Bacteriotherapy against Propionibacterium acnes for the treatment of acne

Abstract

The present disclosure relates to compositions and methods for treating skin diseases and disorders, as well as compositions useful in the treatment of acne.

Description

Statement regarding federally sponsored research

[0001] This invention was made with Government support under award numbers AI118816, AR067547, AI117673-02, AR06781, and AI052453 from the National Institutes of Health. The Government has certain rights in this invention. Related Applications

[0002] This application claims priority under 35 USC § 119 to U.S. Provisional Patent Application No. 62 / 730,999, filed September 13, 2018, the disclosure of which is incorporated herein by reference. INCORPORATION BY REFERENCE OF SEQUENCE LISTING

[0003] This application contains a Sequence Listing that has been submitted electronically in ASCII format and is incorporated herein by reference in its entirety. The ASCII copy, created on September 13, 2019, is named 00015-354WO1_SL.txt and is 12,125,812 bytes in size. [Technical field]

[0004] The present disclosure relates to compositions and methods for treating skin diseases and disorders, as well as compositions and formulations for treating acne.

[0005] Human skin harbors a diverse microbial community that constitutes a key component of the innate immune barrier to protect the host against pathogens.

[0006] The present disclosure provides topical probiotic compositions comprising, consisting essentially of, or consisting of a microorganism selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof.

[0007] The present disclosure provides a postbiotic composition comprising a fermentation extract of a probiotic composition comprising, consisting essentially of, or consisting of a microorganism selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof.

[0008] The present disclosure also provides a pharmaceutical composition comprising a postbiotic probiotic of the present disclosure and a pharma- ceutically acceptable carrier.

[0009] The present disclosure also provides a method of treating a skin disorder associated with C. acnes (P. acnes), comprising administering an effective amount of a composition or pharmaceutical composition of the present disclosure that inhibits the growth, viability, or activity of C. acnes. In one embodiment, the skin disorder is selected from the group consisting of acne, chronic blepharitis, and endophthalmitis. In another or further embodiment, administration is by topical application.

[0010] The present disclosure also provides a topical composition comprising one or more bacteria selected from S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and a carrier. In one embodiment, the topical composition comprises a lotion, tincture, cream, or ointment.

[0011] The present disclosure also provides a composition comprising a cell-free fermentation extract obtained from S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, or any combination thereof.

[0012] The present disclosure provides CoNS strains that are potent inhibitors of Propionibacterium acnes (P. acnes), a Gram-positive anaerobic bacterium that resides primarily in the hair follicles of the skin. The present disclosure provides 14 strains of CoNS that exhibit potent antibacterial activity against P. acnes (Table 1). These CoNS strains were screened and isolated from human skin and are derived from diverse species of bacteria, including Staphylococcus epidermidis, Staphylococcus hominis, Staphylococcus warneri, Staphylococcus capitis, and Staphylococcus lugdinensis. These anti-P. acnes CoNS strains can be used in bacteriotherapy targeting P. acnes to treat patients with inflammatory acne.

[0013] The present disclosure provides methods and compositions useful for treating acne and C. acnes infections.

[0014] The present disclosure provides topical probiotic compositions comprising, consisting essentially of, or consisting of a microorganism selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof.

[0015] The present disclosure also provides a postbiotic composition comprising a fermentation extract of a probiotic composition comprising, consisting essentially of, or consisting of a microorganism selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof.

[0016] The present disclosure also provides a pharmaceutical composition of any of the above in combination with a pharma- ceutically acceptable carrier.

[0017] The present disclosure provides a composition comprising one or more probiotic bacterial strains and, optionally, a thickened topical formulation of prebiotic compounds, protectants, moisturizers, emollients, abrasives, salts, and / or surfactants, wherein the one or more probiotic bacterial strains comprise one or more bacterial strains selected from the group consisting of S. capitis, S. epidermidis, and any combination thereof, wherein the composition is formulated for topical treatment of disorders of skin, scalp, or mucous membrane abnormalities, wherein the composition inhibits the growth of C. acnes. In one embodiment, the one or more probiotic bacterial strains are selected from the group consisting of S. capitis N030_E12, S. epidermidis, and any combination thereof. In another or further embodiment, the one or more probiotic bacteria of S. sepidermidis are selected from the group consisting of S. sepidermidis AMT5_C5, S. sepidermidis N009_G7, S. sepidermidis N018_F3, and any combination thereof. In yet another embodiment, the one or more probiotic bacterial strains include S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof. In another embodiment, each probiotic bacterial strain inhibits the growth of C. acnes. In yet another or further embodiment, the one or more probiotic bacterial strains are provided in live form. In yet another embodiment, the one or more probiotic bacterial strains are provided in lyophilized, freeze-dried, or spray-dried form. In a further embodiment, the probiotic bacteria can be reconstituted in live form.

[0018] The present disclosure also provides a method for treating skin or mucosal infections, atopic dermatitis, psoriasis, mastitis, acne, or other disorders associated with skin abnormalities in humans or other mammals by applying an effective amount of a composition or formulation described herein to the skin or mucosa of a subject in need thereof. In one embodiment, the composition is applied topically. In another or further embodiment, the composition is formulated as a cream, ointment, salve spray, powder, oil, thickened formulation, or compress.

[0019] The present disclosure also provides a method of treating a skin disorder associated with C. acnes comprising administering an effective amount of a composition described herein or a pharmaceutical composition thereof that inhibits the growth, viability or activity of C. acnes. In one embodiment, the skin disorder is selected from the group consisting of acne, chronic blepharitis and endophthalmitis. In another or further embodiment, administration is by topical application.

[0020] The present disclosure also provides a topical composition comprising one or more bacteria selected from S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and a carrier, in one embodiment, the carrier forms a lotion, tincture, cream, or ointment.

[0021] The present disclosure also provides a composition comprising a cell-free fermentation extract obtained from a culture of S. capitis N030_E12, S. epdermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, or any combination thereof. The present disclosure also provides a pharmaceutical composition comprising a cell-free fermentation extract obtained from a culture of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, or any combination thereof, and a pharma- ceutically acceptable carrier.

[0022] The present disclosure also provides a formulation for topical application comprising a cell-free fermented extract obtained from a culture of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3 or any combination thereof and a pharma- ceutically acceptable carrier. In one embodiment, the composition or formulation comprises a plurality of phenol-soluble modulin peptides (PSMs). In another or further embodiment, the PSM is a PSM selected from the group consisting of PSMβ1, PSMβ3, PSMβ4, PSMβ6, and any combination thereof. In another embodiment, the composition or formulation comprises PSMβ1, 3, 4, and 6. In a further embodiment, the formulation comprises a cream, ointment, salve spray, powder, oil, thickened formulation, or compress.

[0023] The present disclosure provides a method of treating a skin disorder associated with C. acnes comprising administering an effective amount of a composition or formulation of the present disclosure that inhibits the growth, viability or activity of C. acnes.

[0024] The disclosure also provides a method of diagnosing a skin disease or disorder comprising measuring the amount of PSMβ in a sample from the skin of a subject, wherein the measurement determines a level of a PSM selected from the group consisting of PSMβ1, PSMβ3, PSMβ4, PSMβ6 and any combination thereof and comparing the level to normal control levels of PSMβ1, PSMβ3, PSMβ4, PSMβ6 and any combination thereof, wherein a lower level in the sample is indicative of a skin disease or disorder. In one embodiment, the skin disease or disorder is a C. acnes infection.

[0025] The details of one or more embodiments of the invention are set forth in the accompanying drawings and the description below. Other features, objects, and advantages of the invention will become apparent from the description and drawings, and from the claims. [Brief description of the drawings]

[0026] [Figure 1A-1B] The domain architecture of the predicted NPRS cluster in S. capitis N030_E12 is shown. A. Several genes contain domains involved in the synthesis of antimicrobial peptides. The AMP-binding domain suggests acyl-CoA synthetase activity upstream of the acyl carrier protein (ACP). The condensation domain is found in many multidomain enzymes that synthesize peptide antibiotics and catalyzes the condensation reaction to form peptide bonds in nonribosomal peptide biosynthesis. There is also a nicotinamide adenine dinucleotide (NAD)-binding domain, including domains of the short-chain dehydrogenase / reductase (SDR) superfamily. B. Sequence comparison of S. capitis genes containing condensation domains with known reference genes using the bioinformatics tool Natural Product Domain Seeker (NaPDos), which rapidly detects and analyzes bacterial secondary metabolite genes, revealed similarity to known antimicrobial products.

[0027] [Figure 2A-2B] The domain architecture of the predicted trans-AT PKS cluster in S. epidermidis strains is shown. A. Polyketide synthases (PKSs) polymerize simple fatty acids to produce a wide variety of natural products called polyketides. Notable domains within PKS enzymes include dehydratases (DHs) and ketoreductases (KRs). B. Sequence comparison of S. epidermidis PKS_KS-containing genes to known reference genes using NaPDos revealed similarity to known antibacterial products.

[0028] [Diagram 3]Figure 1 shows inhibition of C. acnes growth in sterile supernatants of several different C. acnes strains. Growth of lesional acne-associated (C. acnes 25 and 26) and health-associated (C. acnes 27) strains was measured by OD600 after 72 h incubation in 100% sterile supernatants of the indicated C. acnes strains grown for 7 days in RCM medium. Supernatants of health-associated strains C.acnes_UCSD_HI12 and C.acnes_UCSD_HI30 (single locus sequence types D1 and A5, respectively) were potent inhibitors of C. acnes growth and were selected as attractive candidates for acne biotherapy (indicated by arrows and boxes).

[0029] [Figure 4] Antibacterial activity of 24 coagulase-negative staphylococci isolated from normal human skin against two Proprionibacterium acnes strains (ATCC 6919 and ATCC 29322). Anti-P. acnes activity of each CoNS clone was measured by radial diffusion assay. Briefly, 5 μl of overnight culture of each CoNS clone (white dots in each square) was spotted onto Brucella broth agar plates containing the indicated P. acnes strain. The agar plates were incubated at 37°C under anaerobic conditions for 72 h to grow P. acnes. The black areas represent the growth inhibition zones of P. acnes (see arrows). The numbers represent the key numbers of the CoNS strains listed in Table A.

