Collagen composition for skin substrate repair and skin care application thereof

Abstract

The invention discloses a collagen composition for skin substrate repair and skin care application thereof, and the collagen composition comprises the following components: 1-3% of soluble III-type collagen, 1-5% of hyaluronic acid, 1-2% of plant extract, 0.1-0.5% of allantoin, 0.2-0.5% of dipotassium glycyrrhizinate, 1-5% of glycerol, 1-5% of butanediol, 1-5% of 1, 2-propylene glycol, 1-5% of 1, 3-propylene glycol, 1-5% of propylene glycol and the balance of water. The cleaning agent is prepared from the following components in percentage by weight: 1 to 2 percent of 1, 2-hexanediol, 0.1 to 0.5 percent of phenoxyethanol, 0.1 to 0.5 percent of ethylhexylglycerin, 0.1 to 0.5 percent of carbomer, 0.1 to 0.5 percent of triethanolamine and the balance of water. The collagen III is added, so that the problems of wrinkles and skin aging are remarkably relieved. According to the skin-care lotion, the oily composition and the water-based composition are reasonably proportioned, so that excellent moistening and moisturizing effects are provided, the moisture balance of the skin is favorably maintained, and the skin is kept soft and moist. The added plant extract, hydrolyzed protein and mineral substances not only nourish and repair the skin, but also can improve various skin problems, enhance the endurance capacity of the skin and avoid the condition that the skin wrinkles are increased during the period of stopping using.

Description

Technical Field

[0001] The invention belongs to the technical field of bioengineering, and relates to a collagen composition for skin base repair and its application in skin care. Background Art

[0002] Skin aging is a complex process that is caused by both endogenous and exogenous factors. Endogenous factors mainly include genetic factors and the natural aging process. As we age, the regeneration capacity of skin cells weakens, and the production of collagen and elastin decreases, causing the skin to lose elasticity and radiance.

[0003] The extracellular matrix (ECM) plays an important role in skin aging. ECM is composed of components such as collagen, elastin and glycosaminoglycans, which provide mechanical strength and elasticity to the skin. When the structure and function of the ECM change significantly, the function of fibroblasts is weakened, resulting in a decrease in the production of collagen and elastin, which can cause skin aging. In addition, external factors such as ultraviolet radiation and pollutants can also accelerate the degradation of ECM and destroy collagen and elastin. Pollutants damage the components of ECM through oxidative stress and inflammatory responses. These external factors interact with the endogenous aging process, accelerating skin aging and causing various other problems such as dull skin, fine lines, acne, etc.

[0004] Therefore, it is necessary to propose a preparation and application of a collagen combination skin care for skin base repair to solve the above skin problems.

[0005] Collagen repair is one of the important strategies to delay skin aging. External use of skin care products containing collagen or promoting collagen production can help restore skin elasticity and strength. However, most traditional collagen on the market is extracted from animal tissues, which is a complicated process and easily destroys its structure, resulting in loss of active functions. In addition, animal-derived collagen is prone to allergic reactions as an exogenous substance. Further difficulties in collagen extraction and purification increase the production cost of skin care products.

[0006] In addition, laser treatment and microneedle therapy can stimulate the skin's own collagen production, thereby improving the skin's texture and appearance, but they are expensive. They produce obvious effects after a short period of skin repair, but they change the skin barrier and can only be maintained with long-term use.

[0007] Traditional collagen on the market is mostly extracted from animal tissues. There are problems or disadvantages: (1) Complex extraction process: Traditional collagen is mostly extracted from animal tissues. The process is complicated and easily destroys its structure, resulting in loss of active functions. (2) Allergic reactions: Animal-derived collagen may cause allergic reactions or rejection reactions. (3) Poor stability: Collagen has poor stability in skin care products and is easily degraded, affecting the effectiveness of the product. (4) High cost: The cost of extracting and purifying high-quality collagen is high, which increases the production cost of skin care products.

