Aminoacyl-tRNA synthetase that efficiently introduces lysine derivatives

Abstract

To provide a mutant lysyl-tRNA synthetase that has a deletion at one or more sites selected from the group corresponding to the amino acid sequence of wild-type aminoacyl-tRNA synthetase: 102nd, 128th-140th, and 159th-179th amino acid residues.SOLUTION: Compared with wild-type lysyl-tRNA synthetase, the mutant lysyl-tRNA synthetase according to the present invention has high activity, a high level of expression and good solubility, and may significantly increase the amount of inserted unnatural amino acid and the expression level of target protein including unnatural amino acid.SELECTED DRAWING: None

Description

[Technical field]

[0001] The present invention relates to the field of biotechnology, and in particular to aminoacyl-tRNA synthetases that efficiently introduce lysine derivatives. [Background technology]

[0002] Unnatural amino acid-incorporated proteins (whole proteins), obtained by replacing amino acid residues at desired positions in proteins with amino acids other than the 20 types (unnatural amino acids) involved in normal protein synthesis, can be an effective tool for analyzing protein structure and function. More than 30 kinds of whole proteins have been synthesized using aminoacyl-tRNA synthetase (aaRS) / tRNA pairs derived from various organisms. The system with the longest history and applicable to the introduction of various useful unnatural amino acids is a tyrosyl-tRNA synthetase (TyrRS) mutant and an amber-inhibited genetically modified tRNA. Tyr As for the method in question, the important thing is their orthogonal relationship, i.e., the aaRSs of the two groups, eubacteria and archaea and eukaryotes, can acylate the amino group of tRNA in their respective groups, but cannot acylate the amino group of tRNA in the other group.

[0003] On the other hand, pyrrolysyl-tRNA synthetase (PylRS) from Methanosarcina mazei and the amber inhibitor gene tRNAPyl function as an orthogonal aaRS / tRNA pair in Escherichia coli cells. Pyrrolysine is a lysine derivative with a bulky methylpyrroline moiety in the side chain. Wild-type PylRS can bind Nε-Boc-L-lysine to tRNAPyl in E. coli. However, because LysRS strictly discriminates between lysines, it has been difficult to specifically introduce lysine derivative moieties with functional groups of various sizes and shapes into proteins.

[0004] Thus, there is a need in the art to develop aminoacyl-tRNA synthetases that modify wild-type lysyl-tRNA synthetases to efficiently introduce lysine derivatives into proteins. Summary of the Invention [Problem to be solved by the invention]

[0005] It is an object of the present invention to provide aminoacyl-tRNA synthetases and methods for efficiently introducing lysine derivatives into proteins. [Means for solving the problem]

[0006] A first aspect of the present invention provides a mutant protein of an aminoacyl-tRNA synthetase, wherein the mutant protein is deleted at one or more sites selected from the group consisting of amino acid residues at positions 10, 128 to 140, and 159 to 179 corresponding to the amino acid sequence of a wild-type aminoacyl-tRNA synthetase.

[0007] In another preferred example, the plurality includes 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33 and 34.

[0008] In another preferred example, the positions 128 to 140 include positions 128, 129, 130, 131, 132, 133, 134, 135, 136, 137, 138, 139 and 140.

[0009] In another preferred example, positions 159 to 179 include positions 159, 160, 161, 162, 163, 164, 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, 179 and 180.

[0010] In another preferred embodiment, the mutant protein omits at least the following amino acid residues from the amino acid sequence of the wild-type aminoacyl-tRNA synthetase: (a) the amino acid residue at position 102; (b) amino acid residues at positions X to Y, where X is a positive integer between 128 and 132 and Y is a positive integer between 133 and 140; and / or (c) amino acid residues at positions A to B, where A is a positive integer between 159 and 164 and B is a positive integer between 165 and 179. In another preferred example, X is a positive integer between 128 and 132, such as 128, 129, 130, 131, or 132. In another preferred embodiment, X is 128. In another preferred example, Y is a positive integer between 133 and 140, such as 133, 134, 135, 136, 137, 138, 139, or 140. In another preferred embodiment, Y is 140. In another preferred example, A is a positive integer between 159 and 164, such as 159, 160, 161, 162, 163, or 164. In another preferred embodiment, A is 159.

[0011] In another preferred example, B is a positive integer between 165 and 179, such as 165, 166, 167, 168, 169, 170, 171, 172, 173, 174, 175, 176, 177, 178, or 164. In another preferred embodiment, B is 179.

[0012] In another preferred embodiment, the wild-type aminoacyl-tRNA synthetase is derived from the methanogenic archaea Methanosarcina mazei, Methanosarcina barkeri or Methanosarcina acetivorans. In another preferred embodiment, the amino acid sequence of the wild-type aminoacyl-tRNA synthetase is as set forth in SEQ ID NO.:1 or 2. In another preferred embodiment, the number of the deleted amino acid residues is based on SEQ ID NO.:1 or 2. In another preferred embodiment, the mutant protein is a truncated aminoacyl-tRNA synthetase.

[0013] In another preferred embodiment, the length of the amino acid sequence of the mutant protein is at least 90%, preferably 92% to 99%, of the length of the sequence shown in SEQ ID NO.:1 or 2.