[0030] [Figure 5A-5F]Functional screening methods and results for identifying antibacterial CoNS species targeting C. acnes. (A) Schematic of high-throughput antibacterial functional screening outlining the collection and selection of CoNS strains from two different healthy skin sites and the assay to detect antibacterial activity against C. acnes via co-culture on agar or growth in sterile conditioned supernatant of CoNS. (B, C) Growth of C. acnes after 24 h of incubation in 50% sterile filtered supernatant of the CoNS strain library (B) or growth of C. acnes with CoNS co-culture on agar (C). The most potent antibacterial CoNS isolate was selected and identified as S. capitis E12 (red), whereas S. hominus A9 (blue) showed no activity against C. acnes. (D) Table showing the inhibitory activity of S. capitis E12 and S. hominus A9 against several resident and pathogenic skin bacteria, including several strains of C. acnes isolated from healthy and acne skin, as measured by the magnitude of zone inhibition in the antibacterial agar assay (+ small, ++ medium, +++ large). (E) Growth of C. acnes C2 after 24 h of incubation in medium alone or with increasing concentrations of sterile supernatant of S. capitis E12 or S. hominus A9. (F) Viability of several staphylococci and C. acnes after 24 h of treatment with increasing concentrations of sterile supernatant of S. capitis E12 was measured by the number of viable CFU plated on the appropriate selective agar.

[0031] [Figures 6A-6H]Purification and identification of S. capitis E12 antimicrobial peptides. (A, B) 60% ammonium sulfate precipitated supernatant of S. capitis E12 was loaded onto an HLB column and eluted with 80% acetonitrile. The HLB eluate was loaded onto a C8 cartridge and eluted with 50% acetonitrile. Fractions were assayed for activity against C. acnes by agar assay (A) and liquid culture (B). (C) Total protein content of supernatants treated or untreated with S. capitis, and silver staining of SPE flow-through and elution fractions. (D) HPLC purification of S. capitis supernatant identified several peptide peaks, of which one fraction (21) was identified as having anti-C. acnes activity (E). Fraction 21 was pooled from five separate HPLC runs and purified by a second step HPLC to obtain two fractions (15 and 16) that showed anti-C. acnes activity (G). MS was performed on active fractions 15 and 16 with four inactive fractions as controls, and four different PSMβ peptides were identified as promising candidates for antimicrobial peptides. (H) Results of the top eight peptide hits from MS detection of HPLC purified active fractions (15 and 16) and control inactive fractions (13, 14, 17, and 18) showed that peptides corresponding to "antimicrobial proteins" were found and later confirmed to be PSMβ peptides.

[0032] [Figure 7A-7D]Figure 1 shows that whole genome sequence analysis of S. capitis E12 reveals the sequence and predicted properties of PSMβ peptides. (A) Schematic highlighting the S. capitis E12 gene cluster containing six genes encoding PSMβ peptides (PSMβ1-6). (B) Multiple sequence alignment (ClustalW) of all six PSMβ peptides (SEQ ID NOs: 9437, 9439, 9441, 9443, 9445, 9447) including the predicted charge of each peptide. (C) Lack of antibacterial activity against C. acnes during live co-culture or sterile supernatant exposure with ATCC S. capitis strains 35661 and 27840 lacking the PSMβ gene. (D) Representative helical wheel plot (Heliquest) of PSMβ1 showing the predicted amphipathic structure.

[0033] [Figure 8A-8F]Preclinical efficacy of PSMβ peptides and extracts as treatments for acne vulgaris. (A) Inhibition of C. acnes C2 after 72 h of incubation in the presence of S. capitis E12 extract or synthetic peptides PSMβ1, PSMβ4, PSMβ6 individually (A) or in combination of all three. (B) Growth of C. acnes C2 after 72 h of incubation in the presence of S. capitis extract or several different antibiotics. (C) Cytotoxicity of NHEKs treated for 24 h with supernatants of S. capitis E12, S. epidermidis C5, S. epidermidis 1457, and S. capitis 35561 expressed as percentage of maximum LDH release. (D) Visual representation of erythema in the dorsal skin of SKH1 mice after 24 h inoculation with 1x107 CFU of S. capitis E12, S. epidermidis C5, S. epidermidis 1457 and S. capitis 35661. (E) Total number of viable CFU of C. acnes C2 on ex vivo porcine skin explants after 24 h treatment with S. capitis E12 extract (10 mg / mL) or PBS control. (F) Total number of viable CFU of C. acnes C2 in the dorsal skin of SKH1 mice after 24 h treatment with S. capitis E12 extract (10 mg / mL) or PBS control.

[0034] [Figure 9A-9C]Characterization of the biological properties of S. capitis active molecules is shown. (A) Growth of C. acnes C2 was measured in liquid culture using S. capitis E12 supernatants that were untreated, boiled at 90°C for 15 min, or separated into retentate or flow-through fractions on 10 kDa or 3 kDa MWCO columns or not. (B) To measure antibacterial activity, supernatants of S. capitis E12 and control S. hominus A9 were subjected to papain or proteinase K proteolytic digestion (200 μg / ml) for 45 min at 37°C and inoculated onto agar containing C. acnes. (C) CoNS supernatants were precipitated with different saturating amounts of ammonium sulfate and the antibacterial activity of each precipitate was measured by the growth of C. acnes C2 72 h after treatment.

[0035] [Figure 10A-10B] Figure 1 shows that PSMβ peptides are extracted by n-butanol treatment of S. capitis E12 supernatant. (A) Antibacterial activity against C. acnes C2 is retained and enhanced after butanol extraction of PSMβ from sterile supernatant of S. capitis E12, but not against the lantibiotic-producing S. hominus A9. Silver staining of the total protein content of S. capitis E12 supernatant before and after butanol extraction shows enrichment of the small PSMβ peptide.

[0036] [Figure 11] Figure 1 shows that PSMβ does not synergize with the host LL-37 antimicrobial peptide. Evaluation of synergistic antimicrobial activity against C. acnes C2 from S. capitis E12 extract and human LL-37 antimicrobial peptide at the indicated concentrations.

[0037] As used in this specification and the appended claims, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an agent" includes a plurality of such agents, and reference to "a microorganism" includes one or more microorganisms and equivalents thereof known to those skilled in the art.

[0038] Also, the use of "or" means "and / or" unless specifically stated otherwise. Similarly, the terms "include," "including," "containing," and "including" are open ended and are not intended to be limiting.

[0039] Where the descriptions of various embodiments use the term "comprising," those of ordinary skill in the art will understand that in some specific instances, an embodiment may instead be described using the term "consisting essentially of" or "consisting of."

[0040] Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this disclosure belongs. Any methods and reagents similar or equivalent to those described herein can be used in the practice of the disclosed methods and compositions.

[0041] C. acnes (formerly Propionibacterium acnes; C. acnes and P. acnes, used interchangeably herein) is a slow-growing, aerotolerant, anaerobic, gram-positive bacterium associated with cutaneous acne. It can also cause chronic blepharitis and endophthalmitis, the latter occurring especially after intraocular surgery. P. acnes is a member of the normal skin flora, but plays an important role in the development of inflammatory acne when the microorganism proliferates within the pilosebaceous unit. Inflammatory acne is the most common disease of the human skin, affecting up to 80% of people throughout their lives.

[0042] As mentioned above, C. acnes plays a key role in the development of inflammatory acne when the microorganism proliferates within the pilosebaceous unit. Inflammatory acne is the most common disease of human skin, suffering from up to 80% of people throughout their lives. Acne has various manifestations, including comedones, papules, pustules, nodules, cysts, and pilosebaceous adenitis. Among these, inflammatory lesions of acne are of serious concern to patients, as they can lead to acne scarring and thereby cause negative psychological effects. The genome of the bacterium has been decoded, and studies have shown that some genes are capable of producing enzymes that break down skin and immunogenic (activating the immune system) proteins. This bacterium is mainly a resident flora and is part of the skin flora present on the skin of most healthy adults. Normally, this bacterium is barely detectable on the skin of healthy prepubertal children. It lives mainly on fatty acids in the sebum secreted by the sebaceous glands of the hair follicles, among others. It can also be found throughout the gastrointestinal tract.

[0043] The decrease in survival of P. acnes correlates with clinical improvement of the patient's acne. Systemic antibiotics have been used to treat acne for decades and are still widely prescribed to acne patients. Topical antibiotics are also effective, and the oxidizing agent benzoyl peroxide (BPO) is one of the most frequently used topical medications for acne treatment. Topical medications are often used as a first-line treatment for patients suffering from mild to moderate acne. However, current antibiotic treatments have significant drawbacks. Systemic antibiotics nonspecifically disrupt the microbial ecosystem and promote antibiotic resistance. Topical antibiotics are very poor at killing P. acnes on the skin surface.

[0044] The present disclosure demonstrates that coagulase-negative Staphylococci (CoNS) species, such as S. epidermidis and S. capitisnoyouna, that are normally present on the skin, protect against C. acnes by producing factors that inhibit C. acnes. Thus, the present disclosure provides prebiotics, probiotics, and postbiotics that can be used to treat C. acnes infections and / or inhibit the growth of C. acnes.

[0045] The present disclosure shows, for example, that S. capitis E12 consistently produces sufficient amounts of antimicrobial peptides to kill C. acnes. Surprisingly, incubation of 0.6x concentrated S. capitis E12 supernatant with acne-associated strains of C. acnes reduced the survival of the disease-associated bacteria by over 4 logs and completely sterilized the culture after 24 days. Another attractive feature is that C. acnes C2 showed no acquired resistance until the 20th generation. The potency and poor ability to induce resistance from drugs, including, for example, PSMs, produced by S. capitis E12 is consistent with the mechanism of action of the amphipathic structure of these peptides, the α-helix. Such a structure is common to many antimicrobial peptides and allows for the insertion and destabilization of bacterial membranes. Such a mechanism of direct membrane disruption is ideal for antimicrobial agents that act on epithelial surfaces.

[0046] Although the S. capitis genome contains a cluster of genes encoding up to six PSMs, PSMβ1, 3, 4, and 6 were readily detected by MS analysis of purified active fractions. Antimicrobial assays using synthetic peptides PSMβ1, 4, and 6 showed higher activity against C. acnes when bacteria were treated with a combination of all three. Similarly, the predicted overall charge of each PSMβ is subtly different, which may affect its ability to bind to hydrophobic columns and its interaction with bacterial membranes. Individually, the synthetic PSM peptides were much less potent than the extracts. PSMβ2 and PSMβ5 may also be secreted by S. capitis, but are not biologically active per se, but are thought to be eluted in different fractions that increase the activity of PSMβ1, 3, 4, and 6. β-class PSMs are found in other staphylococci, usually in numbers of 2–4. However, their exact role remains unclear, and unlike the smaller PSMα, they are not thought to be involved in virulence. Two βPSMs (PSMβ1 / 2) exist in S. aureus, but neither has been reported to have antibacterial activity. Other synthetic PSMβ peptides have been shown to inhibit S. aureus in vitro in other studies, but are not known to be active against C. acnes. Thus, by employing the current screening approach, activity was identified that could not be detected by genetic screening approaches alone. The optimal killing efficacy and specificity of combinations, rather than individual peptides, suggests that therapeutic approaches combining multiple PSMs or the living organism itself may be most effective. Thus, the present disclosure shows that the skin microbiome is a valuable resource for discovering novel antibacterial agents with remarkable selectivity for certain pathogens and of value in combating skin diseases such as acne vulgaris.