[0008] Therefore, it is necessary to overcome the above technical difficulties: (1) Extraction and purification: How to efficiently extract and purify collagen while maintaining its biological activity is a major technical challenge. (2) Molecular weight control: Different applications require collagen of different molecular weights. How to accurately control its molecular weight is a challenge. (3) Stability improvement: Improving the stability of collagen in skin care products and preventing its degradation are the key points in research and development. (4) Biocompatibility: Ensuring good compatibility between collagen and skin to avoid allergic and rejection reactions. Summary of the invention

[0009] The purpose of the present invention is to address the above-mentioned deficiencies in the prior art. The present invention first provides a collagen composition for skin base repair, which comprises the following components: water, soluble type III collagen, moisturizer, plant extract, allantoin, dipotassium glycyrrhizinate, glycerin, butylene glycol, phenoxyethanol, ethylhexylglycerin, carbomer and triethanolamine.

[0010] In certain embodiments, the humectant comprises hyaluronic acid and 1,2-hexanediol.

[0011] In certain embodiments, the plant extract includes Glycyrrhiza glabra extract and Centella asiatica extract.

[0012] In certain embodiments, it comprises the following components by weight: 1-5% soluble type III collagen, 1-5% hyaluronic acid, 1-2% plant extract, 0.1-0.5% allantoin, 0.2-0.5% dipotassium glycyrrhizinate, 1-5% glycerol, 1-5% butylene glycol, 1-2% 1,2-hexanediol, 0.1-0.5% phenoxyethanol, 0.1-0.5% ethylhexylglycerin, 0.1-0.5% carbomer, 0.1-0.5% triethanolamine, and the balance is water.

[0013] In certain embodiments, it comprises the following components by weight: 1-5% soluble type III collagen, 1-5% hyaluronic acid, 1-2% plant extract, 0.1-0.5% allantoin, 0.2-0.5% dipotassium glycyrrhizinate, 1-5% glycerol, 1-5% butylene glycol, 1-2% 1,2-hexanediol, 0.1-0.5% phenoxyethanol, 0.1-0.5% ethylhexylglycerol, 0.1-0.5% carbomer, 0.1-0.5% triethanolamine, and the balance is water

[0014] The present invention also provides a method for preparing the above-mentioned collagen composition for skin base repair, the method comprising the following steps:

[0015] (1) Heat water to 50-70°C, add carbomer, and stir until completely dissolved;

[0016] (2) adding glycerol, butanediol, and 1,2-hexanediol in sequence and continuing stirring;

[0017] (3) Cooling to 30-40° C., adding soluble collagen, hyaluronic acid, licorice extract, Centella asiatica extract, allantoin and dipotassium glycyrrhizinate, and stirring evenly;

[0018] (4) Add phenoxyethanol and ethylhexylglycerin, stir well, and fill into sterilized bottles.

[0019] In some embodiments, it further comprises the following steps:

[0020] (5) Sealed packaging to avoid contact with light and air to ensure product stability.

[0021] In certain embodiments, the pH value is adjusted to a pH value of 5.5-6.5.

[0022] Finally, the present invention provides application of the collagen composition for skin base repair in skin care, wherein the application is for non-therapeutic purposes.

[0023] In certain embodiments, the application is one or more of supporting skin, moisturizing skin, skin allergy prevention, skin wound recovery, scar reduction, and cosmetic post-operative care.

[0024] Compared with the prior art, the present invention has the following advantages and beneficial effects:

[0025] The type III collagen skin-soothing lotion of the present invention significantly alleviates wrinkles and skin aging problems by adding the type III collagen of the present invention. As an important component in the skin, type III collagen has good water solubility and anti-wrinkle effects, can enhance the elasticity and firmness of the skin, and make the skin look younger and healthier. In addition, the skin-soothing lotion provides excellent moisturizing and hydrating effects through a reasonable ratio of oily and aqueous compositions, helps maintain the moisture balance of the skin, and keeps the skin soft and moisturized. The added plant extracts, hydrolyzed proteins, and minerals not only nourish and repair the skin, but also improve a variety of skin problems, enhance the skin's tolerance, and avoid the increase of skin wrinkles during discontinuation. BRIEF DESCRIPTION OF THE DRAWINGS

[0026] Figure 1 Skin epidermal water loss diagram.