[0014] In another preferred embodiment, the mutein (truncated form) has at least 90%, 95%, 96%, 97%, 98% or 99% sequence identity with a peptide fragment of corresponding length present in SEQ ID NO.:1 or 2.

[0015] In another preferred embodiment, the mutant protein is truncated by at least amino acid residues at positions 128-140 and 159-179 of the amino acid sequence of the wild-type aminoacyl-tRNA synthetase.

[0016] In another preferred embodiment, the mutant protein is truncated by at least amino acid residues at positions 10, 128-140, and 159-179 of the amino acid sequence of the wild-type aminoacyl-tRNA synthetase. In another preferred embodiment, the amino acid sequence of the mutein is as shown in SEQ ID NO.:3. In another preferred embodiment, the amino acid sequence of the mutein is as shown in SEQ ID NO.:4.

[0017] In another preferred example, in the mutant aminoacyl-tRNA synthetase corresponding to the sequence as shown in SEQ ID NO.:4, the mutant protein further comprises an amino acid mutation selected from the group consisting of a histidine (H) at position 29, an aspartic acid (D) at position 76, a serine (S) at position 89, an asparagine (N) at position 91, an arginine (R) at position 96, a serine (S) at position 121, an asparagine (N) at position 129, a serine (S) at position 145, an alanine (A) at position 148, a leucine (L) at position 274, a cysteine ​​(C) at position 313, a phenylalanine (F) at position 349, or a combination thereof. In another preferred embodiment, the amino acid number of the mutation site is based on SEQ ID NO.:4.

[0018] In another preferred embodiment, the mutant protein is a mutant aminoacyl-tRNA synthetase having a sequence as shown in SEQ ID NO.:4, and further comprises an amino acid mutation selected from the group consisting of histidine (H) at position 29, aspartic acid (D) at position 76, serine (S) at position 89, asparagine (N) at position 91, arginine (R) at position 96, serine (S) at position 121, asparagine (N) at position 129, serine (S) at position 145, alanine (A) at position 148, leucine (L) at position 274, cysteine ​​(C) at position 313, phenylalanine (F) at position 349, or a combination thereof, based on the sequence shown in SEQ ID NO.:4. In another preferred embodiment, the histidine (H) at position 29 is mutated to a tyrosine (Y); and / or the aspartic acid (D) at position 76 is mutated to a glycine (G); and / or the serine (S) at position 89 is mutated to a glycine (G); and / or the asparagine (N) at position 91 is mutated to a threonine (T); and / or the arginine (R) at position 96 is mutated to a lysine (K); and / or the serine (S) at position 121 is mutated to a proline (P); and / or the asparagine (N) at position 129 is mutated to aspartic acid (D); and / or the serine (S) at position 145 is mutated to a proline (P); and / or the alanine (A) at position 148 is mutated to a threonine (T); and / or the leucine (L) at position 274 is mutated to an alanine (A); and / or the cysteine ​​(C) at position 313 is mutated to a serine (S); and / or The phenylalanine (F) at position 349 is mutated to a tyrosine (Y).

[0019] In another preferred example, the mutations of the mutant protein in the mutant aminoacyl-tRNA synthetase corresponding to the sequence as shown in SEQ ID NO.:4 are selected from the group consisting of H29Y, D76G, S89G, N91T, R96K, S121P, N129D, S145P, A148T, L274A, C313S, F349Y, or combinations thereof.

[0020] In another preferred embodiment, in the mutant aminoacyl-tRNA synthetase corresponding to the sequence as shown in SEQ ID NO.:4, the mutant protein further comprises a mutation selected from the group consisting of H29Y, D76G, S89G, N91T, R96K, S121P, N129D, S145P and A148T.

[0021] In another preferred embodiment, in the mutant aminoacyl-tRNA synthetase corresponding to the sequence as shown in SEQ ID NO.:4, said mutant protein further comprises a mutation selected from the group consisting of L274A, C313S and F349Y. In another preferred embodiment, the amino acid sequence of the mutein is as shown in SEQ ID NO.:5 or 6.

[0022] In another preferred embodiment, except for the deletions and mutations, the remaining amino acids of the mutant protein are the same or essentially the same as the sequence as shown in SEQ ID NO.:1 or SEQ ID NO.:2.

[0023] In another preferred embodiment, the essentially same means that at most 50 (preferably 1 to 20, more preferably 1 to 10) amino acids differ, wherein the differences include amino acid substitutions, deletions or additions, and the mutant protein still has aminoacyl-tRNA synthetase activity.

[0024] In another preferred example, the amino acid sequence of the mutant protein has at least 70%, preferably at least 75%, 80%, 85%, 90%, more preferably at least 95%, 96%, 97%, 98%, 99% or more sequence identity compared to SEQ ID NO.1 or SEQ ID NO.:2.

[0025] In another preferred embodiment, the mutant protein is formed by mutation of the wild-type aminoacyl-tRNA synthetase shown in SEQ ID NO.:1 or SEQ ID NO.:2. In another preferred embodiment, the mutant protein is selected from the group consisting of: (1) a polypeptide having an amino acid sequence as set forth in any one of SEQ ID NOs.: 3 to 6; or

[0026] (2) A polypeptide derived from a polypeptide having an amino acid sequence shown in any one of SEQ ID NOs: 3 to 6, which is formed by substituting, deleting or adding one or more amino acid residues, preferably 1 to 20, more preferably 1 to 15, more preferably 1 to 10, more preferably 1 to 8, more preferably 1 to 3, and most preferably 1 amino acid residue, and which has the polypeptide function described in (1).

