Glycosyl-modified fusion proteins, nucleic acid molecules, expression vectors, host cells and uses
By designing a glycosylated murine Fc variant fusion protein with hepatitis B virus antigen, the binding and activation ability with dendritic cells is enhanced, solving the problem of the ineffectiveness of existing HBV vaccines in chronic infection and achieving an effective immune response and therapeutic effect against HBV.
Patent Information
- Authority / Receiving Office
- CN · China
- Patent Type
- Applications(China)
- Current Assignee / Owner
- CHIMIGEN BIOMEDICAL (CHENGDU) CO LTD
- Filing Date
- 2025-08-28
- Publication Date
- 2026-06-23
AI Technical Summary
Existing HBV vaccines are ineffective in eradicating chronic infection, and in chronic viral infection, viral antigens are recognized as "self" substances and cannot be cleared through traditional immunization routes, leading to antigen tolerance of the immune system to HBV.
A glycosylated fusion protein, comprising a murine Fc variant and hepatitis B virus antigen, was designed. Through amino acid mutation and non-mammalian glycosylation modification, it was enhanced to bind to dendritic cells (DCs), activate DCs, and promote the proliferation and activation of specific T cells.
This fusion protein can effectively activate dendritic cells (DCs), promote the proliferation and activation of specific T cells, enhance the immune response, break tolerance to HBV antigens, and has the potential to treat hepatitis B virus infection.
Smart Images

Figure CN122255291A_ABST
Abstract
Description
[0001] This application claims priority to Chinese Patent Application No. 202411894669.X, filed on December 20, 2024, entitled "Glycosyl-modified fusion protein, nucleic acid molecule, expression vector, host cell and application", the entire contents of which are incorporated herein by reference. Technical Field
[0002] This application relates to a glycosylated fusion protein, nucleic acid molecule, expression vector, host cell, and application, and relates to the field of biopharmaceutical technology. Background Technology
[0003] Human hepatitis B virus (HBV) is a member of a family of DNA viruses that primarily infect the liver. HBV mainly infects hepatocytes and can cause both acute and chronic liver disease, leading to cirrhosis and hepatocellular carcinoma. Approximately 90% of adults infected with HBV clear the infection, while the remaining 10% become chronic carriers, who are highly likely to develop cirrhosis and hepatocellular carcinoma (Block, 2016). Prophylactic vaccines based on HBV surface antigen (HBsAg) are highly effective in providing protective immunity against HBV infection. These vaccines are developed from HBsAg purified from the plasma of chronic HBV carriers and produced using recombinant DNA technology and synthetic peptides (see U.S. Patents 4,599,230 and 4,599,231). These vaccines are highly effective in preventing infection but in eradicating established chronic infection.
[0004] When a healthy host (human or animal) encounters an antigen (such as a protein derived from bacteria, viruses, and / or parasites), the host typically initiates an immune response. This immune response can be humoral or cellular. In a humoral response, B cells produce antibodies in response to antigenic stimulation and secrete them into the blood and / or lymph. The antibodies then neutralize the antigen (e.g., a virus) by specifically binding to the antigen on their surface, kill it through phagocytosis by phagocytes, and / or through complement-mediated mechanisms. A cellular response is characterized by the ability to select for and increase specific helper cells and cytotoxic T lymphocytes to directly eliminate cells containing antigens. However, in many individuals, the immune system does not respond to certain antigens. When antigens do not stimulate the production of specific antibodies and / or cytotoxic T cells, the immune system is unable to prevent the resulting disease. Therefore, infectious agents (e.g., viruses) can establish chronic infection, and the host's immune system can develop antigen tolerance to the virus. The most common cases of chronic viral infection include hepatitis B, hepatitis C, human immunodeficiency virus (HIV), and herpes simplex virus (HSV).
[0005] In chronic infection, viruses can evade the host's immune system. Viral antigens are recognized as "self" substances within the body and are therefore not recognized by antigen-presenting cells. The way antigen-presenting cells process antigens depends on their location (Steinman et al., 1999). Exogenous antigens are processed in the APC endosome, and the resulting peptide fragments mix with major histocompatibility complex (MHC) class II molecules and are presented on the cell surface. This complex is presented to CD4+ T cells and stimulates the production of CD4+ T helper cells. Cytokines secreted by the helper cells then stimulate B cells to produce antibodies against the exogenous antigen (humoral response). Immunization using antigens typically generates an antibody response through this endosome antigen processing pathway. On the other hand, intracellular antigens are processed in the proteasome, and the resulting peptide fragments form a complex with MHC class I molecules and are presented on the APC surface. After this complex binds to the co-receptor CD8 molecule, the antigen is presented to CD8+ T cells, triggering a cytotoxic T cell (CTL) immune response that kills the host cells carrying the antigen.
[0006] In patients with chronic viral infections, viral antigens are produced within host cells due to active viral replication, and these secreted antigens circulate in bodily fluids. For example, virions, HBV surface antigen, and core antigen (e antigen) can be detected in the blood of chronic HBV carriers. Effective therapeutic vaccines may be able to induce CTL responses against intracellular antigens or antigens delivered to appropriate cellular compartments, thereby activating the MHC class I processing pathway. CTL-inducible therapeutic vaccines can be processed via the proteasome pathway and presented via the MHC class I pathway (Larsson et al., 2001). This can be achieved either by producing antigens within host cells or by delivering the vaccine to appropriate cellular compartments for processing and presentation to elicit a cellular response. Several methods for intracellular antigen delivery have been documented in the literature.
[0007] Dendritic cells (DCs) derived from blood monocytes can be immunomodulators that stimulate naïve T cell responses due to their ability to act as professional antigen-presenting cells (Steinman et al., 1999; Banchereau and Steinman, 1998). This unique property of dendritic cells in capturing, processing, presenting antigens, and stimulating naïve T cells makes them a crucial tool for developing therapeutic vaccines (Laupeze et al., 1999). Antigen targeting of dendritic cells is an important step in antigen presentation, and the presence of several receptors on dendritic cells targeting the Fc region of monoclonal antibodies has been used for this purpose (Regnault et al., 1999). Examples of this approach include the ovarian cancer Mab-B43.13 antibody, anti-PSA antibodies, and anti-HBV antibody-antigen complexes (Wen et al., 1999). Studies have shown that cancer immunotherapy using dendritic cells loaded with tumor-associated antigens generates tumor-specific immune responses and anti-tumor activity (Campton et al., 2000; Fong and Engleman, 2000). Satisfactory results were obtained in in vivo clinical trials using dendritic cells sensitized with tumor antigens (Tarte and Klein, 1999). These studies clearly demonstrate the efficacy of using dendritic cells to generate an immune response against cancer antigens.
