Essence containing recombinant collagen composition with skin repairing effect

Abstract

The invention discloses essence water containing a recombinant collagen composition with a skin repairing effect. The aqueous cosmetic (such as essence) comprises a recombinant collagen composition, a humectant, a thickener, a skin conditioner, a pH regulator and deionized water as functional components. Aiming at the condition that an existing repair product containing recombinant collagen has a poor repair effect on skin with damaged barriers, the invention designs that a recombinant collagen composition composed of various recombinant collagens with a synergistic effect in the aspect of skin repair is added into a formula and is matched with various repair functional components; the essence water with the skin repairing effect remarkably improved is prepared.

Description

Technical Field

[0001] The present invention belongs to the technical field of cosmetics, and particularly relates to a essence water containing a recombinant collagen composition with skin repair efficacy. Background Art

[0002] In modern society, due to reasons such as seasonal alternation, environmental pollution, stress, eating habits, etc., the skin barrier is easily damaged, resulting in the skin losing elasticity, moisture and nutrition, and frequent occurrence of skin problems such as fragility, sensitivity, flushing, and dryness. If the damaged skin cannot be repaired, the damage of the skin barrier will exist for a long time, which is a concern for many people. Recombinant collagen is closely related to skin damage repair. Therefore, people compound recombinant collagen with ingredients having repair efficacy (such as hyaluronic acid, ceramide, Centella Asiatica extract, witch hazel extract, etc.), and repair products added with the above ingredients are welcomed by consumers.

[0003] Most of the existing repair products only add one kind of recombinant collagen, and the relatively small amount of recombinant collagen has a weak cooperation with other efficacy ingredients during skin repair, resulting in the repair effect not being satisfactory. Summary of the Invention

[0004] In view of the technical problem in the prior art that the skin repair effect of products containing recombinant collagen on barrier-damaged skin is not good, the purpose of the present invention is to provide a essence water containing recombinant collagen as an efficacy ingredient, which has a significantly improved effect on repairing damaged skin barriers.

[0005] To solve the above technical problem, the inventors have conducted a relatively in-depth study on the skin repair efficacy of various existing collagen-containing repair products and the synergistic effects between various ingredients having skin repair-related efficacy, and found that:

[0006] 1. Basically, only one kind of collagen is added in the existing repair products and the content is relatively small, which makes there is no cooperation between different kinds of collagens and the cooperation between collagen and other skin repair efficacy ingredients is also relatively weak. The fact that the existing repair products cannot achieve a satisfactory skin repair effect may be related to this.

[0007] 2. There may be a synergistic effect in skin repair among some recombinant collagens, or between recombinant collagens and other skin repair efficacy ingredients. Therefore, through the combination of multiple recombinant collagens and / or the combination of recombinant collagens and other skin repair efficacy ingredients, it is expected to significantly enhance the skin repair efficacy of repair products. For example, the inventors found that (1) if the skin lacks type III collagen, the tenderness, fineness and elasticity of the skin will decline, and the recombinant type III collagen described in the specification of Chinese Patent Application No. 201310701942.8 can help the body repair aging and damaged skin; and a certain proportion of this recombinant type III collagen and GSQ tripeptide have a synergistic effect in antioxidant, and can quickly repair damaged skin after the skin is oxidatively damaged. (2) The recombinant type I collagen described in the specification of Chinese Patent Application No. 201310701767.2 can provide structural support and elastic tension for the dermis, promote epidermal cell proliferation, and repair damaged skin barriers; and a certain proportion of this recombinant type I collagen and GER tripeptide have a synergistic effect in promoting fibroblast proliferation, and can effectively promote the formation of elastic support for the skin structure.

[0008] 3. Further, by compounding the above recombinant collagen composition with cosmetic ingredients such as humectants, thickeners, skin conditioners, pH regulators, etc., and applying this compounding system to aqueous cosmetics (such as essence water), the obtained aqueous cosmetics (such as essence water) can have excellent skin repair efficacy and moisturizing efficacy at the same time.

[0009] That is, the present invention includes:

[0010] 1. An aqueous cosmetic, which comprises a recombinant collagen composition, a humectant, a thickener, a skin conditioner, a pH regulator and deionized water;

[0011] Wherein,

[0012] The recombinant collagen composition is composed of recombinant type III collagen, GSQ tripeptide, recombinant type I collagen and GER tripeptide; the weight ratio of the recombinant type III collagen to the GSQ tripeptide is 500:1 to 100:1; the weight ratio of the recombinant type I collagen to the GER tripeptide is 200:1 to 50:1;

[0013] The amino acid sequence of the recombinant type III collagen is as shown in SEQ ID No: 2;

[0014] The amino acid sequence of the recombinant type I collagen is as shown in SEQ ID No: 1.

