Fusion protein and novel application thereof in modification of particle powder

Abstract

The invention relates to the field of protein, in particular to fusion protein formed by fusion expression of pichia pastoris sourced mucoprotein and a silicon binding tag and application of the fusion protein in modification of particle powder. The fusion protein has a good combination effect with cosmetic powder raw materials such as silicon dioxide, titanium dioxide, zinc oxide and the like, mucoprotein and powder are organically combined by combining labels, the system compatibility and suspension dispersion stability of the powder raw materials can be remarkably enhanced, and meanwhile the particle powder is endowed with the moisturizing performance and the like; and when the composition is further applied to a physical sun-screening agent, the moisturizing and clear performance of the skin feeling of the sun-screening agent is enhanced, the defects of whitening, powder blocking and difficult smearing of the physical sun-screening agent are overcome, and the use feeling of the sun-screening agent is improved.

Description

Technical Field

[0001] The invention belongs to the field of protein application, and relates to a fusion protein formed by mucin and a silicon binding tag and a new application thereof in particle powder modification. Background Art

[0002] At present, powder raw materials are increasingly used in cosmetics, such as pigment powder, white powder, physical powder and pearl powder, and their applications in skin care, makeup, oral care and other fields are already very mature. Among them, white powder has the functions of covering, whitening and blocking ultraviolet rays, and physical powder includes three categories: inorganic powder, organic powder and natural powder, which can effectively improve the skin feel of cosmetics.

[0003] Silicon products in inorganic powders are widely used and can be added to almost every product in skin care and makeup. There are two general categories of "silicon" in cosmetics, namely silicon dioxide and various polysiloxane polymer compounds. The main function of polysiloxane in skin care products and cosmetics is to act as a softener and film former. Moreover, its ingredients are safe, low in allergenicity, and will not be absorbed by the skin. Silicon dioxide is a typical inorganic substance. Quartz and clay, which are often mentioned, all have silicon dioxide as an important component. Silicon dioxide often acts as a sustained-release ingredient in skin care products and cosmetics. Due to its large specific surface area, it can absorb the functional ingredients and then slowly release them, increasing the stability of the active ingredients; in addition, silicon dioxide also has a slight concealing power, which can increase the smoothness of the skin, and is very suitable for adding to foundation, isolation and other base makeup. However, silicon also has disadvantages. Silicon is insoluble in water, and its dispersibility and ductility in skin care products and cosmetics need to be improved. Secondly, if you have oily skin, using silicone-containing products can easily clog your pores. Excessive use may irritate the skin and cause inflammation, which is not conducive to skin health and maintenance. Silicon-containing products can also rub the skin, damage the stratum corneum, accelerate pigmentation and cell aging, and cause skin sensitivity.

[0004] Titanium dioxide and zinc oxide in white powder often appear in cosmetics as the main ingredients of physical sunscreens. The sunscreen mechanism of physical sunscreens is related to the size of its powder particles. When the particle size is large (pigment level), the sunscreen mechanism is a simple covering effect. This type of powder forms a covering layer on the skin surface, reflecting or scattering the ultraviolet rays irradiated on the skin surface, thereby reducing the ultraviolet content entering the skin. It is also called an ultraviolet shielding agent and has a weak sunscreen effect. However, as the powder particle size decreases, the reflection and scattering ability of this type of sunscreen to ultraviolet rays decreases, while the absorption of UVB is significantly enhanced. When the particle size is as small as nanometers, the sunscreen mechanism is that it can reflect and scatter UVA and absorb UVB, and the sunscreen effect is strong. Although titanium dioxide and zinc oxide have the advantages of strong sunscreen ability and good transparency, they also have the disadvantages of easy agglomeration, poor dispersibility, poor adsorption and air permeability, easy generation of free radicals while absorbing ultraviolet rays, photocatalytic and irritating to the skin, and easy clogging of pores, which affect the user's skin feel.