[0008] In addition, previous studies have shown that chimeric antigens (fusion of Fc antibody fragments and HBV antigens) can effectively elicit antigen-specific T-cell and B-cell-mediated immune responses against HBV and can also break tolerance to HBV antigens under chronic conditions (George et al., US Patents 8007805 B2, 8025873 B2, 8029803 B2 and 8465745 B2, Chinese Patent 200480022747.1, Indian Patent 225281, Japanese Patent 5200201, Korean Patent 10-1327719, New Zealand Patent 545048, Singapore Patent 119567, South African Patent 2006-0804, Australian Patent 2012200998, effective European Patents; German, French and British Patent 1664270; Ma et al., 2020; George et al., 2020). Compared to reports on the modification of the Fc fragment of human immunoglobulins, there are relatively few reports on the modification of the Fc fragment of mouse immunoglobulins. We believe it is necessary to conduct research on the engineering modification of the Fc fragment of mouse immunoglobulins to determine whether the engineering modification can increase the presentation effect. Summary of the Invention
[0009] This application provides a glycosylated fusion protein comprising a murine Fc variant and a hepatitis B virus antigen, wherein the murine Fc variant is obtained by modifying a murine IgG1 Fc fragment. This fusion protein can bind to dendritic cells (DCs), activate DCs, and promote the proliferation and activation of specific T cells.
[0010] This application also provides a nucleic acid molecule encoding the above-mentioned fusion protein, as well as an expression vector and a host cell including the nucleic acid molecule.
[0011] This application also provides the use of the above-mentioned fusion protein in the preparation of a drug for treating hepatitis B virus.
[0012] The first aspect of this application provides a glycosylated fusion protein comprising a murine Fc variant and a hepatitis B virus antigen, wherein the fusion protein binds to dendritic cells (DCs), activates DCs, and promotes the proliferation and activation of specific T cells;
[0013] The mouse-derived Fc variant is obtained by amino acid mutation and glycosylation modification of a mouse-derived Fc fragment;
[0014] The mouse-derived Fc variant includes at least one of alanine at position 223, alanine at position 228, alanine at position 230, leucine at position 330, and glutamic acid at position 332.
[0015] In the glycosylation modification, the glycosyl group is derived from at least one of mannose, N-acetylglucosamine, and fucose;
[0016] In the glycosylation modification, the sugar chain structure formed by the glycosyl linkage is selected from at least one of high-mannose type, oligomannose type, and fucose type;
[0017] The non-mammalian glycosylation modifications do not include sialic acid modification;
[0018] The amino acid sites were numbered according to the EU numbering system.
[0019] In this application, the above-mentioned mouse Fc variant is obtained by modifying the wild-type Fc fragment shown in SEQ ID NO:1 with amino acid mutation and non-mammalian glycosylation.
[0020] Furthermore, the wild-type mouse Fc segment shown in SEQ ID NO:1 is the Fc segment of mouse IgG1. Except for the Fc segment of IgG1, the Fc segments of other mouse IgGs are applicable to this application. For example, when the Fc segment of mouse IgG2 is used as a basis, the Fc variant obtained after amino acid mutation and non-mammalian glycosylation modification has similar effects of binding to DC cells, activating DC cells, and promoting the proliferation and activation of specific T cells.
[0021] In some specific embodiments, the amino acid sequence of the mouse Fc variant is shown in SEQ ID NO:2 or SEQ ID NO:3.
[0022] The amino acid sequence shown in SEQ ID NO:2 consists of 232 amino acid residues. The mutation sites are determined according to the EU numbering system. The alanine residues at positions 223 and 228, and position 230, are shown as underlined in the following sequence:
[0023] VDKKIVP A DCGC A PCIC A VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSSVSELPIMHQDWLNGKEFKCRVNSAAFPAPIEKTISKTK GRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGL.
[0024] The alanine at positions 223 and 228, and positions 230, 330, and 332 in SEQ ID NO:3 are as shown by the underlined positions in the following sequence:
[0025] VDKKIVP A DCGC A PCIC A VPEVSSVFIFPPKPKDVLTITLTPKVTCVVVDISKDDPEVQFSWFVDDVEVHTAQTQPREEQFNSTFRSSVSELPIMHQDWLNGKEFKCRVNSAAFP L P E EKTISKTKGRPKAPQVYTIPPPKEQMAKDKVSLTCMITDFFPEDITVEWQWNGQPAENYKNTQPIMDTDGSYFVYSKLNVQKSNWEAGNTFTCSVLHEGLHNHHTEKSLSHSPGL.
[0026] The difference between non-mammalian glycosylation and mammalian glycosylation lies in the presence or absence of sialic acid modification and the content of mannose. In the technical solution provided in this application, glycosylation is primarily N-glycosylation, with the glycosyl groups derived from at least one of mannose, N-acetylglucosamine, and fucose. The glycan chain structure formed by the glycosyl linkages is selected from one or more of high-mannose, oligomannose, and fucose types. The high-mannose type consists of GlcNAc and mannose, containing 5 to 9 mannose molecules; oligomannose refers to less than 5 mannose molecules; and the fucose type contains fucose. In the solution provided in this application, the aforementioned glycosylation sites are all located on the 297th amino acid of the Fc variant.
[0027] Furthermore, the non-mammal is an insect. Further, the non-mammal is the fall armyworm. Even further, the fusion protein is expressed in Sf9 insect cells.
[0028] In this application, hepatitis B virus antigen refers to a protein on the surface of the hepatitis B virus (HBV), which is one of the important markers of HBV infection. These surface antigens—large protein (S1 / S2 / S), medium protein (S2 / S), and small protein (S)—are believed to participate in the binding of the virus to cell receptors for uptake, while the core protein (HBV Core) forms a capsid that encapsulates a portion of the double-stranded DNA genome. In this application, the HBV antigen can be HBV S1 and / or S2 and / or CORE (core antigen). Further, in some specific embodiments of this application, the HBV antigen is HBV S1 / S2 / CORE. HBV S1 / S2 / CORE, also known as "HBV S1 / S2 / core protein chimeric antigen," is a combination of the dominant B-cell epitopes from the pre-S1 and pre-S2 proteins of the HBV surface antigen and the HBV core antigen (HBcAg).
[0029] In this application, the aforementioned fusion protein mainly comprises a hepatitis B virus antigen capable of inducing an immune response in the body and a murine Fc variant that binds to dendritic cells (DCs). The murine Fc variant can be linked to the C-terminus of the hepatitis B virus antigen, or the hepatitis B virus antigen and the murine Fc variant can be linked by a linker peptide. In one embodiment, the amino acid sequence of the linker peptide is at least one of GGGS (SEQ ID NO: 13), SRGGGS (SEQ ID NO: 14), and VRPQGGGS (SEQ ID NO: 15).