[0015] 2. The aqueous cosmetic according to item 1, wherein the weight ratio of the recombinant type III collagen to the GSQ tripeptide is 200:1 to 100:1, and / or the weight ratio of the recombinant type I collagen to the GER tripeptide is 100:1 to 50:1.

[0016] 3. The aqueous cosmetic according to item 1, wherein, based on 100 parts by weight of the total amount of the aqueous cosmetic, it contains:

[0017]

[0018] 4. The aqueous cosmetic according to item 1, wherein the humectant is selected from glycerol, propylene glycol, butylene glycol, pentylene glycol, hexylene glycol, panthenol, methyl gluceth-20, glyceryl polyether-26, sodium hyaluronate, ectoine, betaine, and sodium polyglutamate.

[0019] 5. The aqueous cosmetic according to item 1, wherein the thickener is selected from xanthan gum, acrylate / C10-30 alkyl acrylate cross-linked polymer, and hydroxyethyl cellulose.

[0020] 6. The aqueous cosmetic according to item 1, wherein the skin conditioner is selected from Centella Asiatica extract, asiaticoside, β-glucan, glucosylglycerol, bifida ferment lysate, and ceramide.

[0021] 7. The aqueous cosmetic according to item 1, wherein the pH regulator is selected from triethanolamine, aminomethylpropanol, and arginine.

[0022] 8. The aqueous cosmetic according to item 1, wherein the humectant is 1 to 10 parts by weight of butylene glycol, 1 to 5 parts by weight of hexylene glycol, 0.1 to 1 part by weight of panthenol, 0.1 to 1 part by weight of sodium hyaluronate, and 0.1 to 1 part by weight of ectoine.

[0023] 9. The aqueous cosmetic according to item 1, wherein the thickener is 0.1 to 1 part by weight of acrylate / C10-30 alkyl acrylate cross-linked polymer.

[0024] 10. The aqueous cosmetic according to item 1, wherein the skin conditioner is 0.1 to 1 part by weight of asiaticoside and 1 to 14.5 parts by weight of Centella Asiatica extract.

[0025] 11. The aqueous cosmetic according to item 1, wherein the pH regulator is 0.1 to 1 part by weight of arginine.

[0026] 12. The aqueous cosmetic according to item 1 is essence water, essence, facial mask, or cleansing mousse.

[0027] 13. The preparation method of the aqueous cosmetic according to item 1 includes the following steps:

[0028] Step 1: Disperse sodium hyaluronate, ectoine, panthenol, acrylate / C10-30 alkyl acrylate cross-linked polymer and recombinant collagen composition uniformly in butylene glycol and hexylene glycol, add deionized water and stir. After dispersing uniformly, keep the obtained dispersion at 85 °C; and

[0029] Step 2: After cooling the dispersion, add arginine, asiaticoside, and Centella Asiatica extract to the dispersion in sequence to obtain the aqueous cosmetic.

[0030] Advantages of the Invention

[0031] In view of the poor repair effect of existing repair products containing recombinant collagen on skin with damaged barrier, the present invention designs to add a recombinant collagen composition composed of multiple recombinant collagens into the formula, and cooperate with multiple repair active ingredients to prepare an essence water containing a recombinant collagen composition with skin repair effect. Therefore, the present invention designs to cooperate small molecule peptides with three recombinant collagens to build a strong collagen repair system, and at the same time cooperate with active ingredients such as asiaticoside, Centella Asiatica extract and ectoine. The prepared essence water product can supplement collagen and moisture for the skin, soothe and repair the skin, and make the skin delicate, moist and non-greasy. Detailed Embodiments

[0032] The experimental methods used in the following examples are all conventional methods without special requirements.

[0033] Preparation Example 1

[0034] Recombinant type III collagen: Prepared and purified according to the method disclosed in the specification of Chinese Patent Application No. 201310701942.8, and its amino acid sequence is as shown in SEQ ID No:2.

[0035] Recombinant type I collagen: Prepared and purified according to the method disclosed in the specification of Chinese Patent Application No. 201310701767.2, and its amino acid sequence is as shown in SEQ ID No:1.

[0036] GSQ tripeptide: A commercially available product.