[0047] The term "contacting" refers to exposing a topical prebiotic, probiotic and / or postbiotic composition to the skin such that the composition can kill or inhibit C. acnes on the skin.

[0048] The term "fermented extract" as used herein refers to the product of fermentation of probiotic resident skin bacteria in culture and under suitable fermentation conditions. For example, S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and / or S. epidermidis N018_F3 can be cultured to produce factors useful for inhibiting the growth and survival of C. acnes. Extracts from S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and / or S. epidermidis N018_F3 can be applied to the skin to inhibit the growth and / or infection of C. acnes and / or treat acne vulgaris. In some embodiments, the fermented extract comprises one or more PSMs selected from the group consisting of PSM beta-1, -2, -3, -4, -5, -6 and any combination thereof.

[0049] The term "inhibit" or "inhibitory effective amount" refers to an amount of a prebiotic, probiotic and / or postbiotic skin composition consisting of, consisting essentially of, or consisting of one or more probiotic microorganisms and / or fermentation media or extracts and / or fermentation by-products (e.g., PSMβs) and / or synthetic molecules sufficient to inhibit the growth, proliferation or presence of C. acnes on the skin, for example. The term "inhibit" also includes preventing or ameliorating signs or symptoms of a disorder (e.g., acne, pain, etc.).

[0050] The term "phenol-soluble modulin" or "PSM" refers to a family of protein toxins produced by staphylococci that are soluble in phenol. The protein sequences of PSMs vary. In the present disclosure, a series of PSMs are identified that inhibit the growth and survival of C. acnes. These PSMs are identified in FIG. 7B (e.g., PSMβ1-6). The PSMs of the present disclosure can be synthesized using a peptide synthesizer or purified from a fermentation extract of a culture, for example, with S. capitis E12. Alternatively, the present disclosure provides coding sequences for the PSMs of the present disclosure. Such coding sequences can be used to produce the PSMs by recombinant molecular biology techniques. For example, one skilled in the art can insert the coding sequence for one or more PSMs into an expression vector and then transfect or transform a suitable host cell (e.g., a bacterial cell) with the vector such that the recombinant bacterial cell expresses the one or more PSMs. Such recombinant bacterial cells can be used in the probiotics of the present disclosure, or can be used to produce postbiotics (e.g., extracts) suitable for the methods described herein in the treatment of acne.

[0051] The term "postbiotic," "postbiotic composition," or "topical postbiotic composition" or "postbiotic skin composition" as used herein refers to non-viable bacterial products or metabolic by-products from probiotic organisms, including probiotic skin resident fermentation extracts and pharmaceutical carriers. In certain embodiments, the postbiotic comprises at least two, at least three, at least four of PSMβ1, 3, 4, and / or 6.

[0052] The term "polynucleotide" as used herein refers to a polymer of deoxyribonucleotides or ribonucleotides, either in the form of an independent fragment or as a component of a larger genetic construct (e.g., by operably linking a promoter to a polynucleotide encoding a peptide of the present disclosure). Numerous genetic constructs (e.g., plasmids and other expression vectors) are known in the art and can be used to produce the peptides of the present disclosure in cell-free systems or in prokaryotic or eukaryotic (e.g., yeast, insect, or mammalian) cells. Given the degeneracy of the genetic code, one of skill in the art can readily synthesize polynucleotides encoding the peptides of the present disclosure. The polynucleotides of the present disclosure (those set forth in the attached sequence listing) can be readily used in conventional molecular biology, including the generation of probes, primers, and expression constructs.

[0053] The term "prebiotics" as used herein refers to compounds or agents that stimulate the growth and / or activity of S. epidermidis and / or S. capitis of the present disclosure. For example, a subject suffering from acne or C. aces infection can, for example, apply a prebiotic to his / her skin, so that the prebiotic stimulates the growth and activity of S. epidermidis and / or S. capitis of the present disclosure. Thus, the stimulated growth and activity of S. epidermidis and / or S. capitis will produce an inhibitory effect on C. acnes infection, thereby treating acne. Prebiotic compounds may include polysaccharides, hydrolysates, salts, herbal extracts, or other compounds sufficient to promote the growth of the relevant probiotic strains (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. lugdnensis N028_E7, and / or S. epidermidis N018_F3) when used in combination with the strains, such as, for example, yeast hydrolysate at a concentration of less than about 40% (w / w), microcrystalline cellulose at a concentration of less than about 10% (w / w), and / or sucrose at a concentration of less than about 10% (w / w). Other examples of prebiotics that may be adapted for use with skin bacteria include inulin, gluco-oligosaccharides, isomalto-oligosaccharides, lactosucrose, polydextrose, soybean oligosaccharides, and xylo-oligosaccharides, as well as those disclosed in Gibson, GR and Roberfroid, M, (Eds.) Handbook of Prebiotics, CRC press (2008), Roberfroid, M, J. Nutr. 137(3):830S-837(2007) and Slavin, J. Nutrients 5(4):1417-1435(2013), each of which is incorporated herein by reference in its entirety.

[0054] As used herein, the term "probiotic", "probiotic composition" or "topical probiotic composition" or "probiotic skin composition" includes a probiotic resident skin bacteria, an attenuated or artificial microorganism expressing an agent that inhibits the growth or infection of C. acnes (e.g., at least two or more of the PSMβs described herein), and a pharmaceutical carrier that maintains the viability of the resident skin bacteria. In some embodiments, the probiotic includes a suitable pharma- ceutically acceptable carrier for the formulation components and includes the probiotic resident bacteria of the present disclosure at least 50-80%, 85%, 87%, 90%, 92%, 95%, 98% or 100% purified.

[0055] In some embodiments, the probiotic compositions described herein consist or consist of a probiotic organism. In further embodiments, the probiotic organism is a bacterium. In further embodiments, the bacterium comprises a component of normal skin flora. In further embodiments, the bacterium consists or consists of a strain of Staphylococcus hominis. In other embodiments, the bacterium consists or consists of a strain of Staphylococcus epidermidis. In yet another embodiment, the bacterium consists or consists of a strain of Staphylococcus capitis. In yet another embodiment, the bacterium consists or consists of a strain of Staphylococcus lugdnensis. In other embodiments, the probiotic consists or consists of a mixture of strains. In some embodiments, the mixture of strains consists or consists of multiple strains of S. hominis. In other embodiments, the mixture of strains consists or consists of multiple strains of S. epidermidis. In other embodiments, the mixture of strains consists or consists of multiple strains of S. capitis. In other embodiments, the mixture of strains consists of or consists of multiple strains of S. lugdnensis and / or one or more strains of S. capitis and / or one or more strains of S. lugdnensis. In other embodiments, the mixture of strains consists of or consists of one or more strains of S. hominis and one or more strains of S. epidermidis. In some embodiments, the composition consists of or consists of one or more strains in addition to S. hominis, S. epidermidis, S. capitis and / or S. lugdnensis. In some further embodiments, the additional strain(s) consists of one or more strains from the genera Staphylococcus, Lactobacillus or Lactococcus.Particular probiotic formulations consist of or consist of S. capitis N030_E12, S. idermidis AMT5_C5, S. idermidis N009_G7, S. gdnensis N028_E7, and / or S. dermidis N018_F3. Such formulations typically contain a sufficient amount of bacterial cells to provide a final density of 103 to 106 CFU / cm2 when applied to the skin of a subject. Such formulations may contain a concentration of about 104 to about 107 CFU / g, or alternatively, a concentration of 10 to about 105 CFU / g, or alternatively, a concentration of about 105 to about 109 CFU / g. Such formulations may include multiple strains of S. hominis, S. epidermidis, S. capitis, and / or S. lugdnensis, and may further include Lactococcus lactis, Lactobacillus plantarum, Lactobacillus rhamnosus, Lactobacillus acidophilus, and / or other species or strains known in the art to form part of the normal healthy skin or mucosal flora. In some embodiments, S. hominis (e.g., strains -A12, -C2, -D12, and / or -G1 listed in Table A) constitute 100% of the bacterial cells in the formulation.In some further embodiments, staining for S. hominis indicates that the bacterial cells in a given preparation comprise less than 90-100%, 85-95%, 70-80%, 75-85%, 60-70%, 65-75%, 50-60%, 55-65%, 40-50%, 45-55%, 30-40%, 35-45%, 20-30%, 25-35%, 10-20%, 15-20%, 1-10%, 5-15%, or 1% of the bacterial cells, with the remainder of these colony forming units being S. epidermidis, S. capitis, and / or S. lugdnensis, or Lactococcus lactis, Lactobacillus plantarum, Lactobacillus rhamnosus, Lactobacillus acidophilus, and / or other such strains known in the art to form part of the normal healthy skin or mucous membrane flora.

[0056] In some embodiments, bacteria other than S. hominis, S. epidermidis, S. capitis, and / or S. lugdnensis comprise about 50% or less of the bacterial cells in a formulation. In some embodiments, the bacteria comprise less than 50%, 40%, 30%, 20%, 10%, 5%, or 1% of the bacterial cells in a given formulation. In some embodiments, bacteria other than S. hominis, S. epidermidis, S. capitis, and / or S. lugdnensis may include Lactococcus lactis, Lactobacillus plantarum, Lactobacillus rhamnosus, Lactobacillus acidophilus, and / or other such species or strains known in the art to form part of the normal healthy skin or mucous membrane flora. In some embodiments, the formulation may contain a combination of two or four strains of S. hominis, S. epidermidis, S. capitis, and / or S. lugdnensis, in any percentage between about 1% and 99% of a particular strain (e.g., about 25% S. hominis, about 25% S. epidermidis, about 25% S. capitis, and about 25% S. lugdnensis). Any percentage or ratio of two or more (e.g., 2, 3, 4) strains that exhibit positive inhibition of C. acnes is contemplated herein. In some embodiments, the formulation contains about 50% S. capitis and about 50% S. epidermidis of the strains listed above. In some embodiments, the formulation contains about 40% S. capitis and about 60% S. epidermidis of the strains listed above. In some embodiments, the formulation comprises about 70% S. capitis and about 30% S. epidermidis of the strains described above. In some embodiments, the formulation comprises about 30% S. capitis and about 70% S. epidermidis of the strains described above. In some embodiments, the formulation comprises about 80% S. capitis and about 20% S. epidermidis of the strains described above.In some embodiments, the formulation comprises about 20% S. capitis and about 80% S. epidermidis of the strains listed above. In some embodiments, the formulation comprises about 90% S. capitis and about 10% S. epidermidis of the strains listed above. In some embodiments, the formulation comprises more than about 90% S. capitis and less than about 10% S. epidermidis of the strains listed above. In some embodiments, the formulation comprises less than about 10% S. capitis and more than about 90% S. epidermidis of the strains listed above.