[0030] In the scheme provided in this application, the fusion protein may further include a protein tag to facilitate the expression, detection, and purification of the target gene. Further, the protein tag may be a His tag, which is attached to the N-terminus of the polypeptide antigen to improve the purification efficiency of the fusion protein.
[0031] The fusion protein described above is a glycosylated fusion protein that includes a hepatitis B virus antigen and a murine Fc variant that can elicit an immune response in humans. The fusion protein can be obtained by expression in insect cells using a baculovirus expression system.
[0032] A second aspect of this application provides a nucleic acid molecule encoding any of the fusion proteins described above.
[0033] A third aspect of this application provides a recombinant expression vector comprising the aforementioned nucleic acid molecule.
[0034] A fourth aspect of this application provides a host cell comprising the aforementioned recombinant expression vector.
[0035] The fifth aspect of this application provides a pharmaceutical composition comprising any of the fusion proteins described above and a pharmaceutically acceptable carrier.
[0036] In this application, the pharmaceutically acceptable carrier is non-toxic to cells or individuals at the dosage and concentration used. A physiologically acceptable carrier is typically a pH buffer solution. The pharmaceutical composition provided in this application is further formulated as an injectable preparation, and the aforementioned carrier may also include diluents such as water, ethanol, and polyethylene glycol, as well as isotonic additives such as sodium chloride, glucose, or glycerol. Furthermore, conventional solubilizers and buffers may be added.
[0037] The sixth aspect of this application provides the use of any of the above-described fusion proteins in the preparation of medicaments for treating hepatitis B virus.
[0038] The seventh aspect of this application provides the use of any of the above-described fusion proteins in the preparation of medicaments for treating any hepatitis B virus expressing HBV S1 and / or S2 and / or core protein antigens.
[0039] In this application, the drug for treating hepatitis B virus can be an HBV antiviral agent. In some instances, the HBV antiviral agent can be a pharmaceutically acceptable agent comprising one or more compounds selected from tenofovir, tenofovir disoproxil fumarate, tenofovir alafenamide, entecavir, tebivelin, adefovir dipivoxil, and lamivudine. In other instances, the HBV antiviral agent is an HBV antiviral RNAi agent that inhibits HBV replication. In still other instances, the HBV antiviral agent is a core capsid assembly inhibitor. In yet another instance, the HBV antiviral agent is a TLR agonist.
[0040] In other embodiments of the method, the method further includes administering an immunomodulatory agent to the host. In some instances, the immunomodulatory agent is interferon, such as pegylated interferon alpha2-a. In other instances, the immunomodulatory agent is an immune checkpoint inhibitor, such as a PD1 / PDL1 inhibitor.
[0041] In other embodiments of this method, the host is a human subject. In still other embodiments, the viral infection is HBV infection.
[0042] The fusion protein provided in this application is formed by fusing a murine Fc variant with hepatitis B virus antigen. This fusion protein can bind to dendritic cells (DCs), activate DCs, and promote the proliferation and activation of specific T cells, thereby achieving the effect of treating hepatitis B virus infection in the host. Attached Figure Description
[0043] Figure 1a The results of SDS-PAGE identification of Seq2-Sf9 are shown, where M1 is the protein molecular weight marker and BSA is the protein standard.
[0044] Figure 1b The results of SDS-PAGE identification of Seq3-Sf9 are shown, where M is the protein molecular weight marker and BSA is the protein standard.
[0045] Figure 2a The results of BLI assays for Seq2-Sf9 and FcγRIIA proteins;
[0046] Figure 2b The results of BLI assays for Seq3-Sf9 and FcγRIIA proteins;
[0047] Figure 3 The results show the binding affinity of Seq2-293 and Seq3-293 to DC2.4 at different concentrations.
[0048] Figure 4a The results of the Seq4-Sf9 staining assay on SDS-PAGE / Pageblue are shown.
[0049] Figure 4b The results are from Seq4-Sf9 Western blot analysis; the primary antibody is His tag Polyclonal antibody (Rabbit); the secondary antibody is HRP-conjugated Affinipure Goat Anti-Rabbit IgG (H+L).
[0050] Figure 4cResults of SDS-PAGE / Pageblue staining assays for Seq5-Sf9 and Seq6-Sf9;
[0051] Figure 4d The results are from Western blot analysis of Seq5-Sf9 and Seq6-Sf9 proteins; the primary antibody is Histag Polvclonal antibody; the secondary antibody is HRP-conjugated Affinipure Goat Anti-Rabbit IgG (H+L).
[0052] Figure 4e The result of N-glycosylation modification at position 484 (position 297 of Fc fragment) in Seq4-Sf9;
[0053] Figure 4f The results show the percentage of fluorescence intensity detected by flow cytometry for Seq5-Sf9 and Seq6-Sf9.
[0054] Figure 5a The results of the SDS-PAGE / Pageblue staining assay for Seq7-Sf9 are shown; Lane 1 shows the sample eluted from the Ni column; Lane 2 shows the sample dialyzed into the storage solution.
[0055] Figure 5b The results are from a Western blot (WB) experiment of Seq7-Sf9; the antibody is Goat anti-mouse IgG (H+L), lane 1 is the sample eluted from the Ni column, and lane 2 is the sample dialyzed into the storage solution.
[0056] Figure 5c The results show the binding efficacy of Seq7-Sf9 to the mouse dendritic cell line DC2.4, with Mouse IgG1 serving as the control protein.
[0057] Figure 6a The results show the expression of CD54 on the cell surface after Seq7-Sf9 fusion protein was loaded with DC for 48 h. Among them, Donor#2, Donor#4, and Donor#5 were 3 PBMC volunteers.
[0058] Figure 6b The results show the expression of CD83 on the cell surface after Seq7-Sf9 fusion protein was loaded with DC for 48 h. Among them, Donor#2, Donor#4, and Donor#5 were 3 PBMC volunteers.
[0059] Figure 6cThe results show the expression of CD86 on the cell surface after Seq7-Sf9 fusion protein was loaded with DC for 48 h. Among them, Donor#2, Donor#4, and Donor#5 were 3 PBMC volunteers.
[0060] Figure 6d The results of Seq7-Sf9 loaded DCs on CD4+ T cell proliferation detection, where Donor#2, Donor#4, and Donor#5 were 3 PBMC volunteers;
[0061] Figure 7 Serum titer of rabbits immunized with Seq7-Sf9;
[0062] Figure 8 The results of SDS-PAGE gel identification of the fusion protein Seq8-293 are shown, where M1 represents the protein molecular weight marker, R represents the reduced protein, and NR represents the non-reduced protein.
[0063] Figure 9 SDS-PAGE gel identification results of the fusion protein Seq8-Sf9;
[0064] Figure 10 SDS-PAGE gel identification results of the fusion protein Seq9-Sf9;
[0065] Figure 11a The results show the expression of CD54 on the cell surface after Seq9-Sf9 and Seq10-293 loaded DC for 48 h.