[0037] GER tripeptide: A commercially available product.

[0038] Example 1 of Raw Material Efficacy Test - Antioxidant Efficacy Test of Recombinant Type III Collagen, GSQ Tripeptide and Their Combinations

[0039] Prepare an aqueous solution of recombinant type III collagen (200 mg / mL), aqueous solutions of GSQ tripeptide I - V (the concentrations of GSQ tripeptide are 0.2 mg / mL, 0.4 mg / mL, 1 mg / mL, 2 mg / mL, 20 mg / mL respectively), and compositions 1 - 5 (aqueous solutions, 200 mg / mL of recombinant type III collagen + 0.2 mg / mL, 0.4 mg / mL, 1 mg / mL, 2 mg / mL, 20 mg / mL of GSQ tripeptide).

[0040] Experimental method: The experiment was divided into 3 groups, namely the blank group, the AAPH control group and the sample group. Cells were seeded in a Costa 96 - well plate at a density of 1×10 5 cells / mL, and 200 μL of cell suspension was added to each well. After adherent culture in an incubator at 37°C and 5% CO2 for 24 h, the experiment was carried out. Discard the culture medium. In the sample group, 120 μL of the above - prepared aqueous solution of recombinant type III collagen, aqueous solution of GSQ tripeptide (I - V) or composition (1 - 5) was added to each well of the cells. The AAPH control group and the blank group were added with an equal volume of FBS - free medium. Incubate in the cell incubator for 2 h, and then wash the cells twice with PBS. To induce oxidative stress, 120 μL of 200 μmol / L AAPH solution was added to each well of the sample group and the AAPH control group, and the blank group was added with an equal volume of FBS - free medium. After incubating in the cell culture incubator for 3 h, wash the cells 3 times with PBS. Lyse the cells with RIPA lysis buffer containing 1 mmol / L phenylmethanesulfonyl fluoride at 4°C for 10 min, collect the lysed cells, and centrifuge at 10000×g for 5 min to obtain the supernatant. Measure the activity of GSH - Px enzyme in the supernatant.

[0041] At the same time, calculate the combination index CI=(A×B) / AB. When CI < 1, it indicates a synergistic effect in combination; when CI ≤ 0.9, it indicates a significant synergistic effect. Among them,

[0042] C = GSH - Px value of the blank group - GSH - Px value of the AAPH control group, representing the upper limit of the recovery of GSH - Px value after drug administration;

[0043] T = GSH - Px value of each sample group - GSH - Px value of the AAPH control group, representing the actual recovery level of GSH - Px value after drug administration;

[0044] A and B respectively represent the (1 + T / C) values when administering recombinant type III collagen or GSQ tripeptide alone;

[0045] AB represents the (1 + T / C) value when administering compositions 1 - 5.

[0046] The effects of the above-mentioned recombinant type III collagen, GSQ tripeptide, and compositions 1-5 on the GSH-Px enzyme activity of cells, as well as the combination drug indices of compositions 1-5, are shown in Table 1.

[0047] Table 1

[0048]

[0049] From the results in Table 1 above, it can be seen that compositions 1, 2, 3, 4, and 5 of the present invention can significantly increase the activity of GSH-Px in cells. Among them, the combination drug indices of compositions 2, 3, and 4 are all less than 1, indicating that when the weight ratio of recombinant type III collagen:GSQ tripeptide in the composition is 500:1 to 100:1, there is a synergistic effect in improving the GSH-Px enzyme activity in cells. Moreover, the combination drug index of compositions 3 and 4 is less than 0.9, indicating that when the recombinant type III collagen:GSQ tripeptide is 200:1 to 100:1, the synergistic effect on improving the GSH-Px enzyme activity in cells is significant. GSH-Px plays the role of an antioxidant in metabolism and can protect biological membranes from oxidative damage by catalyzing glutathione to reduce hydrogen peroxide. GSH-Px can bind harmful substances such as free radicals and heavy metal ions in the body and then excrete them from the body to prevent the body from suffering oxidative damage. Therefore, GSH-P X activity is one of the important indicators for antioxidant and anti-aging.