[0027] In another preferred embodiment, the amino acid sequence of the mutant protein is as shown in any one of SEQ ID NOs.:3-6. In another preferred embodiment, the mutant protein is a non-naturally occurring protein. In another preferred embodiment, the mutein is used to introduce a defined modified amino acid into a target protein. In another preferred embodiment, the mutant protein has one or more of the following characteristics: (a) the ability to introduce defined modified amino acids with larger functional groups into target proteins compared to wild-type aminoacyl-tRNA synthetases; (b) the expression level of the target protein is high, and (c) The sequence length of the mutant protein is short, it is easily expressed, and the expression level is high.

[0028] A second aspect of the invention provides an isolated polynucleotide, said polynucleotide encoding a mutant protein according to the first aspect of the invention. In another preferred embodiment, the polynucleotide encodes a polypeptide as set forth in any one of SEQ ID NOs.:3-6.

[0029] In another preferred embodiment, the polynucleotide encodes a polypeptide as set forth in SEQ ID NO.:4 and the nucleotide sequence is as set forth in SEQ ID NO.:9. In another preferred embodiment, the polynucleotide comprises a DNA sequence, an RNA sequence, or a combination thereof.

[0030] In another preferred embodiment, the ORF of the polynucleotide in the mutant aminoacyl-tRNA synthetase further comprises an auxiliary element selected from the group consisting of a signal peptide, a secretory peptide, a tag sequence (e.g., 6His), or a combination thereof. A third aspect of the invention provides a vector, said vector comprising a polynucleotide as described in the second aspect of the invention. In another preferred embodiment, the vector includes an expression vector, a shuttle vector, and an integrative vector. In another preferred embodiment, the vector is selected from the group consisting of pET, pCW, pUC, pPIC9k, pMA5, or a combination thereof. In another preferred embodiment, the vector is a pEvol vector and / or a pBAD vector. In another preferred embodiment, the vector is used to express a mutant protein according to the first aspect of the invention.

[0031] A fourth aspect of the invention provides a host cell, said host cell comprising a vector as described in the third aspect of the invention or having integrated into its genome a polynucleotide as described in the second aspect of the invention or expressing a mutant protein as described in the first aspect of the invention. In another preferred embodiment, the host cell is selected from the group consisting of a prokaryotic cell, a eukaryotic cell, or a combination thereof. In another preferred embodiment, the host cell is a eukaryotic cell, such as a yeast cell, a plant cell or an animal cell (eg, a mammalian cell). In another preferred embodiment, the host cell is a prokaryotic cell, such as E. coli. In another preferred embodiment, the host cell is E. coli Top10, or BL21. In another preferred embodiment, the host cell comprises: (a) a mutant protein according to the first aspect of the invention, (b) an artificial tRNA capable of binding to a selected modified amino acid in the presence of said mutant protein, and optionally (c) a first nucleic acid sequence that encodes a target protein and includes a codon recognized by said artificial tRNA. In another preferred embodiment, the host cell comprises: (d) further comprising said selected modified amino acid. In another preferred embodiment, the first nucleic acid sequence comprises a codon recognized by the artificial tRNA at a position for introducing a predetermined modified amino acid. In another preferred embodiment, the predetermined modified amino acid is a substrate for the mutant protein. In another preferred embodiment, the predetermined modified amino acid is a lysine having a modifying group.

[0032] In another preferred embodiment, the modified amino acid is selected from the group consisting of an alkynyloxycarbonyl lysine derivative, a tert-butoxycarbonyl (BOC)-lysine derivative, a fatty acylated lysine derivative, or a combination thereof. In another preferred embodiment, the structure of the alkynyloxycarbonyl lysine is as shown in Formula I: [ka] Here, n is an integer from 0 to 8. In another preferred embodiment, the artificial tRNA is an inhibitor tRNA, preferably an amber suppressor tRNA. In another preferred embodiment, the coding nucleic acid sequence of the artificial tRNA is as shown in SEQ ID NO.:7.

[0033] GGAAACCTGATCATGTAGATCGAATGGACTCTAAATCCGTTCAGCCGGGTTAGATTCCCGGGGTTTCCGCCA(SEQ ID NO.:7)

[0034] In another preferred embodiment, the codon recognized by said artificial tRNA is UAG (amber), UAA (ochre), or UGA (opal), preferably the amber codon.

[0035] In another preferred embodiment, the mutant protein specifically catalyzes the artificial tRNA to form an "artificial tRNA-Xa" complex, where Xa is the predetermined modified amino acid in the form of an aminoacyl group. In another preferred embodiment, the host cell is a prokaryotic or eukaryotic cell, preferably E. coli.

[0036] In another preferred embodiment, the target protein is selected from the group consisting of insulin, human insulin precursor protein, precursor protein of insulin lispro, precursor protein of insulin glargine, parathyroid hormone, cortirelin, calcitonin, bivalirudin, glucagon-like peptides and their derivatives exenatide and liraglutide, somaglutide, ziconotide, semorelin, somarelin, secretin, teduglutide, hirudin, growth hormone, growth factor, growth hormone releasing factor, corticotropin, releasing factor, deserelin, desmopressin, excitonin, glucagon, leuprolide, luteinizing hormone releasing hormone, somatostatin, thyrotropin releasing hormone, triptorelin, vasoactive intestinal peptide, interferon, parathyroid hormone, BH3 peptides, amyloidosis peptides, or fragments of the above peptides, or combinations thereof.