[0005] Since most powders have poor dispersibility in the system and there is an "inorganic / organic" incompatibility, when untreated powders are added to foundation or other systems, there are many problems such as large oil absorption and interfacial voids, which lead to self-agglomeration of powders and changes in formula viscosity after long-term storage, thus affecting the fineness, storage performance, skin feel, etc. of the final cosmetic formula. Therefore, we can change the surface properties of powders and optimize the touch of powders through some means. Without affecting the effect of powders, we strive to find some mild skin care ingredients to synergize, solve the problems of existing products, reduce the irritation and uncomfortable skin feel caused by powder-containing cosmetics and skin care products, and develop more gentle and effective high-tech multifunctional cosmetics and skin care products.

[0006] Mucin, also known as mucin, is a type of highly glycosylated high molecular weight protein. The special structure of mucin gives it a variety of functional properties. Mucin is mainly composed of a protein core and polysaccharide branches. The hydrophobic ends at both ends allow it to bind to the hydrophobic surface. The high-density polysaccharide region plays an important role in mucin hydration and lubrication. At the same time, mucins can form disulfide bonds through the cysteine-rich regions at both ends, thereby forming a mucin network. Studies have shown that the mucin network can form a protective barrier, reduce the infection of bacteria and external substances, and thus play a role in sterilization and anti-inflammatory. At the same time, the mucin network can also prevent water evaporation and has the effect of locking water, moisturizing and lubricating. At present, mucin has a place in skin care products as the main ingredient for moisturizing and anti-wrinkle, but it is still blank in powder modification.

[0007] Silicon products are the most widely used in granular powders, including silicon-modified titanium dioxide or zinc dioxide granular powders, which are often used as physical sunscreen raw materials. In 2007, Koji Taniguchi et al. disclosed a silica-binding tag Si-tag, which can tightly bind functional proteins to silica particles and fix them on the surface of granular silica (Taniguchi K, Nomura K, Hata Y, et al. The Si-tag for immobilizing proteins on a silica surface [J]. John Wiley & Sons, Inc. 2007 (6).). In 2014, Mohamed AAAbdelhamid et al. verified a new Si-binding peptide with a shorter sequence and superior binding performance. (Mohamed AAAbdelhamid, et al. Affinity purification of recombinant proteins using a novel silica-binding peptide as a fusion tag [J]. Appl Microbiol Biotechnol (2014) 98: 5677–5684). It is worth exploring whether fusing mucin with a silicon-binding tag (Si-tag) and combining it with granular powders can improve some existing problems of powders (poor water solubility, easy agglomeration, poor dispersibility, skin discomfort, etc.) and give granular powders more performance and efficacy. Summary of the invention

[0008] The purpose of the present invention is to seek a new method for modifying and modifying granular powders, to overcome the phenomenon that existing powders are easy to self-aggregate, have poor dispersibility and poor skin feel, to provide a new fusion protein combined with granular powders, to give the granular powders new functional properties, and at the same time to improve the compatibility and dispersibility of the powder system, and to further apply it to physical sunscreens to enhance the moisturizing and clear skin feel of the sunscreens, to overcome the shortcomings of physical sunscreens such as whitening, powder sticking and difficulty in application, and to enhance the user's skin feel experience.

[0009] The present invention provides a fusion protein, which is obtained by fusion of mucin and a silicon-binding peptide, wherein the amino acid sequence of the mucin is shown in SEQ ID NO: 1 and SEQ ID NO: 3.

[0010] Preferably, the silicon-binding peptides known in the prior art are applicable to the present invention, such as those disclosed in US20090098164A1 and US20180327448A1, but preferably the amino acid sequence of the silicon-binding peptide is as shown in SEQ ID NO: 5 or SEQ ID NO: 11.

[0011] The present invention provides a nucleic acid encoding the fusion protein.