[0050] Raw material efficacy test example 2: Proliferation-promoting efficacy test of recombinant type I collagen, GER tripeptide, and their compositions on fibroblasts

[0051] Prepare an aqueous solution of recombinant type I collagen (42 mg / mL), aqueous solutions of GER tripeptide I-V (the concentrations of GER tripeptide are 0.042 mg / mL, 0.21 mg / mL, 0.42 mg / mL, 0.84 mg / mL, and 4.2 mg / mL), and compositions 1-5 (aqueous solutions, 20 mg / mL of recombinant type I collagen + 0.042 mg / mL, 0.21 mg / mL, 042 mg / mL, 0.84 mg / mL, and 4.2 mg / mL of GER tripeptide).

[0052] Place the revived human skin fibroblasts in a cell culture incubator with saturated humidity. Use a low-glucose DMEM medium containing 10% FBS by volume ratio. When the cells are cultured to 85% confluence at 37°C and 5% CO2, digest and passage them with 0.25% trypsin. Observe under an inverted microscope and use cells in the logarithmic growth phase for cell experiments.

[0053] Resuscitated human skin fibroblasts were centrifuged at 1000 r / min and counted according to 1×10 4 indivual

[0054] / mL density was plated in a 96-well plate, 100μL of cell suspension was added to each well, and after 24h of adherence culture, 100μL of the prepared sample solution was added. Incubate in an incubator for 24h. After 24h, 10μL of CCK-8 working solution was added to each well, and incubated in a CO2 incubator for 1h. The absorbance was measured at 450nm to calculate the cell proliferation rate.

[0055] Cell proliferation rate = sample group OD × 100% / blank group OD.

[0056] At the same time, the combined drug index CI = (A × B) / AB was calculated. When CI < 1, it indicates that the combined use has a synergistic effect; when CI ≤ 0.9, it indicates that the synergistic effect is significant. Among them, A and B are the cell proliferation rates of the recombinant type I human collagen group and the GER tripeptide-I to V group, respectively, and AB is the cell proliferation rate of the combination group 1 to 5.

[0057] Table 2 shows the effects of the above-mentioned recombinant type I collagen, GER tripeptide and compositions 1-5 on promoting fibroblast proliferation, as well as the combined drug index of compositions 1-5.

[0058] Table 2

[0059]

[0060] As can be seen from the results of Table 2 above, Composition 1, Composition 2, Composition 3, Composition 4, and Composition 5 of the present invention can significantly promote fibroblast proliferation. Among them, the combined medication index of Composition 2, Composition 3, and Composition 4 is less than 1, indicating that the weight ratio of recombinant type I collagen: GER tripeptide has a synergistic effect in promoting fibroblast proliferation when it is 200:1 to 50:1. Moreover, the synergistic index of Composition 3 and Composition 4 is less than 0.9, indicating that the synergistic effect of recombinant type I collagen: GER tripeptide in promoting fibroblast proliferation is significant when it is 100:1 to 50:1. In the early stage of the repair process, fibroblasts divide and proliferate in large numbers and gather at damaged skin barriers. In the later stage of the repair process, fibroblasts secrete collagenase to participate in skin tissue reconstruction. Therefore, in the repair process, fibroblasts play a very important role.

[0061] Preparation Example 2

[0062] As an example of the raw materials, a recombinant collagen composition was prepared, which is a combination of recombinant type I collagen, recombinant type III collagen, and Mini small molecule recombinant collagen peptides GSQ and GER. Among them, the weight ratio of recombinant type III collagen to Mini small molecule recombinant collagen peptide GSQ is in the range of 200:1 to 100:1, and the weight ratio of recombinant type I collagen to Mini small molecule recombinant collagen peptide GER is in the range of 100:1 to 50:1.

[0063] Example 1

[0064] Disperse 0.8 parts by weight of sodium hyaluronate, 0.5 parts by weight of ectoine, 0.4 parts by weight of panthenol, 0.7 parts by weight of acrylate / C10-30 alkyl acrylate cross-linked polymer, and 3 parts by weight of the recombinant collagen composition of Preparation Example 2 evenly in 6 parts by weight of butanediol and 5 parts by weight of hexanediol, and add an appropriate amount of deionized water to obtain a mixed dispersion. Keep the mixed dispersion at 85 °C, and after the mixed dispersion cools down, add 0.7 parts by weight of arginine, 0.5 parts by weight of asiaticoside, and 14 parts by weight of Centella Asiatica extract in sequence, and make up to 100 parts by weight with deionized water and stir evenly to obtain the essence water of this example.