[0037] A fifth aspect of the present invention provides an expression system, the expression system comprising: (a) a mutant protein according to the first aspect of the invention, (b) an artificial tRNA capable of binding to a selected modified amino acid in the presence of said mutant protein, and optionally (c) a first nucleic acid sequence that encodes a target protein and includes a codon recognized by said artificial tRNA. In another preferred embodiment, the first nucleic acid sequence comprises a codon recognized by the artificial tRNA at a position for introducing a predetermined modified amino acid. In another preferred embodiment, the expression system comprises: (d) further comprising said selected modified amino acid. In another preferred embodiment, the predetermined modified amino acid is a lysine having a modifying group.

[0038] In another preferred embodiment, the modified amino acid is selected from the group consisting of an alkynyloxycarbonyl lysine derivative, a tert-butoxycarbonyl (BOC)-lysine derivative, a fatty acylated lysine derivative, or a combination thereof. In another preferred embodiment, the structure of the alkynyloxycarbonyl lysine is as shown in Formula I: [ka] Here, n is an integer from 0 to 8. In another preferred embodiment, the artificial tRNA is an inhibitor tRNA, preferably an amber suppressor tRNA. In another preferred embodiment, the nucleic acid sequence of the artificial tRNA is as shown in SEQ ID NO.:7.

[0039] In another preferred embodiment, the codon recognized by said artificial tRNA is UAG (amber), UAA (ochre), or UGA (opal), preferably the amber codon. In another preferred embodiment, the expression system is a cell or a cell extract.

[0040] In another preferred embodiment, the expression system is used to introduce a predefined modified amino acid into a target protein or to prepare a target protein that contains an unnatural amino acid.

[0041] A sixth aspect of the present invention provides a plasmid system, the plasmid system comprising: (1) and (2) (1) a first expression cassette, the first expression cassette comprising a first coding sequence encoding a target protein, the first coding sequence comprising a codon for introducing a predetermined modified amino acid, the codon being UAG (amber), UAA (ochre), or UGA (opal); and

[0042] (2) a second expression cassette, said second expression cassette comprising a second coding sequence encoding an aminoacyl-tRNA synthetase, wherein said aminoacyl-tRNA synthetase is a mutant protein according to the first aspect of the invention;

[0043] The system also includes a third expression cassette, the third expression cassette including a third coding sequence encoding an artificial tRNA, the artificial tRNA including an anticodon corresponding to the codon;

[0044] Additionally, the aminoacyl-tRNA synthetase specifically catalyzes the artificial tRNA to form an "artificial tRNA-Xa" complex, where Xa is the predetermined modified amino acid in the form of an aminoacyl group. In another preferred embodiment, the plasmid system is a single plasmid system or a multiple plasmid system. In another preferred embodiment, the multiple plasmid system includes a double plasmid system, a three plasmid system and a four plasmid system. In another preferred embodiment, the codon is UAG (amber) or UGA (opal). In another preferred embodiment, the codon comprises a three-base nucleotide sequence corresponding to an amino acid on an mRNA or DNA. In another preferred embodiment, the predetermined modified amino acid is a lysine having a modifying group.

[0045] In another preferred embodiment, the modified amino acid is selected from the group consisting of an alkynyloxycarbonyl lysine derivative, a tert-butoxycarbonyl (BOC)-lysine derivative, a fatty acylated lysine derivative, or a combination thereof. In another preferred embodiment, the first expression cassette, the second expression cassette and the third expression cassette are each located on a different plasmid.

[0046] In another preferred embodiment, any two or three of the first expression cassette, the second expression cassette and the third expression cassette are located on the same plasmid.

[0047] In another preferred embodiment, the plasmid is an expression vector selected from the group consisting of pBAD / gIII ABC, pBAD / His ABC, pET28a, pETDuet-1, or pEvol-pBpF vectors.

[0048] In another preferred embodiment, the plasmid further comprises a resistance gene, a tag sequence, a repressor gene (araC), a promoter gene (araBAD), or a combination thereof.

[0049] In another preferred embodiment, the resistance gene is selected from the group consisting of an ampicillin resistance gene (AmpR), a chloramphenicol resistance gene (CmR), a kanamycin resistance gene (KanaR), a tetracycline resistance gene (TetR), or a combination thereof. In another preferred embodiment, the plasmid system is a double plasmid system.

[0050] In another preferred embodiment, the first expression cassette is located on a first plasmid, the second expression cassette is located on a second plasmid, and the third expression cassette is located on either the first plasmid or the second plasmid. In another preferred embodiment, the third expression cassette is located on a second plasmid.

[0051] In another preferred embodiment, the first plasmid is an expression vector selected from the group consisting of pBAD-His ABC, pBAD / His ABC, pET28a, and pETDuet-1.

[0052] In another preferred embodiment, the first plasmid further comprises a resistance gene, a tag sequence, a repressor gene (araC), a promoter gene (araBAD), or a combination thereof. In another preferred embodiment, the second plasmid is a pEvol-pBpF vector.