[0012] The present invention provides the use of the fusion protein in modifying granular powders, increasing the moisturizing effect of powders, or improving the dispersion uniformity of powders or system compatibility. Specifically, it is used in the production of granular powders with moisturizing requirements, or in the production of granular powders with high dispersion requirements, or in the preparation of granular powder systems with high dispersion uniformity requirements;

[0013] Preferably, the production of granular powder with moisturizing requirements includes powders of one or more of silicon dioxide, titanium dioxide and zinc oxide;

[0014] More specifically, the products with moisturizing requirements are sunscreens, foundations, loose powder makeup, especially physical sunscreens, specifically products in the field of personal care, such as cosmetics, base makeup, and color makeup.

[0015] The present invention provides use of the fusion protein in improving the moisturizing effect of a product with moisturizing requirements.

[0016] Preferably, the product with moisturizing claim contains a powder component. More preferably, the product with moisturizing claim contains a powder composed of one or more of silicon dioxide, titanium dioxide and zinc oxide.

[0017] Specifically, the product with moisturizing claim is a sunscreen, especially a physical sunscreen.

[0018] The present invention also provides use of the fusion protein in preparing products with moisturizing requirements.

[0019] Specifically, the product with moisturizing requirements contains a powder component, preferably, it contains powder of one or more of silicon dioxide, titanium dioxide and zinc oxide.

[0020] Preferably, the product with moisturizing claim is a sunscreen, especially a physical sunscreen.

[0021] Wherein, the mucin sequence of the present invention is (SEQ ID NO: 1 and SEQ ID NO: 3), preferably SEQ ID NO: 3.

[0022] The two silicon-binding peptide sequences of the present invention are:

[0023] Si-tag-1 (SEQ ID NO: 5):

[0024] MAVVKCKPTSPGRRHVVKVVNPELHKGKPFAPLLEKNSKSGGRNNNGRITTRHIGGGHKQVLGKAGAARWRGV RPTVRGTAMNPVDHPHGGGEGRNFGKHPVTPWGVQTKGKKTRSNKRTDKFIVRRRSK.

[0025] Si-tag-2 (SEQ ID NO: 11): GRARAQRQSSRGR.

[0026] Beneficial effects of the present invention: The fusion protein provided by the present invention can increase the efficacy of the powder, such as moisturizing performance, high dispersibility and high system compatibility, etc., and is more conducive to the uniformity and stability of the system during product configuration and application. Specifically as follows: The composition system obtained by organically combining the fusion protein provided by the present invention with the powder has better compatibility and higher dispersibility; the fusion protein provided by the present invention can enhance the use experience of the physical sunscreen, making it easier to apply, refreshing and non-greasy, and significantly improving its shortcomings such as whitening and powder sticking.

[0027] The downstream application of the present invention can be used for the production of granular powders, and the modification and improvement can give the powders more functional properties; it can also be used in personal care fields such as sunscreen foundation, makeup, etc. to enhance moisturizing, and improve problems such as uneven application of powder products, dryness and greasiness, and unnatural skin color. BRIEF DESCRIPTION OF THE DRAWINGS

[0028] Figure 1 : SDS-PAGE electrophoresis of the purified fusion protein. In figure a, M: Marker; 1: MS2-2-Si-tag-1 fusion protein; 2: MS2-2-Si-tag-2 fusion protein; in figure b, M: Marker; 1: MS2-1-Si-tag-1 fusion protein; 2: MS2-1-Si-tag-2 fusion protein;

[0029] Figure 2 :The binding of fusion protein to powder. Wherein, M: Marker; 1: Mucin-Si-tag-1 fusion protein; 2-4: The supernatant after the binding of mucin-Si-tag-1 fusion protein with silica, titanium dioxide, and zinc oxide; 5: Mucin-Si-tag-2 fusion protein; 6-8: The supernatant after the binding of mucin-Si-tag-2 fusion protein with silica, titanium dioxide, and zinc oxide.

[0030] Figure 3 : Sedimentation curve after fusion protein combined with powder.