[0065] Example 2

[0066] Disperse 0.3 parts by weight of sodium hyaluronate, 1 part by weight of ectoine, 0.1 parts by weight of panthenol, 0.2 parts by weight of acrylate / C10-30 alkyl acrylate cross-linked polymer, and 8 parts by weight of the recombinant collagen composition of Preparation Example 2 evenly in 10 parts by weight of butanediol and 2 parts by weight of hexanediol, and add an appropriate amount of deionized water to obtain a mixed dispersion. Keep the mixed dispersion at 85 °C, and after the mixed dispersion cools down, add 0.1 parts by weight of arginine, 0.1 parts by weight of asiaticoside, and 2 parts by weight of Centella Asiatica extract in sequence, and make up to 100 parts by weight with deionized water and stir evenly to obtain the essence water of this example.

[0067] Example 3

[0068] Disperse 1 part by weight of sodium hyaluronate, 0.2 part by weight of ectoine, 0.9 part by weight of panthenol, 0.5 part by weight of acrylate / C10-30 alkyl acrylate cross-linked polymer, and 5 parts by weight of the recombinant collagen composition of Preparation Example 2 evenly in 4 parts by weight of butanediol and 4 parts by weight of hexanediol, and add an appropriate amount of deionized water to obtain a mixed dispersion. Keep the mixed dispersion at 85 °C, and after the mixed dispersion cools down, add 0.9 part by weight of arginine, 0.2 part by weight of asiaticoside, and 10 parts by weight of Centella Asiatica extract in sequence, and make up to 100 parts by weight with deionized water and stir evenly to obtain the essence water of this example.

[0069] Efficacy test:

[0070] Test Example 1: Test on the water content of the skin stratum corneum

[0071] Test instrument: Skin moisture tester Corneometer CM825

[0072] Test subjects: Select 32 Chinese healthy male / female subjects with rough facial skin, obvious visible pores; facial skin with certain flushing / red blood streaks; poor skin barrier function and TEWL screening value ≥ 15; self-identified sensitive skin and lactic acid stimulation score ≥ 3 points, aged 18 - 35 years, with an average age of 27.81 ± 0.85 years.

[0073] Test samples: Prepare essence water samples and commercially available essence water samples containing collagen.

[0074] Test method: Adopt the before-and-after comparison method, and measure the water content of the skin stratum corneum of the subjects before using the test samples and after continuously using the samples for 2 weeks.

[0075] Measurement area: Cheeks. Coat the essence water samples and the commercially available essence water samples containing collagen on the left and right cheeks respectively, and apply them once at (20 ± 0.1) mg / cm 2 for single application.

[0076] Test principle: Based on the fact that the dielectric constants of water (81) and other substances (<7) vary quite a lot, according to the different water contents, a measuring capacitor with an appropriate shape will change with the change of the capacitance of the skin, and the capacitance of the skin is within the measurement range, so the water content of the skin can be measured.

[0077] Environmental conditions: The test environment temperature is 20.1 °C - 21.1 °C, and the relative humidity is 50.6% RH - 59.7% RH.

[0078] Test results:

[0079] Table 3: Test Results of Moisture Content in Skin Cuticle

[0080]

[0081] Table 3 shows that after the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks, the moisture content of the subjects' skin cutin layer increased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the rising rates of the moisture content in the skin cutin layer were 25.47%, 35.09%, and 27.28% respectively. After using the commercially available essence water containing collagen, the rising rate of the moisture content in the skin cutin layer was 22.40%. The essence water prepared in Example 2 had the highest rising rate value in the test of the moisture content in the skin cutin layer, indicating that the essence water prepared in Example 2 had the best moisturizing effect. Moreover, after using the essence water prepared in Example 1, Example 2, and Example 3, the rising rates of the moisture content in the skin cutin layer were all higher than those of using the commercially available essence water sample containing collagen.

[0082] Test Example 2: Measurement of Trans-epidermal Water Loss of Skin

[0083] Test Instrument: Trans-epidermal Water Loss Meter Vapometer

[0084] Test Subjects: 32 Chinese healthy male / female subjects were selected, who had rough facial skin with obvious visible pores; their facial skin had certain flushing / red blood streaks; their skin barrier function was poor and the TEWL screening value was ≥15; they considered themselves sensitive skin and the lactic acid stimulation score was ≥3 points. The age range was 18 - 35 years old, and the average age was 27.81±0.85 years old.

[0085] Test Samples: Prepared essence water samples and commercially available essence water samples containing collagen

[0086] Test Method: An before-and-after comparison method was adopted. The trans-epidermal water loss of the subjects' skin was measured before using the test samples and 2 weeks after continuously using the samples.