[0053] In another preferred embodiment, the second plasmid further comprises a resistance gene, a tag sequence, a repressor gene (araC), a promoter gene (araBAD), or a combination thereof. In another preferred embodiment, there is no limitation on the locations of the first expression cassette, the second expression cassette and the third expression cassette in the plasmid.

[0054] In another preferred embodiment, any two or three of the first expression cassette, the second expression cassette and the third expression cassette can be combined into one.

[0055] In another preferred example, any two of the first expression cassette, the second expression cassette and the third expression cassette can be connected by a connecting sequence (e.g., IRES, P2A, T2A, etc.).

[0056] In another preferred embodiment, the first expression cassette, the second expression cassette and / or the third expression cassette may or may not include a promoter.

[0057] In another preferred example, the first expression cassette, the second expression cassette and / or the third expression cassette further comprise one or more promoters, which are operably linked to the first coding sequence, the second coding sequence, the third coding sequence, an enhancer, a transcription termination signal, a polyadenylation sequence, an origin of replication, a selectable marker, a nucleic acid restriction site, and / or a homologous recombination site. In another preferred embodiment, the first expression cassette comprises a first promoter, and preferably, the first promoter is an inducible promoter.

[0058] In another preferred embodiment, the first promoter is selected from the group consisting of an arabinose promoter (araBAD), a lactose promoter (Plac), a pLacUV5 promoter, a pTac promoter, or a combination thereof.

[0059] In another preferred embodiment, the first expression cassette comprises, in order from 5' to -3', a promoter (eg, araBAD), a ribosome binding site RBS, the first coding sequence, and a terminator or tag sequence.

[0060] In another preferred embodiment, the second expression cassette further comprises a second promoter, and preferably, the second promoter is an inducible promoter.

[0061] In another preferred embodiment, the second promoter is selected from the group consisting of an arabinose promoter (araBAD), a glnS promoter, a proK promoter, or a combination thereof.

[0062] In another preferred embodiment, the second expression cassette comprises, from 5' to -3' in sequence, a promoter (eg, araBAD or glnS), a ribosome binding site RBS, the second coding sequence and a terminator (rrnB or glnST).

[0063] In another preferred embodiment, the third expression cassette further comprises a third promoter, and preferably, the third promoter is a constitutive promoter. In another preferred embodiment, the third promoter is the reverse transcription promoter proK.

[0064] In another preferred embodiment, the third expression cassette comprises, from 5' to -3' in sequence, a promoter (such as proK), a ribosome binding site (RBS), a third coding sequence, and a terminator or tag sequence.

[0065] A seventh aspect of the invention provides a host cell or cell extract, said host cell or cell extract comprising an expression system according to the fifth aspect of the invention, or a plasmid system according to the sixth aspect of the invention. In another preferred embodiment, the host cell is selected from the group consisting of E. coli, Bacillus subtilis, yeast cells, insect cells, mammalian cells, or combinations thereof.

[0066] In another preferred embodiment, the cell extract is derived from cells selected from the group consisting of Escherichia coli, Bacillus subtilis, yeast cells, insect cells, mammalian cells, or combinations thereof.

[0067] An eighth aspect of the present invention is a method for producing a composition comprising the steps of: (1) providing a host cell according to the fourth aspect of the invention, or an expression system according to the fifth aspect of the invention, or a plasmid system according to the sixth aspect of the invention; and

[0068] (2) expressing the target protein in the presence of the unnatural amino acid using the host cell, expression system, or plasmid system.

[0069] In another preferred embodiment, the target protein is selected from the group consisting of human insulin precursor protein, precursor protein of insulin lispro, precursor protein of insulin glargine, parathyroid hormone, cortirelin, calcitonin, bivalirudin, glucagon-like peptides and their derivatives exenatide and liraglutide, ziconotide, semorelin, somarelin, secretin, teduglutide, hirudin, growth hormone, growth factor, growth hormone releasing factor, corticotropin, releasing factor, deserelin, desmopressin, excitonin, glucagon, leuprolide, luteinizing hormone releasing hormone, somatostatin, thyrotropin releasing hormone, triptorelin, vasoactive intestinal peptide, interferon, parathyroid hormone, BH3 peptides, amyloidosis peptides, or fragments of the above peptides, or combinations thereof. In another preferred embodiment, the unnatural amino acid is a lysine having a modified group.

[0070] In another preferred embodiment, the unnatural amino acid is selected from the group consisting of an alkynyloxycarbonyl lysine derivative, a tert-butoxycarbonyl (BOC)-lysine derivative, a fatty acylated lysine derivative, or a combination thereof.

[0071] In another preferred embodiment, the method further comprises: (1) providing a host cell or cell extract according to the seventh aspect of the invention; and (2) introducing the lysine derivative into the target protein via the mutant protein and artificial tRNA pair described in the first aspect of the present invention by culturing the cells or cell extract in the presence of an unnatural amino acid.

[0072] A ninth aspect of the present invention provides a kit comprising: (a) a container; and (b) located within the container a mutant protein according to the first aspect of the invention, or a polynucleotide according to the second aspect of the invention, or a vector according to the third aspect of the invention, or an expression system according to the fifth aspect of the invention, or a plasmid system according to the sixth aspect of the invention. In another preferred embodiment, the kit further comprises a cell extract. In another preferred embodiment, the plasmid system is a multiple plasmid system, and each of the plasmids is located in the same or different containers.