[0057] The term "probiotic resident skin bacteria" as used herein includes microorganisms of the skin microbiome. The probiotic resident skin bacteria may include a bacterial composition that inhibits the growth or infection of C. acnes or kills C. acnes. In one embodiment, the probiotic resident skin bacteria includes one or more bacteria selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and S. epidermidis N018_F3.

[0058] As used herein, the terms "purified" and "substantially purified" refer to cultures or co-cultures of microorganisms or biological agents (e.g., fermentation media and extracts, fractionated fermentation media, fermentation by-products, peptides, polypeptides, genes, polynucleotides, etc.) that are substantially free of other cells or components found in the natural environment in which the agent is naturally associated when produced in vivo. The level of purification can vary from about 50-80% purity to 100% purity for certain microorganisms or agents.

[0059] The term "therapeutically effective amount" as used herein for the treatment of a subject suffering from a disease or disorder caused by overgrowth or infection of C. acnes means an amount of prebiotic, probiotic and / or postbiotic skin composition or extract thereof sufficient to ameliorate the signs or symptoms of the disease or disorder. For example, a therapeutically effective amount can be measured as an amount sufficient to reduce the symptoms of acne in a subject. Typically, a subject is treated with an amount that reduces the symptoms of the disease or disorder by at least 50%, 90% or 100%. In general, the optimal dosage depends on factors such as the disorder, the weight of the subject, the type of bacteria, the sex of the subject, and the severity of the symptoms. Nevertheless, a person skilled in the art can easily determine the appropriate dosage.

[0060] As used herein, the term "topical" can include external administration to the skin, as well as shallow injections (e.g., intradermal and intralesional), such that the topical probiotic compositions described herein come into direct contact with the skin and dermal layer.

[0061] The present disclosure provides whole cell preparations, including substantially homogenous or substantially pure preparations of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and / or S. epidermidis N018_F3. Such preparations can be used in the preparation of compositions for the treatment of acne, inflammation, and microbial infections. The whole cell preparations can include S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and / or S. epidermidis N018_F3. The present disclosure also provides fractions derived from such whole cells, including agents that reduce the growth or viability of C. acnes in the skin.

[0062] The ability of a first bacterial composition (e.g., S. capitis) to inhibit the activity of a second bacterial composition (e.g., C. acnes) can be determined, for example, by contacting a probiotic or postbiotic with, for example, C. acnes, and measuring the growth or viability of C. acnes before and after contact with the probiotic or postbiotic. Contacting an organism with a topical probiotic composition of the present disclosure can occur in vitro, for example, by adding a topical probiotic or postbiotic composition to a bacterial culture. Alternatively, contacting can occur in vivo, for example, by contacting a topical probiotic or postbiotic composition with a subject suffering from a skin disease or disorder.

[0063] The probiotic resident skin bacteria preparation or postbiotic composition can be prepared in various ways. In one embodiment, the probiotic resident skin bacteria preparation is prepared by cultivating and isolating a bacterial strain selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3 and any combination thereof, and resuspending the bacterial strain(s) in a suitable carrier. In another embodiment, the postbiotic composition is prepared by cultivating a resident bacterial strain selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3 and any combination thereof under conditions to obtain a fermentation product, obtaining a cell-free preparation of a fermentation extract, and combining the extract with a suitable carrier.

[0064] A topical probiotic or postbiotic composition can be administered to a subject using any of a variety of methods known in the art.For example, the probiotic or postbiotic skin composition or extract or synthetic formulation of the present disclosure can be formulated for topical administration (e.g., as a lotion, cream, spray, gel, or ointment).Such topical formulations are useful for treating or suppressing the presence of microorganisms, fungi, viruses, or infections or inflammation on the skin.Examples of formulations include topical lotions, creams, soaps, wipes, etc.

[0065] In yet another embodiment, a topical probiotic composition is provided that includes multiple species of probiotic resident skin bacteria. When used to treat acne or other skin diseases or disorders associated with increased levels or activity of C. acne, the composition includes one or more bacteria that inhibit such C. acnes on the skin. In such an example, the probiotic resident skin bacteria is a coagulase-negative Staphylococcus sp. In one embodiment, the probiotic resident skin bacteria is selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3, and any combination thereof.

[0066] In another embodiment, the topical probiotic composition comprises a postbiotic skin flora fermentation extract that inhibits the growth or activity of C. acnes on the skin. In various aspects, the bacteria from which the extract is produced include S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and / or S. epidermidis N018_F3.

[0067] According to further embodiments, the topical composition may be formulated as a lotion, shake lotion, cream, ointment, gel, foam, powder, solid, paste or tincture.

[0068] In another embodiment, a bandage or dressing is provided comprising the topical prebiotic, probiotic and / or postbiotic composition as described above. In various embodiments, a bandage or dressing is provided, the main components of which include a matrix and a probiotic skin flora that inhibits C. acnes on the skin. In various embodiments, a bandage or dressing is provided, the main components of which include a matrix and a postbiotic that inhibits C. acnes on the skin.

[0069] Pharmaceutical compositions, including the probiotic skin compositions disclosed herein, including resident flora (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and / or S. epidermidis N018_F3), may be formulated in any form suitable for topical administration for local or systemic effect, such as emulsions, solutions, suspensions, creams, gels, hydrogels, ointments, powders, dressings, elixirs, lotions, suspensions, tinctures, pastes, foams, films, aerosols, irrigation, sprays, suppositories, bandages, skin patches, and the like. Topical formulations containing the probiotics disclosed herein may also include liposomes, micelles, microspheres, nanosystems, and mixtures thereof.

[0070] "Pharmaceutically acceptable carrier" is intended to include solvents, dispersion media, coatings, antibacterial and antifungal agents (as appropriate, provided they do not adversely affect the probiotic resident bacteria), isotonic and absorption delaying agents, and the like. The use of such media and agents for pharmaceutically active substances is well known in the art. Except insofar as any conventional media or agent is incompatible with the pharmaceutical composition, their use in therapeutic compositions and methods is contemplated. Supplementary active compounds can also be incorporated into the compositions.

[0071] Pharmaceutically acceptable carriers and excipients suitable for use in the topical formulations disclosed herein include, but are not limited to, aqueous vehicles, water-miscible vehicles, non-aqueous vehicles, stabilizers, solubility enhancers, isotonicity agents, buffers, antioxidants, local anesthetics, suspending and dispersing agents, wetting or emulsifying agents, complexing agents, encapsulating or chelating agents, penetration enhancers, cryoprotectants, lyophilization protection agents, thickening agents, and inert gases.

[0072] Pharmaceutical compositions containing probiotics can be formulated in the form of ointments, creams, sprays and gels. Suitable ointment vehicles include oils such as lard, benzoinized lard, olive oil, cottonseed oil, and oily or hydrocarbon vehicles such as white petrolatum; emulsifying or absorbing vehicles such as hydrophilic petrolatum, hydroxystearin sulfate, glycerol, anhydrous lanolin; water-removable vehicles such as hydrophilic ointments; water-soluble ointment vehicles such as polyethylene glycols of different molecular weights; emulsion vehicles, either water-in-oil (W / O) emulsions or oil-in-water (O / W) emulsions, such as cetyl alcohol, glyceryl monostearate, lanolin, and stearic acid (see Remington: The Science and Practice of Pharmacy). These vehicles are emollient, but generally require the addition of antioxidants and preservatives.

[0073] Suitable cream bases can be oil-in-water or water-in-oil. Cream vehicles can be water-washable and include an oil phase, an emulsifier, and an aqueous phase. The oil phase, also called the "internal" phase, is generally composed of petrolatum and fatty alcohols such as cetyl or stearyl alcohol. The aqueous phase usually, but not necessarily, exceeds the oil phase in volume and generally contains a moisturizer. The emulsifier in a cream formulation can be a nonionic, anionic, cationic, or amphoteric surfactant.

[0074] Gels are semi-solid suspension-type systems. Single-phase gels contain material substantially uniformly throughout the liquid carrier. Suitable gelling agents include cross-linked acrylic polymers such as carbomer, carboxypolyalkylene, Carbopol™; hydrophilic polymers such as polyethylene oxide, polyoxyethylene-polyoxypropylene copolymers, polyvinyl alcohol; cellulosic polymers such as hydroxypropylcellulose, hydroxyethylcellulose, hydroxypropylmethylcellulose, hydroxypropylmethylcellulose phthalate, methylcellulose; gums such as tragacanth, xanthan gum; sodium alginate; gelatin, and the like. To prepare a uniform gel, the gelling agent can be dispersed by adding dispersing agents such as alcohol or glycerin, or by trituration, mechanical mixing, and / or stirring.

[0075] In another embodiment, pharmaceutical compositions comprising the prebiotics, probiotics and / or postbiotics disclosed herein may be formulated alone or in combination with one or more additional therapeutic agents, including, but not limited to, chemotherapeutic agents, antibiotics (so long as they do not destroy the benefits of the probiotics), antifungals, antipruritics, analgesics, protease inhibitors and / or antivirals.

[0076] As used herein, topical administration includes intradermal, intraconjunctival, intracorneal, intraocular, ocular, auricular, transdermal, nasal, vaginal, urethral, ​​respiratory, and rectal administration. Such topical formulations are useful for treating or inhibiting infections of the eye, skin, and mucous membranes (e.g., mouth, vagina, rectum). Examples of commercially available formulations include topical lotions, creams, soaps, wipes, etc.

[0077] Solutions or suspensions for use in pressurized containers, pumps, sprays, atomizers, or nebulizers may be formulated to contain ethanol, aqueous ethanol, or a suitable alternative agent to disperse, solubilize, or extend the release of the active ingredients disclosed herein, a propellant as a solvent; and / or a surfactant, such as sorbitan trioleate, oleic acid, or oligolactic acid.