[0066] Figure 11b The results show the expression of CD83 on the cell surface after Seq9-Sf9 and Seq10-293 loaded DC for 48 h.
[0067] Figure 12a The results of CD54 expression detection on the cell surface after Seq8-Sf9 loaded DC for 48 h;
[0068] Figure 12b The results of CD83 expression detection on the cell surface after Seq8-Sf9 loaded DC for 48 h;
[0069] Figure 13a The results show the expression of CD54 on the cell surface after Seq8-Sf9 and Seq8-293 cells were loaded with DCs.
[0070] Figure 13b The results show the expression of CD83 on the cell surface after Seq8-Sf9 and Seq8-293 were loaded with DCs.
[0071] Figure 14aThe results show the expression of CD54 on the cell surface after Seq8-Sf9 and Provenge loaded DCs.
[0072] Figure 14b The results show the expression of CD83 on the cell surface after Seq8-Sf9 and Provenge loaded DCs.
[0073] Figure 15a The results of Seq8-Sf9 and Provenge loaded DC assays were used to detect the proliferation of CD4+ T cells derived from volunteer 1.
[0074] Figure 15b The results of Seq8-Sf9 and Provenge loaded DC assays were used to detect the proliferation of CD4+ T cells derived from volunteer 2.
[0075] Figure 16 The results of ELISPOT detection of IFNγ secretion by DC-activated CD8+ T cells with Seq8-Sf9 load;
[0076] Figure 17 Results of Western Blot analysis of PAP protein expression levels in human prostate cancer cell lines PC3 and LNCap;
[0077] Figure 18a The results show the killing effect of Seq8-Sf9 and Provenge loaded DC-induced CTLs on PC3 tumor cells.
[0078] Figure 18b The results show the killing effect of Seq8-Sf9 and Provenge loaded DC-induced CTLs on LNCap tumor cells.
[0079] Figure 19a The results of detecting serum antibody titers against Seq6-Sf9 in SD rats immunized with Seq8-Sf9 via subcutaneous injection (dose of 0 / 2 / 10 / 50 ug); the sample collection time points were 0 days (before the first injection), 14 days (before the second injection), 28 days (before the third injection) and 35 days (one week after the third injection), n=6.
[0080] Figure 19b The results of serum antibody titer detection in SD rats immunized with Seq8-Sf9 subcutaneously (dose of 0 / 2 / 10 / 50 ug) 14 days later;
[0081] Figure 19c The results of serum antibody titer detection in SD rats immunized with Seq8-Sf9 subcutaneously (dose of 0 / 2 / 10 / 50 ug) 28 days later;
[0082] Figure 19dThe results of serum antibody titer detection in SD rats immunized with Seq8-Sf9 subcutaneously (dose of 0 / 2 / 10 / 50 ug) 35 days later;
[0083] Figure 20a The results of ELISPOT assay of IFNγ secreted by spleen cells of SD rats after Day 35 immunization with Seq8-Sf9;
[0084] Figure 20b ELISPOT dot plot of IFNγ secreted by spleen cells of SD rats after Day 35 immunization with Seq8-Sf9;
[0085] Figure 21 HE pathological staining of prostate tissue from SD rats after Day 35 immunization with Seq8-Sf9 (20× magnification).
[0086] Figure 22a The expression of CD54 on the cell surface was compared between Seq9 and Sf9 after 48 h of Seq8-Sf9 loaded with DCs.
[0087] Figure 22b The expression of CD83 on the cell surface was detected after Seq9-Sf9 was loaded with DC for 48 h, compared with Seq8-Sf9. Detailed Implementation
[0088] To enable those skilled in the art to better understand the solutions of this application, a further detailed description of this application is provided below. The specific embodiments listed below are merely descriptions of the principles and features of this application; the examples are only for explaining this application and are not intended to limit its scope. Based on the embodiments of this application, all other embodiments obtained by those skilled in the art without inventive effort are within the scope of protection of this application.
[0089] Example 1: Fc Variant Affinity Detection
[0090] 1.1 Acquisition and affinity detection of Fc variants expressed in Sf9 insect cells
[0091] To enhance the stability of the mouse IgG Fc fragment, mutations were made at positions 223, 228, and 230 of the wild-type mouse Fc fragment shown in SEQ ID NO:1. The resulting amino acid sequence is shown in SEQ ID NO:2. To enhance the binding and activation of the mouse IgG1 Fc fragment with DC cells, mutations were made at positions 223, 228, 230, 330, and 332 of the wild-type mouse Fc fragment. The resulting amino acid sequence is shown in SEQ ID NO:3.
[0092] The signal sequence (amino acid sequence shown in SEQ ID NO:11) of the AcMNPV gp64 protein was cloned into the RsrII-digested pFastBacHTa (Thermo Fisher Scientific; Cat# 10584-027) vector to obtain pFastBacHTa-gp64. Similarly, the signal sequence (amino acid sequence shown in SEQ ID NO:12) of the AcMNPV gp67 protein was cloned into the RsrII-digested pFastBacHTa (Thermo Fisher Scientific; Cat# 10584-027) vector to obtain pFastBacHTa-gp67. The DNA sequence corresponding to the amino acids shown in SEQ ID NO:2 or SEQ ID NO:3 was synthesized, and the fragment was subcloned into the pFastBacHTa-gp64 vector digested with Sal I (New England Biolabs, R3138S) and Hind III (New England Biolabs, R0104S) for expression in insect cells. The recombinant plasmid was transformed into DH10Bac competent cells and then cultured on fresh LB agar plates containing 50 μg / ml kanamycin, 7 μg / ml gentamicin, 10 μg / ml tetracycline, 100 μg / ml Bluo-gal, and 40 μg / ml IPTG. After incubation overnight, white colonies were selected, and recombinant rod-granule DNA was isolated according to standard protocol. Positive rod particles were transiently transfected into 2 ml of insect Sf9 cells using a transfection reagent. The transfected cells were incubated in ESF 921 medium for a period of time, and the cells and supernatant were collected. The proteins were purified from the supernatant using Protein A and named Seq2-Sf9 and Seq3-Sf9, respectively.