[0073] A tenth aspect of the present invention is a method for producing a composition comprising the steps of: (a) a mutant protein according to the first aspect of the invention, (b) an artificial tRNA capable of binding to a selected modified amino acid in the presence of said mutant protein; and (c) providing a translation system comprising the selected modified amino acid. An eleventh aspect of the invention provides the use of a mutant protein according to the first aspect of the invention, or a host cell according to the fourth aspect of the invention, or a plasmid system according to the sixth aspect of the invention, or a kit according to the ninth aspect of the invention for incorporating an unnatural amino acid into a target protein or for preparing a target protein comprising an unnatural amino acid.

[0074] A twelfth aspect of the invention provides a method for producing a mutant protein according to the first aspect of the invention, comprising the step of (i) culturing a host cell according to the fourth aspect of the invention to express the mutant protein. A thirteenth aspect of the invention provides an enzyme preparation, the enzyme preparation comprising a mutant protein according to the first aspect of the invention. In another preferred embodiment, the pharmaceutical formulation comprises a lyophilized formulation, a liquid formulation, or a combination thereof. Effect of the Invention

[0075] It should be understood that within the scope of the present invention, the above technical features of the present invention and the technical features specifically described below (e.g., in the implementation) can be combined with each other to form new or preferred technical solutions, which will not be repeated here due to space limitations. [Brief description of the drawings]

[0076] [Figure 1] The plasmid map of pEvol-suppylRs-pylT is shown. [Diagram 2] The plasmid map of pEvol-IPYEpylRs-pylT is shown. [Diagram 3] The plasmid map of pEvol-optpylRs-pylT is shown. [Figure 4] The plasmid map of pEvol-IPYEpylRs(L274A, C313S, F349Y)-pylT is shown. [Diagram 5] The plasmid map of pBAD-araBAD[A1-u4-u5-TEV-R-MiniINS]-glnS[IPYEpylRs]-proK[pylT] is shown. DETAILED DESCRIPTION OF THE PREFERRED EMBODIMENTS

[0077] After extensive detailed research and extensive screening, the present inventors unexpectedly obtained a mutant lysyl-tRNA synthetase. Compared with wild-type lysyl-tRNA synthetase, the mutant lysyl-tRNA synthetase of the present invention has high activity, high expression and high solubility, and can significantly increase the insertion amount of unnatural amino acids and the expression amount of target proteins containing unnatural amino acids. In addition, the mutant lysyl-tRNA synthetase of the present invention can improve the stability of target proteins to prevent them from being easily destroyed. Based on this, the present inventors have completed the present invention.

[0078] term To facilitate understanding of this disclosure, certain terms are first defined. As used herein, unless otherwise specified herein, each of the following terms shall have the meaning indicated below. Other definitions are set forth throughout the invention.

[0079] The term "about" can refer to a value or configuration within an acceptable error range for a particular value or configuration as determined by one of ordinary skill in the art, which depends in part on how the value or configuration is measured or measured. For example, as used herein, the expression "about 100" includes all values ​​between 99 and 101 (e.g., 99.1, 99.2, 99.3, 99.4, etc.).

[0080] As used herein, the terms "containing" or "comprising" may refer to open, semi-closed and closed systems. In other words, the terms also include "consisting essentially of" or "consisting of."

[0081] Sequence identity (or homology) is determined by comparing two aligned sequences along a defined comparison window (which may be 50%, 60%, 70%, 80%, 90%, 95% or 100% of the length of the reference nucleotide sequence or protein) and determining the number of positions in which the same residue occurs. Generally, this is expressed as a percentage. Measuring sequence identity of nucleotide sequences is a method well known to those skilled in the art. As used herein, the terms "aminoacyl-tRNA synthetase" and "lysyl-tRNA synthetase" are used interchangeably.

[0082] Wild-type lysyl-tRNA synthetase As used herein, "wild-type lysyl-tRNA synthetase" refers to a naturally occurring aminoacyl-tRNA synthetase that is not artificially modified, and its nucleotide can be obtained by genetic engineering techniques such as genome sequencing, polymerase chain reaction (PCR), and its amino acid sequence can be deduced by the nucleotide sequence. The source of the wild-type lysyl-tRNA synthetase is not particularly limited, and preferred sources can be, but are not limited to, methanogenic archaea Methanosarcina mazei, Methanosarcina barkeri, and Methanosarcina acetivorans. In a preferred embodiment of the present invention, the amino acid sequence of said wild-type lysyl-tRNA synthetase is as shown in SEQ ID NO.:1.

[0083] MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAMPKSVAR APKPLENTEAAQAQPSGSKFSPAIPVSTQESVSVPASVSTSISSISTGATASALVKGNTNPITSMSAPVQASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPPDIKIFEIGPCYRKESDGKEHLEEFT MLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL(SEQ ID NO.:1) In a preferred embodiment of the present invention, the amino acid sequence of said wild-type lysyl-tRNA synthetase is as shown in SEQ ID NO.:2.