[0078] Materials useful for forming an erodible matrix include chitin, chitosan, dextran and pullulan; agar gum, gum arabic, gum karaya, locust bean gum, tragacanth gum, carrageenan, gum ghatti, guar gum, xanthan gum, and scleroglucan; starches such as dextrin and maltodextrin; hydrophilic colloids such as pectin; phosphates such as lecithin; alginates; propylene glycol alginate; gelatin; collagen; and ethyl cellulose (EC), methyl ethyl cellulose (MEC), carboxymethyl cellulose (CMC), CMEC, hydroxyethyl cellulose (HEC), hydroxypropyl cellulose (PP), methyl ethyl cellulose (MEC), carboxymethyl cellulose (CMC), CMEC, hydroxypropyl cellulose (HEC), hydroxypropyl cellulose (HPC), methyl ethyl cellulose (MEC), methyl ethyl cellulose (MEC), carboxymethyl cellulose (CMEC), hydroxypropyl cellulose (HPC), methyl ethyl cellulose (MEC ... Cellulosic compounds such as cellulose acetate (CA), cellulose propionate (CP), cellulose butyrate (CB), cellulose acetate (CAB), cellulose acetate (CAP), cellulose acetate (CAT), hydroxypropyl methylcellulose (HPMC), HPMCP, HPMCAS, hydroxypropyl methylcellulose acetate trimellitate (HPMCAT), and ethyl hydroxyethyl cellulose (EHEC); polyvinylpyrrolidone; polyvinyl alcohol; polyvinyl acetate; glycerol fatty acid esters; polyacrylamide; polyacrylic acid; copolymers of ethacrylic acid or methacrylic acid (EUDRAGIT, Rohm polylactide; copolymers of L-glutamic acid and ethyl-L-glutamic acid; degradable lactic acid-glycolic acid copolymers; poly-D-(-)-3-hydroxybutyric acid; and other acrylic acid derivatives, such as, but not limited to, homopolymers and copolymers of butyl methacrylate, methyl methacrylate, ethyl methacrylate, ethyl acrylate, (2-dimethylaminoethyl) methacrylate, and (trimethylaminoethyl) methacrylate chloride.

[0079] If necessary, a suitable treatment regimen may combine administration of the prebiotic, probiotic, and / or postbiotic compositions of the present disclosure with one or more additional therapeutic agents (e.g., inhibitors of TNF, antibiotics, etc.). The peptide(s), other therapeutic agents, and / or antibiotics may be administered simultaneously, but may also be administered sequentially. Suitable antibiotics include aminoglycosides (e.g., gentamicin), beta-lactams (e.g., penicillins and cephalosporins), quinolones (e.g., ciprofloxacin), and novobiocin. Generally, antibiotics are administered in bactericidal amounts. A "bactericidal amount" is an amount sufficient to achieve a bactericidal concentration in the subject being treated. According to its conventional definition, an "antibiotic" as used herein is a chemical that, in a dilute solution, inhibits the growth of or kills microorganisms. Synthetic antibiotics (e.g., analogs) known in the art are also included in the term.

[0080] The compositions provided herein include sulfa drugs, such as sulfamethizole, sulfisoxazole, sulfamonomethoxine, sulfamethizole, salazosulfapyridine, and silver sulfadiazine; quinoline antibacterial agents, such as nalidixic acid, pipemidic acid trihydrate, enoxacin, norfloxacin, ofloxacin, tosufloxacin tosylate, ciprofloxacin hydrochloride, lomefloxacin hydrochloride, sparfloxacin, and fleroxacin; isoniazid, ethambutol (ethambutol hydrochloride), p-aminosalicylic acid (p-aminosalicylic acid), and benzodiazepine; Anti-inflammatory drugs such as calcium ricinate, pyrazinamide, ethionamide, prothionamide, rifampicin, streptomycin sulfate, kanamycin sulfate, and cycloserine; anti-acid bacteria drugs such as diaphenylsulfone and rifampicin; antiviral drugs such as idoxuridine, acyclovir, vidarabine, and ganciclovir; anti-HIV drugs such as zidovudine, didanosine, zalcitabine, indinavir sulfate ethanolate, and ritonavir; anti-spirochetal drugs; tetracycline hydrochloride, ampicillin, piperacillin, gentamicin, and dibekacin , Kanendomycin, Lividomycin, Tobramycin, Amikacin, Fradiomycin, Sisomycin, Tetracycline, Oxytetracycline, Rolitetracycline, Doxycycline, Ampicillin, Piperacillin, Ticarcillin, Cephalothin, Cephapirin, Cephaloridine, Cefaclor, Cephalexin, Cefroxadine, Cefadroxil, Cefamandole, Cefotoam, Cefuroxime, Cefotiam, Cefotiam Hexetil, Cefuroxime Axetil, Cefdinir, Cefditoren Pivoxil, Cef It may be used concomitantly with other antibacterial agents, including antibiotics such as tazidime, cefpiramide, cefsulodin, cefinoxime, cefpodoxime proxetil, cefpirome, cefzoplan, cefpime, cefsulodin, cefinoxime, cefinetazole, cefminox, cefoxitin, cefbuperazone, latamoxef, flomoxef, cefazolin, cefotaxime, cefoperazone, ceftizoxime, moxalactam, thienamycin, sulfazecin, aztreonam or their salts, griseofulvin, lankacidin group, etc.

[0081] In yet another embodiment, the compositions provided herein (e.g., the prebiotic, probiotic and / or postbiotic compositions provided herein) can be combined with one or more steroid drugs known in the art, including, but not limited to, aldosterone, beclomethasone, betamethasone, deoxycorticosterone acetate, fludrocortisone acetate, hydrocortisone (cortisol), prednisolone, prednisone, methylprenisolone, dexamethasone, and triamcinolone.

[0082] In yet another embodiment, the compositions provided herein (e.g., prebiotic, probiotic and / or postbiotic compositions) comprise at least one selected from the group consisting of amorolfine, amphotericin B, anidulafungin, bifonazole, It may be combined with one or more antifungal agents, including, but not limited to, butenafine, butoconazole, caspofungin, ciclopirox, clotrimazole, econazole, fenticonazole, filipin, fluconazole, isoconazole, itraconazole, ketoconazole, micafungin, miconazole, naftifine, natamycin, nystatin, oxiconazole, ravuconazole, posaconazole, rimocidin, sertaconazole, sulconazole, terbinafine, terconazole, tioconazole, and voriconazole.

[0083] Also described herein are kits and articles of manufacture for use in the therapeutic applications described herein. Such kits can include carriers, packages, or containers that are compartmentalized to receive one or more containers, such as vials, tubes, and the like, each container containing one of the separate elements used in the methods described. Suitable containers include, for example, bottles, vials, syringes, and test tubes. Containers can be formed of a variety of materials, such as glass and plastic.

[0084] For example, a container can contain one or more compositions provided herein (e.g., prebiotic, probiotic and / or postbiotic compositions), optionally in combination with additional agents disclosed herein. Such kits optionally include compositions disclosed herein together with instructions, labels or directions for use in the methods described herein.

[0085] The present disclosure provides a more selective and powerful method for killing and / or inhibiting the growth of C. acnes. The present disclosure provides a resident skin strain that produces selective antibacterial activity against pathogenic bacterial strains, but not against other members of the skin microflora. Thus, antibacterial therapy using a resident strain will selectively kill the targeted microbial strain. The ability to selectively kill pathogenic bacteria over normal microflora is highly desirable, as it may help maintain homeostasis and form a normal microflora. Many resident skin strains of CoNS produce multiple antibacterial agents. In this case, antibacterial therapy using a resident strain would have a low risk of generating resistant mutants to antibiotics. The CoNS strains provided herein are originally isolated from normal human skin, and therefore have low toxicity to the host. The present disclosure can be used as live bacteria applications, or as sterile extracts (e.g., fermentation extracts) of bacteria, or as purified active proteins, or as synthetic peptides.

[0086] The present disclosure provides two Cutibacterium acnes (C. acnes) strains that are potent antagonists of several coagulase-negative Staphylococci (CoNS) strains, as well as acne-associated C. acnes strains.

[0087] Table A provides several coagulase-negative Staphylococci (CoNS) strains with anti-P. acnes activity.

[0088] Table A JPEG0007624219000001.jpg117138

[0089] #17 (S. epidermidis A11) in Table A has been deposited with the ATCC under accession number PTO-125202, #23 (S. hominis A9) in Table A has been deposited with the ATCC under accession number PTA-125203, and #24 in Table A was used as a negative control strain with no antibacterial activity. See FIG. 4 for the efficacy of antibacterial activity against the two P. acnes.

[0090] The present disclosure exemplifies four strains of skin-derived CoNS: S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and S. epidermidis N018_F3. A list of sequences consisting of all open reading frames detected from each of the aforementioned strains is attached to this disclosure and is incorporated herein for all purposes. Thus, the strains of the present disclosure (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and S. epidermidis N018_F3) can be identified using various probe and sequence techniques and the sequence listing provided herein. For example, S. capitis strain N030_E12 can be identified by determining whether an isolated S. capitis strain expresses one or more of the nucleic acid sequences identified in SEQ ID NOs:1-2377 or produces PSMβ1, 3, 4 and 6 (see, e.g., SEQ ID NOs:9437, 9441, 9443 and 9447). Similarly, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and S. epidermidis N018_F3 strains can be identified by determining whether the isolated S. epidermidis AMT5_C5, S. epidermidis N009_G7 and S. epidermidis N018_F3 strains express one or more of the nucleic acid sequences identified in SEQ ID NOs: 2378-4765 (S. epi C5); 4766-7145 (S. epi, G7); or 7146-9435 (S. epi F3).

[0091] These strains showed broad antibacterial activity against several different strain types of C. acnes isolated from healthy and acne skin, but showed low potency against other gram-positive skin flora and gram-negative bacteria, making them attractive candidates for biotherapy (Table 1). Furthermore, it was also described that two strains of C. acnes: C. acnes_UCSD_HI12 and C. acnes_UCSD_HI30, showed strong inhibitory effects against different C. acnes strains by radial diffusion assay (Table 2) and liquid culture (Figure 3). The application or contact of selected CoNS or C. acnes strains to skin targets eliminated the acne-causing C. acnes without eliminating other skin flora that play beneficial roles in health.