[0093] Seq2-Sf9 and Seq3-Sf9 were identified using Coomassie blue-stained SDS-PAGE gels, with BSA as a control protein. The identification results are as follows: Figures 1a-1bAs shown in the image, the arrows indicate the locations of Seq2-Sf9 and Seq3-Sf9, confirming the obtained purified proteins with a molecular weight of approximately 26 kDa. Biolayer Interferometry (BLI) was used to perform multi-concentration affinity assays on the purified Seq2-Sf9 and Seq3-Sf9 proteins, setting concentration gradients of 5000 nM, 2500 nM, 1250 nM, 625 nM, and 312.5 nM to determine the affinity of Seq2-Sf9 and Seq3-Sf9 proteins for FcγRIIA protein. The detection results are shown below. Figures 2a-2b As shown, the curves from bottom to top indicate that the concentrations of Seq2-Sf9 and Seq3-Sf9 proteins increase sequentially. Calculations show that the affinity (KD value) between Seq2-Sf9 and Seq3-Sf9 and FcγRIIA protein are 7.893E-07 and 4.496E-07, respectively. The smaller the value, the higher the affinity, indicating that the five mutations in the mouse Fc domain can enhance the affinity for FcγRIIA.
[0094] 1.2 Obtaining the Fc variant expressed in 293 cells and detecting its binding affinity to DC cells
[0095] The synthesized DNA sequences corresponding to SEQ ID NO:2 and SEQ ID NO:3 were cloned into the eukaryotic expression vector pcDNA3.4 containing a secretory signal peptide, with EcoRI (New England Biolabs, R0101V) and HindIII (New England Biolabs, R0104S) restriction sites. The clones were electroporated into *E. coli* trans5α, screened with ampicillin, and sequenced to obtain the correct recombinant plasmids. The host bacteria containing the recombinant plasmids were then expanded, and sterile, endotoxin-free recombinant plasmids were obtained using an endotoxin-free kit. The sterile, endotoxin-free recombinant plasmids were mixed with Polyplus suspension cell transfection reagent and transfected into HEK293F cells. After 5 days of expansion culture in serum-free medium, the supernatant was collected and purified using Protein A resin to obtain proteins Seq2-293 and Seq3-293.
[0096] Seq2-293 and Seq3-293 enhanced the binding to FcR, which is mainly expressed on the surface of various monocytes, including dendritic cells (DCs). Since the aforementioned Fc variants are derived from the mouse Fc segment, the mouse dendritic cell line DC2.4 was chosen as the research subject, as it expresses relatively stable FcR and can bind to mouse-derived Fc. Under natural conditions, Fc has a weak affinity for its receptor FcR. DC2.4 cells were incubated with the same concentrations of Seq2-293 and Seq3-293 at 4°C for 1 h. Biotin-labeled anti-mouse IgG1 (anti-Mouse IgG1 Biotin) and streptavidin-HRP (streptavidin-HRP) were then added, respectively, for reaction. The reaction was terminated after TMB substrate color development. Finally, visible light OD450-570 was measured to indicate the Fc / FcR binding on the surface of DC2.4 cells.
[0097] Test results as follows Figure 3 As shown, it can be seen that Seq3-293 has a significantly higher affinity for DC2.4 than Seq2-293 at the same concentration, and this affinity is directly proportional to the working concentration; that is, the Fc variant with the five mutations can enhance the binding ability with DC and has considerable antigen presentation potential.
[0098] Example 2: Preparation of HBV-mFc protein and evaluation of DC binding effect
[0099] 2.1 Preparation of Seq4-Sf9, Seq5-Sf9, and Seq6-Sf9 proteins
[0100] The five-mutant mouse Fc with the amino acid sequence shown in SEQ ID NO:3 was fused with hepatitis B virus antigen (including HBV S1 / S2 / Core) via a linker peptide and a hydrophilic peptide (SEQ ID NO: 16) was attached to the C-terminus to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:4, where hepatitis B virus antigen is located at positions 36-394 and the five-mutant mouse Fc with the amino acid sequence shown in SEQ ID NO:2 is located at positions 403-634.
[0101] The triple mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:2 was fused with hepatitis B virus antigen (including HBV S1 / S2) via a linker peptide to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:5, where positions 36-209 are hepatitis B virus antigen and positions 218-449 are triple mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:2.
[0102] The five-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:3 was fused with hepatitis B virus antigen (including HBV S1 / S2) via a linker peptide to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:6, where positions 36-209 are hepatitis B virus antigen and positions 218-449 are the five-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:2.
[0103] The gene encoding the amino acid sequence shown in SEQ ID NO:4 was ligated into the pFastBacHTa-gp64 vector digested with Sal I (New England Biolabs, R3138S) and Hind III (New England Biolabs, R0104S) for expression in insect cells. Similarly, the genes encoding the amino acid sequences shown in SEQ ID NO:5 and SEQ ID NO:6 were ligated into the pFastBacHTa-gp67 vector digested with Sal I (New England Biolabs, R3138S) and Hind III (New England Biolabs, R0104S) for expression in insect cells. These vectors were then transformed into *E. coli* DH10Bac for transposition to produce recombinant baculovirus. The recombinant baculovirus was isolated and transfected into Sf9 insect cells. Cells were incubated in ESF921 medium at 27°C for 72 hours. The cell pellet was collected and lysed by sonication. Fusion proteins, named Seq4-Sf9, Seq5-Sf9, and Seq6-Sf9, were purified from infected Sf9 cells using affinity chromatography. SDS-PAGE gels stained with Coomassie blue and Western blotting were performed; the results are shown below. Figures 4a-4d As shown, the apparent molecular weights of the monomers of the Seq4-Sf9, Seq5-Sf9, and Seq6-Sf9 fusion proteins are 77KD, 57KD, and 57KD, respectively.
[0104] 2.2 Identification of Glycosylation of Seq4-Sf9
[0105] The fusion protein Seq4-Sf9 obtained from the Sf9 insect cell expression system was sequentially treated with Lys-C protease and Trypsin. The peptide samples after enzymatic digestion were then analyzed using liquid chromatography-mass spectrometry (LC-MS). The raw LC-MS data were analyzed using software, confirming that the N-glycosylation modification ratio of asparagine at position 484 (Fc fragment position 297) was 68.93%, and the glycoform distribution ratio was as follows: Figure 4e This indicates that the glycosylation modification of the fusion protein expressed by the Sf9 insect system is mainly high-mannose type, with a small amount of oligomannose type and fucose type (glycoforms according to Oxford nomenclature).
[0106] 2.3 Detection of the protein binding efficacy of the fusion protein HBV-mFc
[0107] To assess the binding level of the fusion protein HBV-mFc to dendritic cells, imDCs were induced using the classic adherent method. Under serum-free conditions, monocytes exhibit some adhesion; after removing non-adherent cells (mainly T and B cells), they differentiated into immature dendritic cells (imDCs) in a culture system containing granulocyte-macrophage colony-stimulating factor (GM-CSF) and interleukin-4 (IL-4). The imDCs were incubated with the Seq5-Sf9 and Seq6-Sf9 fusion proteins (50 μg / mL each) on ice (2-8℃) for 1 h. After gently washing away unbound portions, the cells were incubated with the secondary antibody PE Rat anti-Mouse IgG1 for a period of time. The fluorescence percentage of the Seq5-Sf9 and Seq6-Sf9 fusion proteins bound to the DCs was then detected by flow cytometry. The Seq5-Sf9 mouse Fc fragment has a triple mutation, while the Seq6-Sf9 mouse Fc fragment has a pentamutation; the fluorescence percentage represents the proportion of the fusion protein bound to DC cells out of all cells. Figure 4f Flow cytometry analysis of fluorescence intensity percentages showed that the fluorescence of the imDC stealth control was low, indicating that the nonspecific background of the cells was low; the binding of the five-mutant (Seq6-Sf9) to imDC was significantly higher than that of the three-mutant (Seq5-Sf9).