[0084] MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAPTRTKKAMPKSVAR APKPLENTEAAQAQPSGSKFSPAIPVSTQESVSVPASVSTSISSISTGATASALVKGNTNPITSMSAPVQASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKK DLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPPDIKIFEIGPCYRKESDGKEHLEEFT MLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELSSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSGSYYNGISTNL(SEQ ID NO.:

[0085] 2) Mutant lysyl-tRNA synthetase As used herein, the terms "mutant protein", "mutant protein of the invention", "mutant aminoacyl-tRNA synthetase of the invention", "mutant lysyl-tRNA synthetase", "mutant enzyme", "aminoacyl-tRNA synthetase mutant" are used interchangeably and refer to all non-naturally occurring mutant aminoacyl-tRNA synthetases, said mutant aminoacyl-tRNA synthetases being artificially modified proteins relative to the polypeptide shown in SEQ ID NO.:1 or SEQ ID NO.:2. In particular, said mutant aminoacyl-tRNA synthetases are as described in the first aspect of the invention.

[0086] It should be understood that the amino acid numbers in the mutant lysyl-tRNA synthetase of the present invention are based on the wild-type lysyl-tRNA synthetase (preferably SEQ ID NO.:1 or SEQ ID NO.:2). When a specific mutant protein has 80% or more homology with the sequence shown in SEQ ID NO.:1 or SEQ ID NO.:2, the amino acid numbers of the mutant protein may be misaligned compared to the amino acid numbers of SEQ ID NO.:1 or SEQ ID NO.:2, for example, by shifting 1-5 positions to the N-terminus or C-terminus of the amino acid, and using conventional sequence comparison techniques in the art, a person skilled in the art can generally understand that such shifting is within a reasonable range, and a mutant protein having the same or similar glycosyltransferase activity with 80% (e.g., 90%, 95%, 98%) homology should not be excluded from the scope of the mutant protein of the present invention due to the shifting of amino acid numbers.

[0087] The muteins of the invention are synthetic or recombinant proteins, i.e., they are chemically synthesized products or can be produced from prokaryotic or eukaryotic hosts (e.g., bacteria, yeast, plants) using recombinant techniques. Depending on the host used in the recombinant production method, the muteins of the invention can be glycosylated or non-glycosylated. The muteins of the invention can or can not include an initial methionine residue.

[0088] The present invention includes fragments, derivatives and analogs of said muteins. As used herein, the terms "fragment", "derivative" and "analog" refer to proteins that retain substantially the same biological function or activity as said muteins.

[0089] The mutein fragment, derivative or analog of the present invention may be (i) a mutein in which one or more conservative or non-conservative amino acid residues (preferably conservative amino acid residues) have been substituted, such substituted amino acid residues may or may not be encoded by the genetic code, or (ii) a mutein having a substitution at one or more amino acid residues, or (iii) a mutein formed by fusing the mature mutein with another compound (e.g., a compound that extends the half-life of the mutein, such as polyethylene glycol), or (iv) a mutein formed by fusing an additional amino acid sequence to the mutein sequence (e.g., a leader sequence or a secretory sequence or a sequence for purifying the mutein or a proprotein sequence, or a fusion protein formed with an antigen IgG fragment). Following the teachings of the present specification, these fragments, derivatives and analogs are within the scope of the skilled artisan. In the present invention, the conservatively substituted amino acids are preferably generated by amino acid substitution according to Table I. [Table 1]

[0090] The discrimination of amino acid substrates of PylRS is related to the three-dimensional structure of the catalytically active functional domain; the size of lysine derivatives that can be activated by wild-type PylRS is limited, and lysine derivatives with large functional groups cannot be introduced into proteins; therefore, by mutating the PylRS site, steric hindrance of binding to the substrate or interactions between the mutated amino acid and the substrate amino acid or main chain moiety can be avoided, improving the effect. Preferably, the mutant protein is as shown in any one of SEQ ID NOs.:3-6.

[0091] MDKKPLNTLISATGLWMSRTGTIHKIKHHEVSRSKIYIEMACGDHLVVNNSRSSRTARALRHHKYRKTCKRCRVSDEDLNKFLTKANEDQTSVKVKVVSAPRTKKAMPKSVARAPKPLENTEAAQASTQESVSVPASVSTSISSSAPVQASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELLSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL(SEQ ID NO.:3)

[0092] MDKKPLDVLISATGLWMSRTGTLHKIKHHEISRSKIYIEMACGDHLVVNNSRSCRPARAFRYHKYRKTCKRCRVSDEDINNFLTRSTESKNSVKVRVVSEPKVKKAMPKSVSRAPKPLENSVSAKASTNTSRSVPSPAKSTPNSSVPASASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELLSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL(SEQ ID NO.:4)

[0093] MDKKPLDVLISATGLWMSRTGTLHKIKHYEIRSKIYIEMACGDHLVVNNSRSCRPARAFRYHKYRKTCKRCRVSGEDINNFLTRSTEGKTSVKVKVVSEPKVKKAMPKSVSRAPKPLENPVSAKASTDTSRSVPSPAKSTPNSPVPTSASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYLRKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFCQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVFGDTLDVMHGDLELLSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL(SEQ ID NO.:5)