[0092] Table 1: Results of antagonism of CoNS against several different bacterial species by radial diffusion assay. Zone of kill / inhibition by radial diffusion: + small, ++ medium, +++ large. JPEG0007624219000002.jpg192164

[0093] Table 2: Several distinct C. acnes strains isolated from healthy human (HI) skin were also found to inhibit the growth of different C. acnes strains from both healthy and acne skin. Two different strains of C. acnes: C. acnes_UCSD_HI12 and C. acnes_UCSD_HI30 produced potent inhibitory products against several strains of C. acnes. Both live cultures and sterile supernatants of both strains were found to inhibit the growth of C. acnes as measured by radial diffusion in agar (Table 2) and liquid cultures (Figure 3). JPEG0007624219000003.jpg90138

[0094] The four Staphylococcal strains included in this disclosure were found to contain several biosynthetic gene clusters encoding sequenced and predicted nonribosomal peptide synthetases (NRPSs) and / or polyketide synthases (PKSs). These are the main multimodular enzyme complexes that synthesize secondary metabolites such as antimicrobial peptides, antibiotics, and siderophores. Each module of the NRPS cluster activates a different amino acid or carboxyl acid and subsequently condenses them sequentially to synthesize linear or cyclic natural products (see Figure 1). Figure 1 highlights such an NRPS cluster in S. capitis N030_E12 identified by antiSMASH. This is a comprehensive resource that allows genome-wide identification, annotation, and analysis of secondary metabolite biosynthetic gene clusters in bacterial genomes. The S. capitis NRPS cluster contains several genes with specific signature domains that may be involved in the synthesis of antimicrobial peptides such as gramicidin and tyrocidine. Figure 2 highlights the trans-AT polyketide synthase (PKS) clusters of S. epidermidis strains AMT5_C5, N009_G7, and N018_F3 identified by antiSMASH. The PKS machinery contains three essential domains: acyltransferase (AT), acyl carrier protein (ACP), and ketosynthase (KS). For example, some polyketides produced by the genus Bacillus include difficidin and macrolactin. Therefore, this PKS cluster present in all three S. epidermidis species may be a source for novel antimicrobial peptides.

[0095] In one embodiment, the present disclosure provides a probiotic composition for topical delivery comprising a CoNS skin resident flora of the present disclosure (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and / or S. epidermidis N018_F3). In a further embodiment, the topical composition comprises only one, two, three, or four of the strains selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and S. epidermidis N018_F3. In yet another embodiment, the topical probiotic composition of the present disclosure can comprise or consist of a skin flora selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and S. epidermidis N018_F3, and any combination thereof, where the skin flora is substantially pure (e.g., 80%, 85%, 87%, 90%, 92%, 95%, 98%, or 100% pure from other species found on the subject's skin).

[0096] In some embodiments, the composition comprises a cream, ointment, oil suspension, or salve, in which the probiotic bacteria (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. lugdnensis N028_E7, and / or S. epidermidis N018_F3) are incorporated within a moisturizer or emulsion as described above below and in Nakatsuji et al. (2016) Nature Medicine. In some embodiments, the composition comprises a patch or compress in which the bacteria are combined with suitable excipients and incorporated within a fabric, gel matrix, or polymer sheet. Suitable excipients and carriers for topical administration are known in the art and include thickeners, emulsifiers, fatty acids, polysaccharides, polyols, polymers and copolymers, including, but not limited to, alginic acid, microcrystalline cellulose, polylactic acid, polylactic-co-glycolic acid, petrolatum, and many others known in the art.

[0097] In some embodiments, the composition comprises bacterial culture medium, conditioned bacterial culture medium, and / or bacterial culture fluid. In some embodiments, the composition comprises a filtrate or supernatant of a bacterial culture medium. In some embodiments, the composition comprises a lyophilized culture medium. In some embodiments, the composition comprises a lyophilized conditioned medium produced from a filtrate or supernatant of a bacterial culture medium.

[0098] In some embodiments, the methods described herein include supporting skin health in a subject. In further embodiments, the methods include providing a treatment for a skin flora dysbiosis and disorders resulting therefrom (e.g., acne). In some embodiments, the methods include providing a treatment for a bacterial infection of the skin (e.g., C. acne infection or overgrowth). In some embodiments, the treatment includes the steps of: identifying a subject having a skin flora dysbiosis, bacterial infection, or acne; and administering a probiotic composition as disclosed herein to the site of the condition in need of treatment. Determination of the appropriate dosage form of a given formulation (ointment, gel, patch, etc.) can be performed by one skilled in the art of treating skin infections. In some further embodiments, the probiotic composition is reapplied at regular intervals. In some embodiments, the probiotic composition is reapplied every 3 days. In some embodiments, the probiotic composition is reapplied every 2 days. In some embodiments, the probiotic composition is reapplied every 2 days. In some embodiments, the probiotic composition is reapplied daily. In some embodiments, the probiotic composition is reapplied one or more times a day. In some embodiments, the probiotic composition is reapplied weekly. In some embodiments, the probiotic composition is applied only once.

[0099] In some embodiments, the method includes providing a treatment for a C. acnes infection. In some further embodiments, the method includes the steps of: diagnosing a C. acnes infection; and applying a probiotic and / or prebiotic composition disclosed herein to the site of infection, where such composition can kill or inhibit the growth of C. acnes, either by production of antimicrobial compounds, competition for resources within the skin or mucosal biome, or other means. Determining the appropriate method of administration of a given formulation (ointment, gel, patch, etc.) can be performed by one skilled in the art of treating skin infections. In some further embodiments, the probiotic composition is reapplied at regularly timed intervals (e.g., daily, every 2 days, every 3 days, weekly, etc.). It will be apparent to one skilled in the art that in other embodiments, similar or identical steps can be applied to provide a treatment for C. acnes. In some embodiments, the method includes providing a treatment for an infection with an unknown or uncharacterized pathogen. In some embodiments, the method includes providing a treatment for a chronic skin condition.

[0100] The commensal bacteria of the present disclosure can be isolated from human skin and identified using the methods described herein. For example, the present disclosure provides a method for obtaining, identifying, and culturing the commensal bacteria described herein by swabbing the surface of human skin, for example, using a foam-tip swab. The swabs are placed in tryptic soy broth. The broth is diluted in Mannitol Salt Agar (MSA) supplemented with 3% egg yolk. Pink colonies without halo, representing coagulase-negative Staphylococci (CoNS) strains, are picked and grown in tryptic soy broth (TSB). The strains can then be assayed as described in FIG. 4 (see also FIG. 5A). Strains that strongly inhibited C. acnes can be further characterized by DNA isolation and sequencing, or PCR, Southern blot, Northern blot. In addition, the expression profile of phenol-soluble modulins can be measured. In some embodiments, organisms expressing PSMβ1, 3, 4 and 6 (e.g., SEQ ID NOs:9437, 9441, 9443, and 9447) may be identified as S. capitis. PSMβ from S. epidermidis is provided in SEQ ID NOs:9449, 9451, and 9453.

[0101] gDNA can be isolated using any number of commercially available kits (e.g., DNeasy UltraClean Microbial Kit, Qiagen). gDNA can be sequenced using a variety of sequencing platforms (e.g., MiSeq; Illumina Inc., San Diego, CA, capable of generating 2-cycle, 2x250 bp paired-end reads). Adapters are removed using cutadapt (e.g., see cutadapt.readthedocs.io / en / stable / at world-wide-web). Low-quality sequences can be removed using Trim Galore (e.g., see cutadapt.readthedocs.io / en / stable / at world-wide-web) with default parameters. Sequences that map to the human genome are removed from the quality trimmed dataset using the Bowtie2 program (version 2.28) (I) with the parameters (-D 20 -R 3 -N 1 -L 20 -very sensitive local) and the human reference genome hg19. The filtered reads are de novo assembled using SPAdes (version 3.8.0) with k-mer lengths ranging from 33 to 127. Genome annotation is performed using the Rapid Annotation of Microbial Genomes by Subsystems Technology (RASY) with default parameters. The predicted amino acid and / or nucleic acid sequences can be compared with the sequence listing attached hereto to identify S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7 and S. epidermidis N018_F3.

[0102] The present disclosure also provides compositions comprising at least two, at least three, at least four, at least five, or at least six PSMβs. In some embodiments, the composition comprises at least four PSMβs. In yet other embodiments, the composition comprises at least five PSMβs. In any of the foregoing embodiments, the PSMβs are selected from PSMβ1, 2, 3, 4, 5, and 6. In certain embodiments, the composition comprises at least PSMβ1, 3, 4, and 6.

[0103] The present disclosure also provides a formulation for topical administration comprising at least two PSMβs. In some embodiments, the formulation comprises at least three PSMβs. In yet other embodiments, the formulation comprises at least four PSMβs. In any of the foregoing embodiments, the PSMβs are selected from PSMβ1, 2, 3, 4, 5, and 6 produced from S. capitis E12 and / or have a sequence that is at least 85%, 90%, 92%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the PSMs set forth in SEQ ID NOs: 9437, 9439, 9441, 9443, 9445, 9447, respectively. In certain embodiments, the formulation comprises at least PSMβ1, 3, 4, and 6. In some embodiments, the formulation comprises at least three of PSMβ1, 3, 4, and 6 and a probiotic, prebiotic, or postbiotic of the present disclosure.

[0104] The present disclosure also provides a method of diagnosing a skin condition and / or risk of C. acnes infection, the method including obtaining a biological sample from the skin of a subject and determining the relative abundance of resident bacteria in the sample, the abundance including determining the abundance of at least S. capitis and S. epidermidis. More specifically, the determination can measure the abundance of at least 1 to 4 (e.g., 1, 2, 3, or 4) of bacteria selected from the group consisting of S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, and S. epidermidis N018_F3. A subject is considered to be at risk for infection with C. acnes if the level or abundance of S. capitis or S. epidermidies (e.g., S. capitis N030_E12, S. epidermidis AMT5_C5, S. epidermidis N009_G7, S. epidermidis N018_F3) falls below a threshold of less than 50%, 40%, 30%, 20%, 10%, 5%, 2.5%, 1%, 0.5%, or 0.1%.

[0105] In another embodiment, the presence of one or more PSMβ produced by S. capitis E12 can be determined in a sample from a subject when determining whether a subject has or is at risk of having a C. acnes infection. For example, a sample can be obtained from the subject's skin, extracted with n-butanol, and the presence of PSMβ measured as described herein. The presence of PSMβ1, 3, 4, and 6 in the sample indicates a reduced risk of infection. In contrast, no or low levels (levels below the normal average control) indicate a subject having or at risk of having a C. acnes infection. A "normal" or "average control" level is a level of PSMβ (e.g., PSMβ1, 3, 4, and / or 6) that is the average level of total PSMβ or the average level of each type of PSMβ (e.g., PSMβ1, 3, 4, and / or 6) in a population of subjects without a C. acnes infection. In one embodiment, the sequence of each PSMβ present in an extract sample can be determined and then compared to sequences such as those set forth in SEQ ID NOs: 9437, 9439, 9441, 9443, 9445 and 9447 to determine which type of PSMβ is present.

[0106] In a further embodiment, the diagnostic and / or prognostic methods can be used to determine whether a subject is in need of a prebiotic, probiotic or postbiotic therapy as described herein.