[0031] Figure 4 : Microscope observation diagram.

[0032] Figure 5 : Water loss rate of powder and composition.

[0033] Figure 6 : Skin feel test. Among them, A1, A2-0.5% fusion protein + sunscreen; B1, B2-sunscreen.

[0034] Figure 7 : Sunscreen moisturizing performance test. DETAILED DESCRIPTION

[0035] The present invention is further described below through specific examples in order to better understand the present invention, but does not constitute a limitation of the present invention.

[0036] Example 1: Construction, expression and purification of mucin-Si-tag fusion protein

[0037] 1) Expression of mucin-Si-tag fusion protein

[0038] In the early stage, our laboratory obtained three mucin expression genes through Pichia pastoris genome amplification, which were different from the original mucin NC_012964.1 (1916362..1918881) sequence and were named MS1-2, MS2-1 and MS2-2, respectively, with moisturizing properties. Due to the low expression level of MS1-2, this example selected MS2-1 (amino acid sequence SEQ ID NO: 1, nucleotide sequence SEQ ID NO: 2) and MS2-2 (amino acid sequence SEQ ID NO: 3, nucleotide sequence SEQ ID NO: 4) mucin genes as research objects;

[0039] First, the long Si-tag-1 tag (amino acid sequence SEQ ID NO: 5, nucleotide sequence SEQ ID NO: 6) was synthesized and cloned into pPIC9K(+) according to the Pichia codon optimization whole gene; then, the recombinant primers were designed by GS linker and amplified and cloned into the MS2-1 and MS2-2 expression vectors pPIC9K(+) respectively to obtain the MS2-1-Si-tag-1 fusion protein (amino acid sequence SEQ ID NO: 7, nucleotide sequence SEQ ID NO: 8) expression vector and the MS2-2-Si-tag-1 fusion protein (SEQ ID NO: 9, nucleotide sequence SEQ ID NO: 10) expression vector.

[0040] For the shorter Si-tag-2 tag (amino acid sequence SEQ ID NO: 11, nucleotide sequence SEQ ID NO: 12), it was directly amplified and cloned into the MS2-1 and MS2-2 expression vectors pPIC9K(+) by designing recombinant primers to obtain the MS2-1-Si-tag-2 short peptide fusion protein (amino acid sequence SEQ ID NO: 13, nucleotide sequence SEQ ID NO: 14) expression vector and the MS2-2-Si-tag-2 short peptide fusion protein (SEQ ID NO: 15, nucleotide sequence SEQ ID NO: 16) expression vector.

[0041] The above expression was linearized by SalI and then electroporated into Pichia pastoris GS115 competent cells. High-copy single clones were screened using 2 mg / mL G418.

[0042] The high-copy transformants obtained by screening were inoculated into BMGY medium and cultured at 30°C and 220 rpm until OD 600 = 2, the cells were collected, washed three times with BMMY medium, resuspended, and cultured at 30°C and 220 rpm for fermentation expression.

[0043] 2) Purification of fusion protein

[0044] The fermentation broth was centrifuged at 5000rpm for 10 minutes, and the fermentation supernatant was collected. The ethanol precooled at 4°C was mixed with the fermentation supernatant in a volume ratio of 2:3, and then placed at 4°C for 2 hours until the precipitate automatically settled and became solid, and then centrifuged at 4°C and 10000rpm for 15 minutes, and the precipitate was retained as the cold ethanol precipitation product. The cold ethanol precipitation product was resuspended in pH 6.0, 20mM Bis-Tris-HCl buffer, and filtered through a 0.45μm microporous filter to remove impurities. The treated sample was purified using an anion mixing method, and the results after purification were as follows Figure 1 As shown: after MS2-2 was fused with different Si tags, the protein purity was greater than 85%, and the bands were clear; after MS2-1 was fused with the long tag Si-tag, the protein was suspected to be degraded, with mixed bands, and the purity was lower than that of the MS2-2 fusion protein. After fusion with the short tag, the effect was relatively good. In order to ensure the accuracy and consistency of subsequent evaluations and exclude other interferences, we selected the MS2-2-Si-tag fusion protein for research and evaluation. Finally, the purified components of the MS2-2 fusion protein were lyophilized to obtain two fusion protein lyophilized powders.