[0108] 2.4 Evaluation of the in vitro activation effect of HBV-mFc protein
[0109] 2.4.1 Preparation of Seq7-Sf9 fusion protein
[0110] Triple-mutant mouse Fc cells with the amino acid sequence shown in SEQ ID NO:2 were fused with hepatitis B virus antigens (including HBV S1 / S2 / Core) via a linker peptide, and a hydrophilic peptide was attached to the C-terminus to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:7. Positions 36-394 represent the hepatitis B virus antigen, and positions 403-634 represent the triple-mutant mouse Fc cells with the amino acid sequence shown in SEQ ID NO:2. The protein expression method is shown in 2.1, using pFastBacHTa-gp64 as the vector, and the protein was named Seq7-Sf9. Biochemical assays were performed using Coomassie Brilliant Blue staining on SDS-PAGE gels and Western blotting. The results are shown below. Figures 5a-5b As shown, the apparent molecular weight of the monomer of the fusion protein is approximately 77 kDa.
[0111] 2.4.2 Assess the binding affinity of Seq7-Sf9 to DC cells
[0112] Different concentrations of Seq7-Sf9 were incubated with DC2.4 cells at 4°C for 1 h (Seq7-Sf9 concentrations were 0 μg / mL, 5 μg / mL, 25 μg / mL, and 50 μg / mL). Biotin-labeled anti-mouse IgG1 (anti-Mouse IgG1 Biotin) and streptavidin-HRP (streptavidin-HRP) were added, respectively, for reaction. The reaction was terminated after TMB substrate exposure. The OD450-570 absorbance value represents the cell surface binding of the fusion protein. Natural mouse IgG1 was used as a control. Figure 5c As shown, compared with the control Mouse IgG1, Seq7-Sf9 has a stronger binding efficacy to DC2.4, suggesting that the fusion protein has the potential for a strong antigen presentation capability.
[0113] 2.4.3 Evaluation of the immune activation effect of the fusion protein Seq7-Sf9 using dendritic cells induced by CD14+ monocytes in peripheral blood PBMCs from healthy individuals.
[0114] To assess the immune-activating effect of the Seq7-Sf9 fusion protein, CD14+ monocytes from three healthy human PBMCs were selected and induced to differentiate into immature dendritic cells (DCs) in a culture system containing granulocyte-macrophage colony-stimulating factor (GM-CSF) and interleukin-4 (IL-4). Immature DCs exhibited strong phagocytic function, and the murine Fc domain contained in the fusion protein enhanced their uptake function, promoting DC maturation and differentiation. Flow cytometry was used to detect changes in surface markers of Seq7-Sf9 fusion protein-loaded DCs, including the adhesion molecule CD54 (ICAM-1: Intercellular adhesion molecule-1), which facilitates adhesion and interaction between mature DCs and other immune cells (such as T cells), and CD83 and the co-stimulatory molecule CD86, which are involved in antigen presentation and T cell activation. The results are as follows: Figures 6a-6c As shown, in three different volunteers, the Seq7-Sf9 fusion protein-loaded DCs highly expressed CD54, CD83, and CD86 maturation markers on their surface, indicating that the fusion protein has a strong DC activation effect, activating the antigen presentation capacity of vaccine-loaded DCs and initiating an immune response as a starting point.
[0115] 2.4.2 Key to in vitro assessment of the effect of Seq7-Sf9-loaded DCs on T cell immune responses
[0116] The primary function of proliferating and maturing dendritic cells (DCs) of CD4+ T cells is antigen presentation. The antigen peptide / MHC-I or antigen peptide / MHC-II complexes on their surface are recognized by T cell surface receptors (TCRs). A crucial step in DC-T cell activation is T cell proliferation. Therefore, co-culturing Seq7-Sf9-loaded DCs with CFSE-labeled CD4+ T cells, after antigen presentation, allows T cells to rapidly proliferate and differentiate into Th cells (helper T cells). The proliferation of CD4+ T cells is then used to assess immune status. Results are as follows... Figure 6d As shown, Seq7-Sf9-loaded DCs significantly promoted T cell proliferation compared to the negative control CD4+ T cells from the same source (Seq7-Sf9 0 μg / ml), and the effect was positively correlated with the concentration of Seq7-Sf9.
[0117] 2.5 Determination of rabbit serum titer
[0118] Antibody levels in rabbit serum were assessed using ELISA. Two healthy male New Zealand rabbits aged 3-4 months were selected as experimental animals. 15 μg of the test substance Seq7-Sf9 protein was dissolved in 0.5-1 mL of PBS solution and emulsified thoroughly with complete / incomplete Freund's adjuvant (4 mg / mL) at a 1:1 volume ratio. The mixture was then injected subcutaneously at four points on the back of the rabbit, resulting in a total of six immunizations (D1, D15, D29, D43, D64, D92), with intervals of 2-4 weeks between each immunization. The immunization dose was 15 μg / rabbit / immunization. (The first immunization used complete Freund's adjuvant, while the second, third, fourth, fifth, and sixth immunizations used incomplete Freund's adjuvant).
[0119] After incubating Seq7-Sf9 (200 ng / well) protein-coated plates overnight, the plates were blocked with PBS + 5% (w / v) BSA for 2 hours. The plates were then incubated for one hour with serially diluted serum samples (starting at 1:300 for each serum sample, with 12 serial dilutions in 2-fold increments). The binding of Seq7-Sf9 to IgG was detected using goat anti-rabbit IgG antibody. The plates were developed using the TMB (3,3',5,5'-tetramethylbenzidine) two-component peroxidase substrate kit (KPL), and the reaction was terminated by adding stop solution. The absorbance at 450 nm was immediately recorded using a SpectraMax Plus spectrophotometer (Molecular Devices). Figure 7 The results showed that antibody levels increased after persistent infection of rabbits with Seq7-Sf9.
[0120] Example 3: Preparation and Bioactivity Evaluation of Seq8-293, Seq8-Sf9, and Seq9-Sf9
[0121] 3.1 Preparation of Seq8-293
[0122] The triple-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:2 was fused with a linker peptide to PAP, a specific marker of prostate cancer, to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:8, wherein positions 1-354 are PAP, a specific marker of prostate cancer, and positions 361-592 are the triple-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:2.