[0107] The following examples are illustrative and are not intended to limit the claimed invention, but rather to illustrate the methods of composition of the present disclosure. Working Example

[0108] Collection of human subjects and sample swabs All human experiments were performed according to protocols approved by the University of California, San Diego (UCSD) IRB (Project #140144). Swabs were taken from the upper arms and face of 12 healthy adults. Swabs were cultured in 3% tryptic soy broth (TSB), vortexed briefly, and plated on egg yolk-mannitol salt agar (MAY) for selective growth of staphylococcal species. S. aureus was differentiated from CoNS by mannitol metabolism and egg yolk reaction. Clinical isolates of C. acnes were obtained by swabbing lesional and nonlesional facial skin of 10 acne patients and 6 healthy volunteers. Swabs were cultured in enriched clostridial media (RCM), vortexed, and plated on Brucella blood agar supplemented with vitamin K, hemin, and 5% sheep's blood and incubated at 37°C for 5 days.

[0109] Screening of antibacterial activity from skin-derived CoNS Twenty-four individual isolated colonies of selected CoNS from each skin site were randomly picked from MAY medium and transferred to TSB (1 mL) in 96-well deep plates. Each plate contained previously characterized CoNS strains, including S. epidermidis ATCC1457 (negative control), which shows no antibacterial activity against other staphylococci, and S. hominus A9 (positive control), which was previously shown to produce a lanthibiotic that kills S. aureus. CoNS plates were sealed with sterile air seal film (Sigma) and incubated overnight at 37°C with shaking at 250 rpm. Bacterial growth was assessed by measuring OD600, and only CoNS that grew to high density (OD600 > 6.0) were used for subsequent analysis. To measure the antibacterial activity of the secreted supernatants, the supernatants of overnight CoNS cultures were harvested and sterile filtered. To measure antibacterial activity from live, growing CoNS, overnight cultured bacteria were pelleted by centrifugation, then the supernatant was discarded and the bacteria were resuspended in fresh TSB.

[0110] mass spectrometry Portions of the fractions of interest (<1 μg) were dried under vacuum and resuspended in 5 μL of 5% acetonitrile with 5% formic acid. Separate LC-MS experiments were then performed on 1 / 5 of each sample through 85 min of data acquisition on an Orbitrap Fusion (Thermo Fisher Scientific) mass spectrometer with an in-line Easy-nLC 1000 (Thermo Fisher Scientific). A homepulled and packed 30 cm column was triple packed with 0.5 cm, 0.5 cm, and 30 cm of 5 μm C4, 3 μm C18, and 1.8 μm C18, respectively, and heated to 60 °C for use as the analytical column. Peptides were initially loaded at 500 bar, followed by a chromatographic gradient ranging from 6 to 25% acetonitrile in 70 min, followed by a 5 min gradient to 100% acetonitrile held for 10 min. Electrospray ionization was performed by applying a voltage of 2000 V through a stainless steel T-junction connecting the analytical column and the Easy-nLC system. Each sample was run over 15 min with a gradient from 3 to 100% acetonitrile, followed by 10 min at 100% acetonitrile, followed by two washes. Peptides with charge states from 2 to 6 were scanned in the range 375–1500 m / z. Centroid data were used for peak quantification. Acquisition was performed in data-dependent positive ion mode. Raw spectra were searched in Proteome Discoverer version 2.1 against the uniprot reference database for Staphylococcus capitis (Uniprot Proteome UP000042965, accessed 1 October 2018) using the Sequest algorithm with a reverse database approach used to control false positive detection of peptides and proteins to 1%. No enzyme was specified in the search and the minimum peptide length was set to 6 amino acids. Search parameters included a precursor mass tolerance of 50 ppm and a fragment mass tolerance of 0.6 Da, with variable oxidation for modification.

[0111] In vitro antibacterial assay For initial CoNS antibacterial screening, radial diffusion agar assays were performed with either S. aureus 113 or C. acnes HL110PA3 (health-associated, SLST K1) or C. acnes HL096PA1 (acne-associated, SLST C2). For radial diffusion agar assays, molten TSB or RCM agar (12 mL) was mixed with S. aureus or C. acnes (1x106 CFU) and poured into 10 cm square Petri dishes. Once the agar had set, a 10 μl aliquot of bacteria was inoculated onto one grid. Plates were incubated overnight at 37°C with shaking (for S. aureus) or for 3 days at 37°C in 2.5 L Anaeropac (Thermo Scientific) (for C. acnes) to allow visible growth of bacteria. Antibacterial activity was indicated by a clear zone of inhibition in the agar surrounding the colony. The size of the inhibition zone was recorded as an index of antibacterial activity (+mild, ++moderate, +++strong). For liquid culture assays, conditioned supernatants from overnight CoNS cultures were harvested and sterile filtered (0.22 μm). In 96-well round-bottom plates, 50% conditioned supernatants were mixed with 50% fresh TSB or RCM containing 1X105 CFU / mL of S. aureus or C. acnes. S. aureus plates were incubated overnight at 37°C with shaking, and C. acnes plates were incubated statically at 37°C in an anaerobic chamber. Bacterial growth was measured by OD600, and positive antibacterial strains were identified as those that inhibited bacterial growth to less than 50% (I50) of that measured for the negative control strain. Bacterial viability was measured by counting the number of CFU on TSB plates (S. aureus) or Brucella blood agar plates (C. acnes). At selected times after treatment with bacterial supernatants or extracts, the number of CFU was determined by serial dilution in phosphate-buffered saline (PBS) and plating on appropriate agar media. Bacterial viability was measured as the total number of CFU per milliliter.

[0112] Purification of antibacterial agents produced by CoNS strains Conditioned media from overnight cultures of selected antimicrobial S. capitis E12 strains, including the positive control antimicrobial S. hominus A9 strain, were first sterilized by filtration through a 0.22 μm Millipore filter. For initial characterization, sterile bacterial supernatants were boiled at 100°C for 15 min or incubated with the proteolytic enzymes papain and proteinase K at 200 μg / mL for 60 min at 37°C. Antimicrobial activity was measured by radial diffusion assay. For size exclusion of antimicrobial molecules, 20 mL of conditioned media was loaded onto 3, 10, and 30 kDa molecular weight cutoff (MWCO) columns (Pierce) and centrifuged at 4000xg for 15 min. The flow-through fraction was set aside and the retained fraction was washed twice with PBS and resuspended in 20 mL of TSB. Antimicrobial activity was assessed for both fractions. To precipitate the active molecules, ammonium sulfate was added to the sterile supernatant (30-80% saturation) and incubated for 1 h under constant rotation at room temperature, followed by centrifugation at 4000 x g for 45 min. The resulting pellet was washed three times with water and reconstituted in water. Antibacterial activity was determined by the growth of S. aureus and C. acnes in agar and liquid cultures.

[0113] Solid phase extraction (SPE) and HPLC purification of the supernatant Sterile S. capitis E12 supernatant, retained on a 10 kDa MWCO column and precipitated with 60% AS, was applied to an Oasis HLB cartridge (Waters). The cartridge was washed with 20% acetonitrile in water and eluted with 80% acetonitrile in water. The eluted fraction was lyophilized and reconstituted in water. The 80% fraction was then loaded onto a C8 Sep-Pak cartridge (Waters), washed with 20% acetonitrile and eluted with 50% acetonitrile. This fraction was lyophilized, reconstituted in water and then assessed for antimicrobial activity according to the manufacturer's instructions and visualized by silver staining (Pierce). For the first step HPLC purification, 1 mg of butanol extract of S. capitis E12 was loaded onto a CapCel Pak C8 (5 μm, 300 Å, 4.6x250 mm) (Shiseido Co., Ltd.) and a linear gradient of 10%–60% acetonitrile in 0.1% (v / v) TFA at 0.8 mL / min was performed. Fractions were lyophilized, resuspended in water, and assessed for antibacterial activity by liquid culture assay. Up to five consecutive purifications were performed by pooling each single antibacterial fraction together for the second step HPLC. A linear gradient of 25%–50% acetonitrile was employed for the second purification.

[0114] Implantation of antibacterial CoNS into pig skin and mice All experiments involving the work with live animals were in accordance with the approved Institutional Animal Care and Use Guidelines of the University of California, San Diego. Fresh frozen porcine skin sheets were obtained from Loretta Tomlin Animal Technologies (Livermore, CA) and disinfected with a surgical brush soaked in 3% chloroxylenol. Skin sheets were cut to 2.5 cm x 2.5 cm and rinsed with sterile PBS at least 20 times. Pig skin was challenged with 1x107 CFU of C. acnes (ATCC6919) for 1 hour and 100 μl of S. capitis E12 extract (10 mg / mL) or PBS control was applied for 24 hours. Viable bacteria were collected by swabbing to measure C. acnes viability. For mouse experiments, the backs of hairless SKH1 mice were scrubbed with alcohol wipes and inoculated with 1x107 CFU C. acnes on sterile gauze pads and fixed with Tegaderm film for 24 hours. The gauze pads containing C. acnes were removed and 100 μl of S. capitis E12 extract (10 mg / mL) or PBS control was inoculated onto new gauze pads, placed back on the same dorsal skin site, and fixed with Tegaderm film for another 24 hours. 48 hours after inoculation, the skin was wiped to measure viable CFU of C. acnes.

[0115] Screening for antibacterial activity from human skin bacteria identifies S. capitis strains with potent and selective activity against C. acnes. A library of 288 CoNS isolates was collected from forearm and facial skin swabs of healthy volunteers. An unbiased analysis of anti-C. acnes activity was performed by live co-culture with CoNS isolates growing on agar containing C. acnes and measuring the growth of C. acnes after addition of sterile-filtered 50% v / v prepared CoNS supernatant (Fig. 5A). The results of the functional screening found a total of 13 isolates that showed activity against C. acnes growth in both liquid assays and agar co-culture (Fig. 5B, C). DNA extracted from CoNS isolates with antibacterial activity was subjected to 16S sequencing, which identified several different species, including S. epidermidis and S. hominis, which are known to frequently parasitize human skin. The most potent isolate was identified as Staphylococcus capitis (S. capitis strain E12) and was used for further characterization. Of the 13 antibacterial strains identified, all were isolated from the forearm. None of the facial isolates were found to inhibit the growth of C. acnes. Interestingly, the S. hominus A9 strain, which produces lantibiotics active against S. aureus, was ineffective against C. acnes, demonstrating the selectivity of antimicrobial agents derived from the mixed skin bacterial community.