[0045] Example 2: Verification of the binding performance of fusion protein and granular powder

[0046] 3 g of silicon dioxide, titanium dioxide and zinc oxide were weighed respectively, washed twice with pH 7.5, 20 mM Tris-HCl buffer, and then fixed to 30 mL to obtain a mother solution with a final concentration of 10%, which was placed at 4°C for later use.

[0047] Take 10 mL of the mother solution, add 50 mg of the two fusion proteins respectively, mix well and let stand at room temperature for 1 hour, and use the blank control without adding fusion protein. After centrifugation, take the supernatant for SDS-PAGE analysis.

[0048] This study used two Si-tag binding tags and tested their binding effects. Figure 2 As shown, both fusion proteins bind to the above-mentioned particle powder, but the binding efficiency of the protein expressed by Si-tag-1 is relatively poor, and there is still a small amount of unbound protein in the supernatant, while there is no band in the supernatant after binding with the protein expressed by Si-tag-2, which proves that the fusion protein is completely bound to the powder and has a high binding efficiency. Subsequent studies will be conducted on proteins expressed by Si-tag-2 fusion and mucin.

[0049] Example 3: Compatibility test of fusion protein and particle powder complex system

[0050] At present, the methods for measuring the stability of nanoparticles in a medium mainly include sedimentation observation method, weighing method, etc. The sedimentation observation method mainly judges the stability by taking pictures of the suspension at different times and according to the trend of the layer height changing over time. However, this method is not suitable for measuring samples with unclear stratification. The weighing method refers to calculating the concentration of nanoparticles by drying part of the suspension and measuring the mass of the solid nanoparticles contained therein. Although this method is simple to operate, the calculated data often has large errors. The present invention draws a sedimentation curve by ultraviolet visible absorption spectrophotometry, which can effectively measure the sedimentation of powder particles in a medium.

[0051] The system in Example 2 was ultrasonically dispersed for 10 minutes to obtain a uniformly dispersed suspension. 3 mL was taken and placed in a cuvette. The UV-visible absorbance at 600 nm was measured at regular intervals and a sedimentation curve was plotted (as shown in FIG. Figure 3 The curve chart can be used to visually determine the speed of the powder sedimentation in the system.

[0052] The results showed that compared with the blank control, the sedimentation rate of the powder in the system after combining with the fusion protein was slower. The reason for the analysis was that the powder surface was combined with mucin, and mucin had good water solubility due to sugar chains, which was equivalent to forming a layer of "water film" on the surface of the particles, so that the powder had better compatibility in the solution system, high dispersibility, and more stability in the medium; while the blank control was not wrapped with a "water film", the system compatibility was poor, resulting in a fast sedimentation rate; the above results also show that the combination of the fusion protein formed by mucin-Si-tag and the particle powder can modify and enhance the hydrophilicity of the powder and increase the compatibility of the solution system.

[0053] Example 4: Detection of the dispersion of the fusion protein and particle powder complex

[0054] In order to further evaluate the effect of fusion protein on the compatibility, dispersibility and stability of particle powder system, nanoparticles of titanium dioxide and zinc oxide were used as research targets to test and observe their dispersibility in solution system. The specific method is as follows:

[0055] 1. Electron Microscope Observation

[0056] Since the powder has a large specific surface area and surface energy, it is easy for the powder to condense and agglomerate during the preparation and post-processing process, and lose the original excellent properties of the powder. The dispersion of the individual powders and the composite was preliminarily observed using an electron microscope.

[0057] Titanium dioxide and zinc oxide liquids were prepared according to the steps in Example 2 and combined with the fusion protein.