[0087] Measurement Area: Cheeks. The prepared essence water samples and the commercially available essence water samples containing collagen were each coated on the left and right cheeks, and were each coated once according to (20±0.1)mg / cm 2 for single coating.

[0088] Test Principle: The core of the Vapometer is a sensitive humidity sensor located in a cylindrical measurement chamber. It is located in a cylindrical measurement cavity. During measurement, this measurement cavity is closed by the skin or other measurement surfaces and is not affected by the ambient air. During the measurement process, the sensor monitors the increase in relative humidity in the measurement cavity, and the evaporation rate (g / m 2h) It is automatically calculated according to the increase in relative humidity. During the measurement interval, the measurement chamber is passively ventilated, and the ventilation time can be automatically controlled.

[0089] Environmental conditions: The test environmental temperature is 20.1°C - 21.1°C, and the relative humidity is 50.6%RH - 59.7%RH.

[0090] Test results:

[0091] Table 4: Test results of skin transdermal water loss

[0092]

[0093] Table 4 shows that after the subjects continuously used the prepared essence water sample and the commercially available essence water sample containing collagen for 2 weeks, the skin transdermal water loss of the subjects decreased significantly compared with the basal loss. Among them, after using the prepared essence water samples of Example 1, Example 2, and Example 3, the improvement rates of skin transdermal water loss were 11.01%, 13.44%, and 10.20% respectively. After using the commercially available essence water sample containing collagen, the improvement rate of skin transdermal water loss was 10.06%. The essence water prepared in Example 2 had the highest improvement rate in the skin transdermal water loss test.

[0094] Test Example 3: VC20 skin smoothness SEsm and skin roughness SEr test

[0095] Test instrument: Skin microscope and active skin surface analysis system VC20Plus.

[0096] Test subjects: 32 Chinese healthy male / female subjects aged 18 - 35 years with an average age of 27.81 ± 0.85 years were selected, whose facial skin was rough with obvious visible pores; the facial skin had certain flushing / red blood streak symptoms; the skin barrier function was poor and the TEWL screening value ≥ 15; self-identified as sensitive skin and the lactic acid stimulation score ≥ 3 points.

[0097] Test samples: Prepared essence water sample and commercially available essence water sample containing collagen.

[0098] Test method: Using the before-and-after comparison method, the skin smoothness and skin roughness SEr / R3 of the subjects were measured before using the test samples and after continuously using the samples for 2 weeks.

[0099] Measurement area: Cheeks. The prepared essence water sample and the commercially available essence water sample containing collagen were each coated on the left and right cheeks, and were each coated once at (20 ± 0.1) mg / cm 2 for single coating.

[0100] Test principle: Through the active skin surface analysis software SELS, the gray level distribution on the skin surface can be statistically analyzed to obtain the clinically useful skin smoothness SEsm and skin roughness SEr / R3.

[0101] Environmental conditions: The test environment temperature is 20.1°C - 21.1°C, and the relative humidity is 50.6%RH - 59.7%RH.

[0102] Table 5: Test results of VC20 skin smoothness SEsm

[0103]

[0104] Table 5 shows that the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks. The VC20 skin smoothness SEsm of the subjects decreased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the improvement rates of VC20 skin smoothness SEsm were 5.88%, 8.74%, and 5.96% respectively. After using the commercially available essence water samples containing collagen, the improvement rate of VC20 skin smoothness SEsm was 4.82%. The essence water prepared in Example 2 had the highest improvement rate in the VC20 skin smoothness SEsm test. And the lower the value of VC20 skin smoothness SEsm, the smoother the skin.

[0105] Table 6: Test results of SEr / R3 skin roughness

[0106]

[0107] Table 6 shows that the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks. The SEr / R3 skin roughness of the subjects decreased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the improvement rates of SEr / R3 skin roughness were 4.24%, 6.91%, and 4.99% respectively. After using the commercially available essence water samples containing collagen, the improvement rate of SEr / R3 skin roughness was 2.53%. The essence water prepared in Example 2 had the highest improvement rate in the SEr / R3 skin roughness test. And the lower the value of SEr / R3 skin roughness, the rougher the skin.

[0108] Test example 4: Proportion of red area of Visia-CR skin, skin redness a value, number of skin pores, proportion of skin pore area.