[0123] A gene encoding the amino acid sequence shown in SEQ ID NO:8 was synthesized. The gene sequence encoding this fusion protein was ligated into the expression vector pcDNA3.4. A recombinant expression plasmid was prepared by digesting EcoRI (New England Biolabs, R0101V) and HindIII (New England Biolabs, R0104S) restriction enzymes. The recombinant expression plasmid was transiently transfected into eukaryotic cells HD293F and cultured. The cell culture medium was collected, centrifuged, and filtered. The filtered culture supernatant was loaded onto a Protein A affinity chromatography column to purify the fusion protein, named Seq8-293. Biochemical assays were performed using Coomassie blue-stained SDS-PAGE gels. The results are shown below. Figure 8 As shown.
[0124] 3.2 Preparation of Seq8-Sf9
[0125] The triple-mutant mouse Fc cell containing the amino acid sequence shown in SEQ ID NO:2 was fused with a prostate cancer-specific marker, PAP, via a linker peptide to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:8. The corresponding coding sequence was then ligated into a pFastBacHTa-gp67 vector digested with Sal I (New England Biolabs, R3138S) and Hind III (New England Biolabs, R0104S) for expression in insect cells. This vector was then transformed into *E. coli* DH10Bac for transposition to generate recombinant baculovirus. The recombinant baculovirus was isolated and transfected into Sf9 insect cells. The cells were incubated in ESF921 medium at 27°C for 72 hours to express the target protein. The supernatant was collected by centrifugation, and the protein purified by Protein A was named Seq8-Sf9. Biochemical assays were performed using Coomassie blue-stained SDS-PAGE gels. The results are shown below. Figure 9 As shown.
[0126] 3.3 Preparation of Seq9-Sf9
[0127] The five-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:3 was fused with a linker peptide to PAP, a specific marker of prostate cancer, to obtain a fusion protein with the amino acid sequence shown in SEQ ID NO:9, wherein positions 1-354 are PAP, a specific marker of prostate cancer, and positions 361-592 are the five-mutant mouse Fc of the amino acid sequence shown in SEQ ID NO:3.
[0128] Using the same method as in 3.2, the above fusion protein was expressed in Sf9 insect cells. The resulting fusion protein was named Seq9-Sf9. Biochemical assays were performed using Coomassie Brilliant Blue stained SDS-PAGE gels. The results are shown below. Figure 10 As shown.
[0129] 3.4 Detection of the activation effect of Seq9-Sf9 on DC
[0130] The human wild-type Fc fragment and the prostate cancer-specific marker PAP were expressed in mammalian 293 cells. The Seq10-293 fusion protein was obtained using the same method as in 3.1. Its amino acid sequence is shown in SEQ ID NO:10. The Seq10-293 fusion protein was used as a control to verify the effect of Fc variants and insect glycoforms on DC activation.
[0131] CD14+ monocytes from two healthy human PBMCs were selected and induced to differentiate into immature dendritic cells (DCs) in a culture system containing granulocyte-macrophage colony-stimulating factor (GM-CSF) and interleukin-4 (IL-4). Immature DCs possess strong phagocytic function and were loaded with Seq9-Sf9 and Seq10-293 fusion proteins, respectively. DCs phagocytosed the fusion proteins and presented antigens, thereby activating the DCs and expressing activation markers (including CD54 and CD83). Flow cytometry was used to detect changes in surface markers on vaccine-loaded DCs. The results are shown below. Figures 11a-11b As shown, at the same concentration, compared to Seq10-293, Seq9-Sf9 significantly activated dendritic cells (DCs), and highly expressed CD54 and CD83 on the cell surface. These results demonstrate that the murine Fc variant and non-mammalian glycoform in the fusion protein can significantly enhance DC phagocytosis and activation, and express activation phenotypes such as CD54 and CD83.
[0132] 3.5 Detection of DC activation effect by Seq8-Sf9
[0133] 3.5.1 Using CD14+ monocytes induced by human peripheral blood PBMCs to assess the immune activation effect of the fusion protein Seq8-Sf9
[0134] To assess the immune activation effect of Seq8-Sf9, CD14+ monocytes from three healthy human PBMCs were selected and induced to differentiate into immature dendritic cells (DCs) in a culture system containing granulocyte-macrophage colony-stimulating factor (GM-CSF) and interleukin-4 (IL-4). Immature DCs exhibited strong phagocytic function, and the murine Fc domain contained in the fusion protein enhanced their uptake function, promoting DC maturation and differentiation. Flow cytometry was used to detect changes in surface markers of vaccine-loaded DCs, including adhesion molecule CD54 (ICAM-1: Intercellular adhesion molecule-1), which facilitates adhesion and interaction between mature DCs and other immune cells (such as T cells), and CD83, which is involved in antigen presentation and T cell activation. The results are as follows: Figures 12a-12b As shown, in three different volunteers, Seq8-Sf9-loaded DCs highly expressed CD54 and CD83 on their surface, indicating that the fusion protein has a strong DC activation effect, activating the antigen presentation ability of Seq8-Sf9-loaded DCs and initiating an immune response as a starting point.
[0135] Furthermore, the immune activation effects of Seq8-Sf9, Seq8-293, and the positive control drug Provenge (sipuleucel-T) were compared, and the results are as follows: Figures 13a-13b As shown in 14a-14b, it can be seen that the Fc variant and non-mammalian glycosylation enhance DC activation efficacy, and Seq8-Sf9 has stronger DC activation function.
[0136] 3.5.2 Key to in vitro assessment of the effect of Seq8-Sf9-loaded DCs on T cell immune responses
[0137] The primary function of proliferating and maturing dendritic cells (DCs) of CD4+ T cells is antigen presentation. The antigen peptide / MHC-I or antigen peptide / MHC-II complexes on their surface are recognized by T cell surface receptors (TCRs). A crucial step in DC-T cell activation is T cell proliferation. Therefore, co-culturing Seq8-Sf9-loaded DCs with CFSE-labeled CD4+ T cells allows for rapid T cell proliferation and differentiation into Th cells (helper T cells) after antigen presentation. This CD4+ T cell proliferation can then be used to assess immune status. Figures 15a-15b As shown, loading DC cells from different healthy individuals with Seq8-Sf9 significantly promoted T cell proliferation, and the effect was positively correlated with the concentration of Seq8-Sf9. Provenge under the same experimental conditions also showed the same effect.