[0058] The system in Example 1 was ultrasonically dispersed for 10 minutes to obtain a uniformly dispersed suspension, which was diluted to a certain multiple with pure water, and 10 μL of the resuspension was placed on a glass slide and observed using an electron microscope.

[0059] The results show (such as Figure 4 As shown in the figure, the titanium dioxide and zinc oxide powders alone are seriously agglomerated and unevenly dispersed in the medium system, while the powders combined with the fusion protein are evenly distributed. This further shows that the powder dispersion is significantly improved after the fusion protein is combined with the particle powder.

[0060] 2. Dynamic Light Scattering

[0061] The particle size was further measured using dynamic light scattering. Dynamic light scattering (DLS) is a mature non-invasive technology that can measure the particle size and particle size distribution of molecules and particles in the submicron range. By measuring the particle size, the dispersion of the powder in the system can be determined. The particle size of the above system was measured using dynamic light scattering (DLS), with the single powder as a blank control. The particle size results are shown in Table 1.

[0062] Table 1: Powder particle size

[0063] <![CDATA[TiO2]]> <![CDATA[TiO2 - fusion protein]]> ZnO ZnO-fusion protein Particle size (nm) 124.3 46.3 571.9 26.4

[0064] The results show that the particle size of TiO2 and ZnO granules in the system is relatively large, which is very different from the theoretical powder particle size (about 30nm for TiO2 and ZnO); this indicates that individual granules tend to aggregate in the system to form large granule aggregates; while the particle size of TiO2 and ZnO granules combined with fusion protein is smaller in the solvent system, and is consistent with the theoretical powder particle size, without aggregation, and has good dispersibility. The above results indicate that the combination of the fusion protein formed by mucin-Si-tag and granule powder can improve the dispersibility of powder in the system and avoid particle aggregation.

[0065] We further analyzed the reasons: the powder surface is combined with mucin, and the powders are isolated by mucin, which affects the van der Waals force and electrostatic interaction between the powders and prevents re-aggregation. On the other hand, mucin has water absorption and hydrophilicity, which can make the air on the surface of the water-insoluble powder be replaced by water, thus having good wettability and further improving the dispersibility of the powder in the water phase system.

[0066] Example 5: Moisturizing performance test of fusion protein and granular powder complex

[0067] The fusion protein and powder complex and the powder alone were used as the research objects, and the water loss rate under certain conditions was tested to evaluate the moisturizing performance. First, the water loss of the fusion protein and powder complex and the powder alone was tested at a temperature of 20°C and a humidity of 47%. The water loss rate was tested for 2 hours, 4 hours, 8 hours and 24 hours respectively. The results are shown in Figure 5 .

[0068] The results in the figure show that the water loss rate data within 8 hours can clearly show the advantages of the fusion protein. After combining with the fusion protein, the water loss rate of the granular powder is lower than that of the single powder, and the moisturizing performance is better; among them, the ZnO effect is the most significant, indicating that after the granular powder is combined with the moisturizing protein, the granular powder is endowed with the moisturizing properties of mucin, which increases the efficacy of the granular powder and has a good application prospect.

[0069] Example 6: Practical application test of fusion protein and particle powder complex in sunscreen

[0070] The combination of fusion protein and granular powder raw materials has significantly improved the compatibility, dispersibility and moisturizing performance of the system. In order to further verify its application value, we added the granular powder complex combined with fusion protein (referred to as sample) and the granular powder not combined with mucin (referred to as control) into the formula to prepare physical sunscreen (the granular powder is titanium dioxide and zinc oxide), carried out human efficacy tests, and evaluated its skin feel and moisturizing properties, as follows.