[0109] Test instrument: Facial image analyzer VISIA-CR

[0110] Test subjects: 32 Chinese healthy male / female subjects aged 18 - 35 years old, with an average age of 27.81 ± 0.85 years old, were selected. Their facial skin was rough with obvious visible pores; their facial skin had certain flushing / thread-like telangiectasia symptoms; their skin barrier function was poor and the TEWL screening value was ≥ 15; they considered themselves to have sensitive skin and the lactic acid stimulation score was ≥ 3 points.

[0111] Test samples: Prepare essence water samples and commercially available essence water samples containing collagen.

[0112] Test method: Adopt a before-and-after control method. Before using the test samples and 2 weeks after continuously using the samples, measure the proportion of the red area of the subjects' skin, the a value of skin redness, the number of skin pores, and the proportion of the skin pore area.

[0113] Measurement area: Cheeks. Coat the prepared essence water samples and the commercially available essence water samples containing collagen on the left and right cheeks respectively, and perform a single coating according to (20 ± 0.1) mg / cm 2 for each.

[0114] Test principle: VISIA-CR uses multiple light sources, greatly improving the visibility of the skin to be analyzed, and providing the conditions of melanin and blood vessels in the lower layer of the skin. It is a new method for detecting, displaying, and analyzing the lower layer of the skin.

[0115] Environmental conditions: The test environment temperature is 20.1℃ - 21.1℃, and the relative humidity is 50.6%RH - 59.7%RH.

[0116] Table 7: Test results of the proportion of the red area of the skin

[0117]

[0118] Table 7 shows that after the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks, the proportion of the red area of the subjects' skin decreased significantly compared with the baseline value. Among them, after using the essence water samples prepared in Example 1, Example 2, and Example 3, the reduction rates of the red area of the skin were 5.63%, 9.25%, and 4.96% respectively. After using the commercially available essence water sample containing collagen, the reduction rate of the red area of the skin was 4.27%. The essence water prepared in Example 2 had the highest reduction rate in the SEr / R3 test of the proportion of the red area of the skin.

[0119] Table 8: Test results of the a value of skin redness

[0120]

[0121] Table 8 shows that the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks. The a value of the skin redness of the subjects decreased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the reduction rates of the a value of the skin redness were 6.41%, 7.57%, and 6.71% respectively. After using the commercially available essence water sample containing collagen, the reduction rate of the a value of the skin redness was 2.66%. The essence water prepared in Example 2 had the highest reduction rate in the test of the a value of the skin redness.

[0122] Table 9: Test results of the number of skin pores

[0123]

[0124] Table 9 shows that the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks. The number of skin pores of the subjects decreased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the reduction rates of the number of skin pores were 2.11%, 2.50%, and 2.46% respectively. After using the commercially available essence water sample containing collagen, the reduction rate of the number of skin pores was 1.93%. The essence water prepared in Example 2 had the highest reduction rate in the test of the number of skin pores.

[0125] Table 10: Test results of the proportion of skin pore area

[0126]

[0127] Table 10 shows that the subjects continuously used the prepared essence water samples and the commercially available essence water samples containing collagen for 2 weeks. The proportion of the skin pore area of the subjects decreased significantly compared with the baseline value. After using the essence water samples prepared in Example 1, Example 2, and Example 3, the reduction rates of the proportion of the skin pore area were 1.89%, 2.22%, and 1.92% respectively. After using the commercially available essence water sample containing collagen, the reduction rate of the proportion of the skin pore area was 1.66%. The essence water prepared in Example 2 had the highest reduction rate in the test of the proportion of the skin pore area.