[0138] 3.5.3 In vitro evaluation of Seq8-Sf9-loaded DC antigen-presenting activated cytotoxic T cells
[0139] Antigen peptide / MHC class I molecule complexes presented on the surface of dendritic cells (DCs) can directly recognize and bind to the TCRs on the surface of CD8+ T cells, thereby activating CD8+ T cells to exert their biological effects, one of the main mechanisms being the secretion of interferon-γ (IFNγ). Seq8-Sf9-loaded DCs were co-cultured with CD8+ T cells from the same volunteer, and then a second stimulation with Seq8-Sf9-loaded DCs was performed to activate a large number of CD8+ T cells. The secretion of IFNγ at the single-cell level was detected by ELISPOT. The results are as follows: Figure 16 As shown, the Seq8-Sf9 loaded group had significantly more IFNγ than the volunteers' own CD8+ T cells (negative control), indicating that Seq8-Sf9 can effectively promote CD8+ T cell activation.
[0140] 3.5.4 Using human prostate cancer cell lines expressing PAP antigen as target cells to evaluate the killing effect of Seq8-Sf9 activated CTLs.
[0141] Treatment for prostate cancer varies depending on androgen sensitivity. PC3 is a common androgen-independent human prostate cancer cell line, while LNCap is androgen-dependent. Both cell lines express a certain amount of PAP, and... Figure 17 As shown, LNCap expressed relatively more PAP protein. Using them as target cells, they were co-cultured with effector cells (CTLs activated by Seq8-Sf9 loaded DCs); the absolute count of dead cells was determined using CFSE and counting beads. Figures 18a-18b As shown, DC-activated CTLs loaded with Seq8-Sf9 can directly kill target cells, and the effect is proportional to the concentration of Seq8-Sf9. In addition, the number of LNCap dead cells in PAP cells with higher expression levels is much higher than that in PC3, which verifies its targeted killing effect and is higher than that of Provenge.
[0142] 3.6 Immunogenicity assessment of Seq8-Sf9
[0143] To assess the immune response to Seq8-Sf9 in vivo, male Sprague Dawley (SD) rats aged 6-8 weeks were immunized with Seq8-Sf9. SD rats were subcutaneously injected with Seq8-Sf9 (Placebo / rat, 2ug / rat, 10ug / rat, 50ug / rat) every two weeks, for a total of three injections. Serum was collected from the immunized animals on Day 14, Day 28, and Day 35 (one week after the third injection) to detect the Seq8-Sf9 specific antibody titer. Figures 19a-19dAs shown, compared to the Placebo group, a low dose of 2ug was sufficient to produce vaccine-specific serum antibodies, with antibody titers reaching their highest levels one week after the third and fourth doses.
[0144] In addition, the spleen of rats on day 35 was harvested and restimulated in vitro with Seq8-Sf9 to activate and induce effector T cell activation. ELISPOT analysis was performed to detect IFNγ secretion from individual spleen cells. Figures 20a-20b As shown, spleen immune cells can rapidly differentiate into cytotoxic T lymphocytes and secrete IFNγ under the secondary stimulation of Seq8-Sf9.
[0145] At the same time, the prostate tissue was observed, and the results were as follows: Figure 21 As shown, inflammatory cell infiltration was also observed in the prostate tissue of rats in the Seq8-Sf9 group.
[0146] In summary, Seq8-Sf9 can establish a complete in vivo immune response in SD rats and effectively activate T cells, meaning that Seq8-Sf9 can complete in vivo immune activation.
[0147] 3.7 Assess the immune activation effect of the Seq9-Sf9 fusion protein using dendritic cells induced by CD14+ monocytes from human peripheral blood PBMCs.
[0148] The Fc segment of Seq9-Sf9 differs from that of Seq8-Sf9. To assess its immune activation effect, CD14+ monocytes sorted from PBMCs of two healthy individuals were induced to differentiate and loaded with Seq9-Sf9. Flow cytometry was used to detect changes in antigen-loaded dendritic cell (DC) surface markers, such as... Figures 22a-22b As shown, Seq9-Sf9 can increase the expression of CD54 and CD83 on the surface of DC cells, promote DC activation, and the expression levels of the markers are higher than those of Seq8-Sf9.
[0149] Finally, it should be noted that other embodiments of this application will readily conceive of by those skilled in the art upon consideration of the specification and practice of the application disclosed herein. This application is intended to cover any variations, uses, or adaptations of this application that follow the general principles of this application and include common knowledge or customary techniques in the art not disclosed herein, and is not limited to what has been described above, and various modifications and changes may be made without departing from its scope. The scope of this application is limited only by the appended claims.
Claims
1. A glycosylated fusion protein, characterized in that, Including a murine Fc variant and hepatitis B virus antigen, the fusion protein binds to dendritic cells (DCs), activates DCs, and promotes the proliferation and activation of specific T cells; The mouse-derived Fc variant is obtained by amino acid mutation and glycosylation modification of a mouse-derived Fc fragment; The mouse-derived Fc variant includes at least one of alanine at position 223, alanine at position 228, alanine at position 230, leucine at position 330, and glutamic acid at position 332. In the glycosylation modification, the glycosyl group is derived from at least one of mannose, N-acetylglucosamine, and fucose; In the glycosylation modification, the sugar chain structure formed by the glycosyl linkage is selected from at least one of high-mannose type, oligomannose type, and fucose type; The glycosylation modification does not include sialic acid modification; The amino acid sites were numbered according to the EU numbering system.
2. The fusion protein according to claim 1, characterized in that, The amino acid sequence of the mouse Fc variant is shown in SEQ ID NO:2 or SEQ ID NO:
3.
3. The fusion protein according to claim 1 or 2, characterized in that, The hepatitis B virus antigen is HBV S1 and / or S2 and / or CORE.
4. The fusion protein according to any one of claims 1-3, characterized in that, The fusion protein also includes a protein tag.
5. The fusion protein according to any one of claims 1-4, characterized in that, The fusion protein also contains linker peptides.
6. A nucleic acid molecule encoding the fusion protein of any one of claims 1-5.
7. A recombinant expression vector, characterized in that, Includes the nucleic acid molecule as described in claim 6.
8. A host cell, characterized in that, Includes the recombinant expression vector as described in claim 7.
9. A pharmaceutical composition, characterized in that, Includes the fusion protein as described in any one of claims 1-5 and a pharmaceutically acceptable carrier.
10. The use of the fusion protein according to any one of claims 1-5 in the preparation of a medicament for treating hepatitis B virus and hepatitis B-related liver cancer.
11. The use of the fusion protein according to any one of claims 1-5 in the preparation of a medicament for treating any hepatitis B virus expressing HBV S1 and / or S2 and / or core protein antigens and hepatitis B-related hepatocellular carcinoma.
12. A method for treating hepatitis B virus infection, characterized in that, The fusion protein according to any one of claims 1-5 is administered to a subject.
Citation Information
Patent Citations
CN1845995A
JP1977000201A
KR101327719B1
US4599230A
US4599231A