] SEQ ID NO:23 - GAPDH forward primer ggtgcgtgcccagttga

[0252] SEQ ID NO:24 - GAPDH reverse primer tactttctccccgcttttt

[0253] SEQ ID NO:25 - Actin β forward primer catgtacgttgctatccaggc

[0254] SEQ ID NO:26 - Actin β reverse primer ctccttaatgtcacgcacgat

Claims

1. An isolated nucleic acid molecule encoding a variant of Sirtuin 6 (SIRT6) having at least 75% identity to the sequence of SEQ ID NO:1, wherein the variant has at least one mutation selected from the group consisting of, or including, the substitution N308K and the substitution A313S with respect to the sequence of SEQ ID NO:

1.

2. 2. The isolated nucleic acid molecule of claim 1, wherein the nucleic acid molecule is a nucleic acid molecule having a sequence selected from the group consisting of SEQ ID NO:6, SEQ ID NO:7 and SEQ ID NO:

8.

3. 2. An isolated polypeptide encoded by the nucleic acid molecule of claim 1.

4. 4. The isolated polypeptide of claim 3, wherein the polypeptide is a polypeptide of a sequence selected from the group comprising or consisting of SEQ ID NO:2, SEQ ID NO:3 and SEQ ID NO:

4.

5. A vector comprising the isolated nucleic acid molecule of claim 1.

6. The vector of claim 5 which is a viral vector.

7. The vector described in claim 5, which is an adeno-associated virus vector (AAV), an exosome-associated AAV vector (exo-AAV), an adenovirus vector, a retrovirus vector, or a herpes virus vector.

8. A suspension comprising the vector of claim 5.

9. A cell expressing the polypeptide described in claim 3.

10. A cell described in claim 9, transfected with the isolated nucleic acid molecule described in claim 1 or the vector described in claim 5.

11. 10. A pharmaceutical composition comprising: (i) an isolated nucleic acid molecule according to claim 1, or an isolated polypeptide according to claim 3, or a vector according to claim 5; and (ii) a pharma- ceutically acceptable excipient.

12. 13. Use of the isolated nucleic acid molecule according to claim 1, or the isolated polypeptide according to claim 3, or the vector according to claim 5 in modulating ageing and / or senescence and / or life span in an individual.

13. The use described in claim 12, wherein the individual is a mammalian individual.

14. The use described in claim 12, wherein the individual is a human individual.

15. 10. Use of the isolated nucleic acid molecule of claim 1, or the isolated polypeptide of claim 3, or the vector of claim 5 in repairing double-strand breaks in a cell.

16. The use of claim 15, wherein the cell is a mammalian cell.

17. The use described in claim 15, wherein the cells are human cells.

18. A pharmaceutical composition for use in the prevention and / or treatment of age-related diseases, comprising an isolated nucleic acid molecule according to claim 1, or an isolated polypeptide according to claim 3, or a vector according to claim 5.

19. The pharmaceutical composition for use according to claim 18, wherein the individual is a mammalian individual.

20. The pharmaceutical composition for use according to claim 18, wherein the individual is a human individual.

21. 19. The pharmaceutical composition for use according to claim 18, wherein the age-related disease comprises or is selected in the group consisting of progeria, Werner's syndrome, neurodegenerative diseases, Alzheimer's disease, cancer, cardiovascular disease, obesity, type 2 diabetes, hypercholesterolemia, hypertension, eye disorders, cataracts, glaucoma, osteoporosis, thrombotic disorders, arthritis, hearing loss and stroke.

22. A kit comprising (i) an isolated nucleic acid molecule according to claim 1, or an isolated polypeptide according to claim 3, or a vector according to claim 5, and (ii) a means for administering said isolated nucleic acid molecule, said isolated polypeptide, or said vector.

Images