[0027] Figure 2 Skin hemoglobin test chart.

[0028] Figure 3 Skin redness detection chart.

[0029] Figure 4 Figure 1. Collagen cell adhesion assay.

[0030] Figure 5 Skin test chart. DETAILED DESCRIPTION

[0031] In order to make the purpose, technical scheme and advantages of the present invention clearer, the specific embodiments of the present invention are further described in detail below in conjunction with specific examples and drawings. If no specific technology or conditions are specified in the examples, the technology or conditions described in the literature in this field or the product instructions are used. If the manufacturer of the reagents or instruments is not specified, they are all conventional products that can be obtained commercially.

[0032] Example 1: Moisturizing Repair Lotion

[0033] Element:

[0034] Water: Balance

[0035] Soluble type III collagen 1: 1-5%

[0036] The sequence of the recombinant type III collagen used in this example is

[0037] (SEQ ID No.1).

[0038] The preparation process is completed through the CN118184767A scheme.

[0039] Hyaluronic acid: 1-5%

[0040] Licorice extract: 1%

[0041] Centella asiatica extract: 1.2%

[0042] Allantoin: 0.1-0.5%

[0043] Dipotassium glycyrrhizinate: 0.2-0.5%

[0044] Glycerol: 1-5%

[0045] Butanediol: 1-5%

[0046] 1,2-Hexanediol: 1-2%

[0047] Phenoxyethanol: 0.1-0.5%

[0048] Ethylhexylglycerin: 0.1-0.5%

[0049] Carbomer: 0.1-0.5%

[0050] Triethanolamine: 0.1~0.5%

[0051] Preparation method:

[0052] Heat water to 40-70°C, add carbomer, and stir until completely dissolved.

[0053] Add glycerol, butanediol, and 1,2-hexanediol in sequence and continue stirring.

[0054] Cool down to 40°C, add soluble collagen, hyaluronic acid, licorice extract, Centella asiatica extract, allantoin and dipotassium glycyrrhizinate, and stir well.

[0055] Finally add phenoxyethanol and ethylhexylglycerin and mix well.

[0056] Adjust pH to 5.5-6.5 and fill into sterilized bottles.

[0057] Embodiment 2:

[0058] Water: Balance

[0059] Soluble type III collagen 2: 1-5%

[0060] The sequence of the recombinant type III collagen used in this example is

[0061] GLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGA NGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMPGLMGARGPPGPAGANGAPGLRGGAGEPGKNGAKGEPGPRGERGEAGIPGVPGAKGEDGKDGSPGEPGANGLPGAAGERGAPGFRGPAGPNGIPGEKGPAGERGAPGPAGPRGAAGEPGRDGVPGGPGMRGMP(SEQ ID No.2).

[0062] The other steps are the same as in Example 1.

[0063] Hyaluronic acid: 1-5%

[0064] Licorice extract: 1%

[0065] Centella asiatica extract: 1.2%

[0066] Allantoin: 0.1-0.5%

[0067] Dipotassium glycyrrhizinate: 0.2-0.5%

[0068] Glycerol: 1-5%

[0069] Butanediol: 1-5%

[0070] 1,2-Hexanediol: 1-2%

[0071] Phenoxyethanol: 0.1-0.5%

[0072] Ethylhexylglycerin: 0.1-0.5%

[0073] Carbomer: 0.1-0.5%

[0074] Triethanolamine: 0.1~0.5%

[0075] Embodiment 3:

[0076] Water: Balance

[0077] Soluble type III collagen 3: 1-5%

[0078] The sequence of the recombinant type III collagen used in this example is

[0079] GPPGIKGPAGIPGFPGMKGHRGFDGRNGEKGETGAPGLKGENGLPGENGAPGPMGPRGAPGERGRPGLPGAAGARGNDGARGSDGQPGPPGPPGTAGFPGSPGAKGEVGPAGSPGSNGAPGQRGEPGPQGHAGAQGPPGPPGINGPLGIAGITGA RGLAGPPGMPGPRGSPGPQGVKGESGKPGANGLSGERGPPGPQGLPGLAGTAGEPGRDGNPGSDGLPGRDGSPGKGDRGENGSPGAPGAPGHPGPPGPVGPAGKSGDRGESGPAGPAGAPGPAGSRGAPGPQGPRGDKGETGERGAAGIK(SEQ ID No. 3).

[0080] The other steps are the same as in Example 1.

[0081] Hyaluronic acid: 1-5%

[0082] Licorice extract: 1%

[0083] Centella asiatica extract: 1.2%

[0084] Allantoin: 0.1-0.5%

[0085] Dipotassium glycyrrhizinate: 0.2-0.5%

[0086] Glycerol: 1-5%

[0087] Butanediol: 1-5%

[0088] 1,2-Hexanediol: 1-2%

[0089] Phenoxyethanol: 0.1-0.5%

[0090] Ethylhexylglycerin: 0.1-0.5%

[0091] Carbomer: 0.1-0.5%

[0092] Triethanolamine: 0.1~0.5%

[0093] Example 4. Safety Assessment:

[0094] Skin reactions Grading DAY28 No response 0 31 cases Faint erythema 1 0 cases Erythema, infiltration, papules 2 0 cases Erythema, edema, papules, blisters 3 0 cases Erythema, edema, bullae 4 0 cases

[0095] 31 test subjects used the test products as required within 28 days, and no adverse skin reactions were observed during the test according to the skin reaction grading standards for human trial tests specified in the 2015 edition of the "Technical Specifications for Safety of Cosmetics".

[0096] Examples 1-3 Skin water loss: 31 subjects used the test product as required within 28 days to detect their skin water loss. The water loss value 28 days after using the sample was significantly reduced compared with that before using the sample (****P<0.001). The less the skin water loss, the better the skin barrier function and the stronger the tolerance. The results are shown in Figure 1 .

[0097] Examples 1-3 Skin hemoglobin detection: 31 subjects used the test product as required within 28 days, and their skin hemoglobin was detected. The skin hemoglobin value 28 days after using the sample was significantly lower than that before using the sample, proving that the product has a soothing effect on skin erythema. The results are shown in Figure 2 28 days after using the sample, the skin hemoglobin value decreased significantly compared with before using the sample (0.01<*P<0.05, 0.001<**P<0.01, ****P<0.001), and the skin erythema was effectively relieved.

[0098] Examples 1-3 Skin redness value detection: 31 subjects used the test product as required within 28 days to detect their skin redness. The skin redness value 28 days after using the sample was significantly reduced compared with that before using the sample, and the skin redness was well alleviated. The results are shown in Figure 3 and see Figure 5 28 days after using the sample, the skin redness value decreased significantly compared with before using the sample (0.01<*P<0.05, 0.001<**P<0.01, ****P<0.001), and the skin redness improved well.

[0099] Collagen cell adhesion experiments used in Examples 1 to 3:

[0100] Fibroblasts were cultured in a cell culture medium supplemented with 10% (v / v) fetal bovine serum (FBS, Cytivia) in an atmosphere of 5% carbon dioxide at 37°C.

[0101] 1) Hydrate 96-well plate: Recombinant human collagen of Examples 1 to 3 was prepared at 20, 50, 100, 200, and 500 μg / mL, and 50 μL of the solution was placed in a 96-well plate, with 3 replicates per group, and hydrated overnight and air-dried. Prepare 1% BSA (autoclaved). Add 200 μL of 1% BSA to each well and place in a 37°C incubator for 2 hours to block the protein.