[0128] Sequence information

[0129] SEQ ID NO: 1: Amino acid sequence of recombinant type I collagen

[0130] QLSYGYDEKS TGGISVPGPM GPSGPRGLPG PPGAPGPQGF QGPPGEPGEPGASGPMGPRGPPGPPGKNGD DGEAGKPGRP GERGPPGPQG ARGLPGTAGLPGMKGHRGFS GLDGAKGDAG PAGPKGEPGSPGENGAPGQM GPRGLPGERGRPGAPGPAGA RGNDGATGAA GPPGPTGPAG PPGFPGAVGAKGEAGPQGPRGSEGPQGVRG EPGPPGPAGA AGPAGNPGAD GQPGAKGANG APGIAGAPGFPGARGPSGPQGPGGPPGPKG NSGEPGAPGS KGDTGAKGEP GPVGVQGPPGPAGEEGKRGA RGEPGPTGLP GPPGERGGPGSRGFPGADGV AGPKGPAGERGSPGPAGPKG SPGEAGRPGE AGLPGAKGLT GSPGSPGPDGKTGPPGPAGQDGRPGPPGPP GARGQAGVMG FPGPKGAAGE PGKAGERGVP GPPGAVGPAGKDGEAGAQGPPGPAGPAGER GEQGPAGSPG FQGLPGPAGP PGEAGKPGEQGVPGDLGAPGPSGARGERGF PGERGVQGPPGPAGPRGANG APGNDGAKGDAGAPGAPGSQ GAPGLQGMPG ERGAAGLPGP KGDRGDAGPKGADGSPGKDGVRGLTGPIGP PGPAGAPGDK GESGPSGPAG PTGARGAPGD RGEPGPPGPAGFAGPPGADGQPGAKGEPGD AGAKGDAGPP GPAGPAGPPG PIGNVGAPGAKGARGSAGPP GATGFPGAAG RVGPPGPSGNAGPPGPPGPA GKEGGKGPRGETGPAGRPGE VGPPGPPGPA GEKGSPGADG PAGAPGTPGPQGIAGQRGVVGLPGQRGERG FPGLPGPSGE PGKQGPSGAS GERGPPGPMG PPGLAGPPGESGREGAPGAEGSPGRDGSPG AKGDRGETGP AGPPGAPGAP GAPGPVGPAGKSGDRGETGP AGPAGPVGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPG PPGSPGEQGPSGASGPAGPR GPPGSAGAPGKDGLNGLPGPIGPPGPRGRT GDAGPVGPPG PPGPPGPPGP PSAGFDFSFL PQPPQEKAHD

[0151] GGRYYRASEQ ID NO:2: Amino acid sequence of recombinant type III collagen

[0152]

Claims

1. An aqueous cosmetic comprising a recombinant collagen composition, a moisturizer, a thickener, a skin conditioner, a pH regulator and deionized water; in, The recombinant collagen composition consists of recombinant type III collagen, GSQ tripeptide, recombinant type I collagen and GER tripeptide; the weight ratio of the recombinant type III collagen to the GSQ tripeptide is 500:1 to 100:1; the weight ratio of the recombinant type I collagen to the GER tripeptide is 200:1 to 50:1; The amino acid sequence of the recombinant type III collagen is shown in SEQ ID No: 2; The amino acid sequence of the recombinant type I collagen is shown in SEQ ID No:

1.

2. The aqueous cosmetic according to claim 1, wherein: The weight ratio of the recombinant type III collagen to the GSQ tripeptide is 200:1 to 100:1, and / or the weight ratio of the recombinant type I collagen to the GER tripeptide is 100:1 to 50:

1.

3. The aqueous cosmetic according to claim 1, wherein: Based on 100 parts by weight of the total amount of the aqueous cosmetic, it comprises:

4. The aqueous cosmetic according to claim 1, wherein: The moisturizer is selected from glycerin, propylene glycol, butylene glycol, pentylene glycol, hexylene glycol, panthenol, methyl gluceth-20, glycereth-26, sodium hyaluronate, tetrahydromethylpyrimidine carboxylic acid, betaine and sodium polyglutamate; or, the thickener is selected from xanthan gum, acrylic acid (ester) / C10-30 alkyl acrylate crosspolymer and hydroxyethyl cellulose; or, the skin conditioner is selected from Centella Asiatica extract, madecassoside, β-glucan, glyceryl glucoside, bifida yeast fermentation product and ceramide; or, the pH adjuster is selected from triethanolamine, aminomethyl propanol and arginine.

5. The aqueous cosmetic according to claim 1, wherein: The moisturizing agent is 1 to 10 parts by weight of butylene glycol, 1 to 5 parts by weight of hexylene glycol, 0.1 to 1 part by weight of panthenol, 0.1 to 1 part by weight of sodium hyaluronate, and 0.1 to 1 part by weight of ectoine.

6. The aqueous cosmetic according to claim 1, wherein: The thickener is 0.1 to 1 part by weight of acrylic acid (ester) / C10-30 alkyl acrylate cross-linked polymer.

7. The aqueous cosmetic according to claim 1, wherein: The skin conditioning agent comprises 0.1 to 1 parts by weight of madecassoside and 1 to 14.5 parts by weight of Centella Asiatica extract.

8. The aqueous cosmetic according to claim 1, wherein: The pH regulator is 0.1 to 1 parts by weight of arginine.

9. The aqueous cosmetic according to claim 1, which is an essence water, an essence liquid, a facial mask, or a cleansing mousse.

Images