[0071] 1. Skin feel

[0072] In order to illustrate the effect of fusion protein on the whitening effect of physical sunscreen, we recruited volunteers and drew two equal-sized areas on the corresponding positions of the volunteers' skin. Before the experiment, the area was cleaned with a cleaning product and then wiped dry with a cotton cloth. 0.1mL of the test liquid (A-0.5% fusion protein + sunscreen; B-sunscreen) was applied to the marked area respectively, and rubbed into the skin with the same pressure and speed through one finger for 15 seconds.

[0073] Photos taken ( Figure 6 ) shows the residual whitening of the formula left on the skin surface compared to the laboratory-made composition containing mucin and physical sunscreen. It can be seen intuitively from the figure that after adding mucin, the residual whitening of the sunscreen is less, the powdery feeling is weakened, and the degree of powder stuck in pores and fine lines is also reduced.

[0074] 2. Moisturizing

[0075] The physical sunscreen and the composition were applied to the human body using the above method, and the moisture content was detected using a moisture tester at regular intervals. The sunscreen without mucin was used as the control group, and no product was applied as the blank group.

[0076] The average moisture growth value in each time period is as follows Figure 7 As shown in (a), the water growth value of the sample group in each time period was significantly better than that of the control group and the blank group, and the water growth values ​​of the sample group and the control group were significantly better than those of the blank group; the water growth of the sample group and the blank group reached a peak at the 4th hour, and the control group reached a peak at the 2nd hour;

[0077] The average increase in overall moisture in 4 hours is as follows Figure 7 As shown in (b), the moisture growth value of the sample group within 4 hours was significantly better than that of the control group and the blank group; the sample group and the control product had significant moisturizing effects, and the moisturizing effect of the sample group was significantly better than that of the control group. The moisturizing performance of the three: sample group > control group > blank group.

Claims

1. A fusion protein, comprising a fusion of a mucin and a silicon-binding peptide, wherein the amino acid sequence of the mucin is shown in SEQ ID NO: 1 or SEQ ID NO:

3.

2. The fusion protein according to claim 1, characterized in that The amino acid sequence of the silicon-binding peptide is shown in SEQ ID NO: 5 or SEQ ID NO: 11; Preferably, the amino acid sequence of the fusion protein is shown in SEQ ID NO: 7, SEQ ID NO: 9, SEQ ID NO: 13 or the amino acid sequence of SEQ ID NO:

15.

3. The nucleic acid encoding the fusion protein according to claim 1 or 2, wherein the nucleotide sequence of the silicon-binding peptide is as shown in SEQ ID NO: 6 or SEQ ID NO: 12; The nucleotide sequence of the mucin is shown in SEQ ID NO: 2 or SEQ ID NO: 4; More preferably, the nucleotide sequence of the fusion protein is shown in SEQ ID NO: 8, SEQ ID NO: 10, SEQ ID NO: 14 or the amino acid sequence is shown in SEQ ID NO:

16.

4. Use of the fusion protein as claimed in claim 1 or 2 in modifying granular powders, increasing the moisturizing effect of powders, or improving the dispersion uniformity of powders or the compatibility of the system.

5. The use according to claim 4, characterized in that It is used in the production of granular powders with moisturizing requirements, or in the production of granular powders with high dispersibility requirements, or in the preparation of granular powder systems with high dispersibility and uniformity requirements.

6. The use according to claim 5, characterized in that The production of the granular powder with moisturizing requirements includes powder of one or more of silicon dioxide, titanium dioxide and zinc oxide.

7. The use according to claim 5, characterized in that The products with moisturizing requirements are sunscreens, foundations, loose powder makeup, especially physical sunscreens, specifically products in the personal care field, such as cosmetics, base makeup, and makeup.

8. Use of the fusion protein as claimed in claim 1 or 2 in preparing a product having a moisturizing requirement.

9. The use according to claim 8, characterized in that The product with moisturizing requirements contains a powder component, preferably, it contains a powder of one or more of silicon dioxide, titanium dioxide and zinc oxide.

10. The use according to claim 9, characterized in that: The product with moisturizing claim is a sunscreen, especially a physical sunscreen.

Images