[0102] 2) Prepare cell suspension: First, starve the cells for 12 to 24 hours to further remove the effects of serum. Digest the cells, centrifuge and discard the culture medium after terminating the digestion, wash 1 to 2 times with PBS, and resuspend in serum-free medium. Adjust the cell density to 5×10 5 Pieces / ml.

[0103] 3) Seeding cells: 8×10 3 / well, added 100 μL of basal culture medium to each group, and then placed in the incubator for incubation for 1 hour.

[0104] 4) Remove the supernatant, stain with 0.1% crystal violet for 20 minutes, observe the cells under a microscope, count the cells, calculate the average value, and perform statistical analysis.

[0105] According to the results, within 1 hour, Example 3 has a significant adhesion effect on skin cells, indicating that collagen can promote skin cell proliferation, regulate cell adhesion and signal transduction between cells and the extracellular matrix, and help restore skin elasticity. Figure 4 .

[0106] The above description is only a preferred embodiment of the present invention and is not intended to limit the present invention. Any modifications, equivalent substitutions, improvements, etc. made within the spirit and principle of the present invention should be included in the protection scope of the present invention.

Claims

1. A collagen composition for skin base repair, characterized in that: It includes the following ingredients: water, soluble type III collagen, moisturizer, plant extract, allantoin, dipotassium glycyrrhizinate, glycerin, butylene glycol, phenoxyethanol, ethylhexylglycerin, carbomer and triethanolamine.

2. The collagen composition for skin base repair according to claim 1, characterized in that: The moisturizers include hyaluronic acid and 1,2-hexanediol.

3. The collagen composition for skin base repair according to claim 1, characterized in that: The plant extracts include Glycyrrhiza glabra extract and Centella asiatica extract.

4. The collagen composition for skin base repair according to claim 1, characterized in that: The invention comprises the following components by weight: 1-5% soluble type III collagen, 1-5% hyaluronic acid, 1-2% plant extract, 0.1-0.5% allantoin, 0.2-0.5% dipotassium glycyrrhizinate, 1-5% glycerol, 1-5% butylene glycol, 1-2% 1,2-hexanediol, 0.1-0.5% phenoxyethanol, 0.1-0.5% ethylhexylglycerol, 0.1-0.5% carbomer, 0.1-0.5% triethanolamine, and the balance is water.

5. The collagen composition for skin base repair according to claim 4, characterized in that: The invention comprises the following components by weight: 1-5% soluble type III collagen, 1-5% hyaluronic acid, 1-2% plant extract, 0.1-0.5% allantoin, 0.2-0.5% dipotassium glycyrrhizinate, 1-5% glycerol, 1-5% butylene glycol, 1-2% 1,2-hexanediol, 0.1-0.5% phenoxyethanol, 0.1-0.5% ethylhexylglycerol, 0.1-0.5% carbomer, 0.1-0.5% triethanolamine, and the balance is water.

6. A method for preparing a collagen composition for skin base repair according to any one of claims 1 to 5, characterized in that: The method comprises the following steps: (1) Heat water to 60°C, add carbomer, and stir until completely dissolved; (2) adding glycerol, butanediol, and 1,2-hexanediol in sequence and continuing stirring; (3) cooling to 40° C., adding soluble collagen, hyaluronic acid, licorice extract, Centella asiatica extract, allantoin and dipotassium glycyrrhizinate, and stirring evenly; (4) Add phenoxyethanol and ethylhexylglycerin, stir well, and fill into sterilized bottles.

7. The method for preparing the collagen composition for skin base repair according to claim 6, characterized in that: It also includes the following steps: (5) Sealed packaging to avoid contact with light and air to ensure product stability.

8. The method for preparing the collagen composition for skin base repair according to claim 6, characterized in that: The pH value is adjusted to 5.5-6.

5.

9. Use of the collagen composition for skin base repair according to any one of claims 1 to 5 in skin care, wherein the use is for non-therapeutic purposes.

10. The use according to claim 9, characterized in that: The application is one or more of supporting skin, moisturizing skin, anti-allergic skin, skin wound recovery, reducing scars, and cosmetic post-operative care.

Images