[0116] We next tested the selectivity of S. capitis E12 in inhibiting the growth of several different CoNS resident species and common skin pathogens in an agar assay. Whereas S. hominus A9 potently inhibited the growth of S. aureus and GAS, S. capitis E12 showed only weak activity against CoNS and was ineffective against other skin pathogens (Figure 5D). Surprisingly, S. capitis E12 showed potent activity against a broad range of C. acnes strains, including strains isolated from both lesional and non-lesional areas of acne patients. A 50% dilution of sterile supernatant of unconcentrated medium of S. capitis E12 was sufficient to inhibit the growth of C. acnes, thus validating the findings from the functional screen and showing that under normal growth conditions, this S. capitis strain can exert sufficient antibacterial activity to outcompete C. acnes (Figure 5E). To determine whether the antibacterial supernatants were bactericidal, the number of surviving C. acnes colonies was counted after 24 h treatment with increasing concentrations of S. capitis E12. Consistent with the results of the functional screen, S. capitis supernatants were generally not bactericidal against other CoNS species, with the exception of S. hominus strain 27844, which was bactericidal only at the highest 10-fold concentration. However, S. capitis E12 supernatants were bactericidal against C. acnes, showing a 6-log reduction in C. acnes during exposure to 0.6X (60%) of the supernatant and complete sterilization of the cultures at the highest concentration (Figure 5F).

[0117] Purification and identification of PSM.BETA. antimicrobial peptides The nature of the antibacterial factor was first investigated and found to be resistant to heat treatment but sensitive to proteolysis, suggesting that it is a proteinaceous molecule (Supplementary Fig. 1A, B). Furthermore, the antibacterial factor precipitated from the supernatant upon incubation with 60-80% ammonium sulfate (AS) and was concentrated by centrifugation (Fig. 9C). Next, a solid-phase extraction method was used to prepare samples from the concentrated AS precipitate. The samples were loaded onto a hydrophilic-lipophilic balance (HLB) column and measured 72 h after inoculation onto C. acnes agar medium (Fig. 6A) or C. acnes liquid culture (Fig. 6B). It was found that the anti-C. acnes molecules were eluted with 80% acetonitrile. The active eluate was then loaded onto a hydrophobic C8 cartridge, and the anti-C. acnes molecules were eluted with 50% acetonitrile (Fig. 6A, B). Total protein staining of this fraction revealed a highly enriched band of approximately 4–5 kDa in size, with higher purity observed in subsequent elution steps (Figure 5C). Reverse-phase high-performance liquid chromatography (HPLC) revealed several peaks, of which a single fraction (fraction 21) was found to inhibit the growth of C. acnes in liquid culture (Figure 5D). To ensure the highest purity, the active fractions from four separate HPLC runs were then pooled together and subjected to a second step of HPLC purification. This time, several smaller peaks were visualized (Figure 6F), and two fractions (fractions 15 and 16) were found to inhibit the growth of C. acnes in liquid culture (Figure 6G). Mass spectrometry (MS) of the active fractions (15, 16) and the control inactive fractions (13, 14, 17, 18) revealed four candidate peptides, each of 5 kDa in size, called "antimicrobial proteins" (Figure 6H). BLAST searches of the peptide sequences revealed that these peptides belong to the β-class family of phenol-soluble modulins (PSMβ), which are present in multiple Staphylococcal genera.

[0118] Although four distinct PSMβ peptides were detected by MS, analysis of the S. capitis E12 genome revealed up to six PSMβ-encoding genes contained within an operon-like structure (Figure 7A). All six PSMβ-encoding genes are closely related, with 56%–91% amino acid sequence identity and predicted charges ranging from -1 to +1 (Figure 7B). Further analysis revealed that these genes were absent from the genomes of ATCC strains of S. capitis 35661 and 27844, and indeed no antibacterial activity against C. acnes was detected for these laboratory strains (Figure 7C). An alpha-helical wheel plot (Heliquest) also predicted that these peptides formed an α-helical amphipathic-like structure for each PSMβ, with separate hydrophobic and hydrophilic faces on opposite sides of the peptide's long axis. This amphipathic structure is common among many well-characterized antibacterial peptides (Figure, 7D).

[0119] PSMβ inhibits skin colonization by C. acnes. The prepared supernatant of S. capitis E12 was extracted with n-butanol, a procedure that enriches for PSM peptides. This resulted in a relatively pure extract enriched for all PSMβ peptides, which retained their activity against C. acnes (Figure 10). To confirm that the PSMβ peptides were active as anti-C. acnes molecules and to identify which peptides had optimal activity, we separately synthesized the most abundant molecules, PSMβ1 and 6, and the less abundant PSMβ4, from the purified active fraction (15 and 16, Figure 6H). All three PSMs were shown to have antibacterial activity in vitro (Figure 8A). Both PSMβ1 and 6 effectively inhibited C. acnes growth at 62 μg / ml, while PSMβ4 was less potent, inhibiting it at 125 μg / ml. Interestingly, the combination of the three peptides showed optimal activity against C. acnes, inhibiting growth at 31 μg / ml. However, this was not inhibitory compared to the butanol extract at the same concentration, which was inhibitory at 8 μg / ml. This difference may be due to the presence of an additional fourth PSMβ peptide (PSMβ3) in the extract. Several bacterial antimicrobials have been shown to synergize with human antimicrobials such as defensins and LL37. However, exposure of C. acnes to extracts of S. capitis with or without the LL-37 peptide did not result in enhanced killing activity (Figure 11). Given the greater potency and relative purity of the PSMβ-containing extracts compared to the synthetically produced PSMβ peptide, subsequent experiments used the extracts to examine the efficacy and potency of S. capitis E12 in in vitro and in vivo experiments.

[0120] Next, we compared the extract of S. capitis E12 with several antibiotics commonly used to treat acne. The extract was more potent against C. acnes than erythromycin, clindamycin, and tetracycline, antibiotics commonly prescribed for acne treatment (Figure 8B). Furthermore, no increase in the MIC (≤16 μg / mL) of C. acnes was recorded during treatment with the extract up to 20 generations, indicating a relative inability to promote resistance. Furthermore, exposure of primary human keratinocytes (NHEKs) to the extract did not result in a significant cytotoxic response from these epidermal cells, as measured by lactate dehydrogenase (LDH) release (Figure 8C). Similarly, back skin of mice exposed to different CoNS strains for 24 h showed that S. capitis E12 did not induce observable erythema or lesions (Figure 8D). Finally, confirming the expected result that this skin resident microbe is well accepted by the epidermis, we applied C. acnes to colonize ex vivo pig skin or the back skin of live SKH1 mice, followed by application of an extract of S. capitis E12. A single treatment significantly reduced C. acnes CFUs in both models (Fig. 8E,F). Overall, these results demonstrate that PSMβ from S. capitis E12 has the ability to kill C. acnes, highlighting the possibility of harnessing naturally occurring microbial events in human skin for the development of therapeutics.

[0121] Although several embodiments of the present disclosure have been described, it will be understood that various modifications may be made without departing from the spirit and scope of the present disclosure. Accordingly, other embodiments are within the scope of the following claims.

Claims

1. 1. A topical probiotic composition comprising one or more bacterial strains for use in treating a skin disease or disorder associated with C. acnes, wherein at least one of the one or more bacterial strains is MTKLAEAIANTVKAGQDHDWAKLGTSIVGIAENGIGLLGKVFGF (SEQ ID NO: 9437), MTKLAEAIANTVKAGQDHDWAKLGTSIVGIAENGIGALSKIFGG (SEQ ID NO: 9439), MQKLAEAIANTVKAGQDHDWAKLGTSIVGIAENGINAITKIFGG (SEQ ID NO: 9441), MTKLAEAIANAVKAGQDQDWAKLGTSIVGIAENGISLLGKVFGF (SEQ ID NO: 9443), MQKLAEAIANTVKAGQDHDWTKLGTSIVDIVENGVSALTKVFGG (SEQ ID NO: 9445), and MEKLFDAIRNTVDAGINQDWTKLGTSIVDIVDNGVKVISKFIGA (SEQ ID NO: 9447).

2. 10. The topical probiotic composition of claim 1, wherein the one or more bacterial strains are provided in a live form.

3. 10. The topical probiotic composition of claim 1, wherein the one or more bacterial strains are provided in lyophilized or freeze-dried or spray-dried form.

4. 4. The topical probiotic composition of claim 3, wherein the one or more bacterial strains are capable of being reconstituted into a viable form.

5. 5. The topical probiotic composition of any one of claims 1 to 4, comprising a thickened topical formulation of one or more bacterial strains, and optionally prebiotic compounds, protectants, humectants, emollients, abrasives, salts, and / or surfactants.

6. 6. The topical probiotic composition of any one of claims 1 to 5, wherein the topical probiotic composition is formulated for the treatment of disorders of the skin, scalp, or mucous membranes, and / or the composition is formulated as a cream, ointment, salve, spray, powder, oil, thickened formulation, or compress.

7. The topical probiotic composition of any one of claims 1 to 6, wherein the composition inhibits the growth, viability, or activity of Propionibacterium acnes.

8. The topical probiotic composition of any one of claims 1 to 7, wherein the skin disease or disorder is acne, chronic blepharitis, and / or endophthalmitis.

9. A pharmaceutical composition for inhibiting the growth, viability, or activity of Propionibacterium acnes comprising multiple phenol-soluble modulin peptides (PSMs), including PSMβ1 (SEQ ID NO: 9437), PSMβ3 (SEQ ID NO: 9441), PSMβ4 (SEQ ID NO: 9443), and PSMβ6 (SEQ ID NO: 9447).

10. A pharmaceutical composition for inhibiting the growth, viability, or activity of Propionibacterium acnes comprising multiple phenol-soluble modulin peptides (PSMs), including PSMβ1 (SEQ ID NO: 9437), PSMβ2 (SEQ ID NO: 9439), PSMβ3 (SEQ ID NO: 9441), PSMβ4 (SEQ ID NO: 9443), PSMβ5 (SEQ ID NO: 9445), and PSMβ6 (SEQ ID NO: 9447).

11. The pharmaceutical composition according to claim 9 or 10, further comprising a pharma- ceutically acceptable carrier.

12. 12. The pharmaceutical composition of any one of claims 9 to 11, wherein the pharmaceutical composition comprises one or more bacterial strains, at least one of the one or more bacterial strains being capable of expressing multiple PSMs.

13. A pharmaceutical composition according to any one of claims 9 to 12, comprising a cell-free fermentation extract obtained from the culture of one or more bacterial strains capable of expressing multiple PSMs.

14. 14. The pharmaceutical composition according to any one of claims 9 to 13, for treating a skin disorder associated with Propionibacterium acnes, wherein the skin disorder associated with Propionibacterium acnes is a skin or mucosal infection, acne, chronic blepharitis and endophthalmitis, or other disorder associated with skin abnormalities in a human or other mammal, and the pharmaceutical composition is for application to the skin or mucosa of a subject in need thereof in an effective amount of the pharmaceutical composition.

15. 15. The pharmaceutical composition of claim 14, wherein the pharmaceutical composition is for topical application, and the pharmaceutical composition is formulated as a cream, ointment, salve, spray, powder, oil, lotion, tincture, thickened preparation, or poultice.

Images