[0094] MDKKPLDVLISATGLWMSRTGTLHKIKHHEISRSKIYIEMACGDHLVVNNSRSCRPARAFRYHKYRKTCKRCRVSDEDINNFLTRSTESKNSVKVRVVSEPKVKKAMPKSVSRAPKPLENSVSAKASTNTSRSVPSPAKSTPNSSVPASASAPALTKSQTDRLEVLLNPKDEISLNSGKPFRELESELLSRRKKDLQQIYAEERENYLGKLEREITRFFVDRGFLEIKSPILIPLEYIERMGIDNDTELSKQIFRVDKNFCLRPMLAPNLYNYARKLDRALPDPIKIFEIGPCYRKESDGKEHLEEFTMLNFSQMGSGCTRENLESIITDFLNHLGIDFKIVGDSCMVYGDTLDVMHGDLELLSAVVGPIPLDREWGIDKPWIGAGFGLERLLKVKHDFKNIKRAARSESYYNGISTNL(SEQ ID NO.:6)

[0095] Compared to the sequences shown in SEQ ID NO.:1 or SEQ ID NO.:2, the mutant proteins of the present invention generally have a high degree of homology (identity), and preferably, the mutant proteins have at least 90%, 95%, 96%, 97%, 98% or 99% sequence identity with the peptide fragments of corresponding length present in SEQ ID NO.:1 or 2.

[0096] Moreover, the muteins of the present invention can be further modified. Modified forms (which do not usually change the primary structure) include chemically derived forms of the muteins in vivo or in vitro, such as acetylation or carboxylation. Modifications further include glycosylation, such as muteins that are generated by glycosylation modifications during the synthesis and processing of the muteins or during further processing steps. Such modifications can be achieved by exposing the muteins to glycosylation enzymes (e.g., mammalian glycosylases or deglycosylases). Modified forms further include sequences with phosphorylated amino acid residues (e.g., tyrosine phosphate, serine phosphate, threonine phosphate). Further included are muteins that are modified to improve their anti-protein hydrolysis performance or optimize their lysis performance.

[0097] The term "polynucleotide encoding a mutant protein of the invention" may include a polynucleotide that encodes a mutant lysyl-tRNA synthetase of the invention, or it may be a polynucleotide that may include additional coding and / or non-coding sequences.

[0098] The present invention relates to variants of the above polynucleotides that code for fragments, analogs and derivatives of the polypeptides or muteins having the same amino acid sequence as the present invention. These nucleotide variants include substitution, deletion and insertion variants. As known in the art, allelic variants are alternative forms of a polynucleotide, which may be a substitution, deletion or insertion of one or more nucleotides, but do not substantially alter the function of the mutein they encode.

[0099] The present invention further relates to a polynucleotide that hybridizes with the above sequence and has at least 50%, preferably at least 70%, more preferably at least 80% homology between the two sequences. The present invention particularly relates to a polynucleotide that can hybridize with the above polynucleotide of the present invention under stringent conditions (or stringent conditions). In the present invention, "stringent conditions" refers to (1) hybridization and elution under lower ionic strength and higher temperature, such as 0.2xSSC, 0.1% SDS, and 60°C, or (2) addition of a denaturing agent, such as 50% (v / v) formamide, 0.1% calf serum / 0.1% Ficoll, 42°C, when hybridizing, or (3) hybridization only occurs when the homology between the two sequences is at least 90% or more, more preferably 95% or more.

[0100] The muteins and polynucleotides of the present invention are preferably provided in an isolated form, and more preferably, are purified to homogeneity.

[0101] The full-length sequence of the polynucleotide of the present invention can generally be obtained by PCR amplification, recombinant methods or artificial synthesis.For PCR amplification, it can be designed according to the relevant nucleotide sequence disclosed in the present invention, particularly the open reading frame sequence, and the cDNA library available on the market or prepared by conventional methods known to those skilled in the art is used as a template to amplify and obtain the relevant sequence.When the sequence is long, it is often necessary to carry out two or more PCR amplifications and then splice each amplified fragment in the correct order.

[0102] Once the relevant sequence is obtained, recombinant methods can be used to obtain large quantities of the relevant sequence, typically by cloning it into a vector, transferring it into a cell, and then isolating the relevant sequence from the host cells grown by conventional methods.

[0103] Additionally, synthetic methods can be used to synthesize related sequences, especially when the fragments are short in length, typically by first synthesizing several small fragments that are then joined together to obtain much longer fragments of the sequence.

[0104] Currently, the DNA sequence encoding the protein of the present invention (or a fragment thereof, or a derivative thereof) can be obtained completely by chemical synthesis. The DNA sequence can then be introduced into a variety of existing DNA molecules (or vectors, etc.) and cells known in the art. Furthermore, mutations can be introduced into the protein sequence of the present invention via chemical synthesis.

[0105] The method of amplifying DNA / RNA using PCR technology is preferably used to obtain the polynucleotide of the present invention. Particularly when it is difficult to obtain full-length cDNA from the library, the RACE method (RACE-cDNA end rest amplification method) can be preferably used, and the primers used in PCR can be appropriately selected according to the sequence information of the present invention disclosed herein and can be synthesized by conventional methods. The amplified DNA / RNA fragments can be separated and purified by conventional methods such as gel electrophoresis.

[0106] Expression vector As used herein, the term "construct" or "vector" generally refers to a nucleic acid capable of transporting a coding sequence for a target protein to which it has been ligated. One type of vector is a "plasmid," which refers to a circular double stranded DNA loop into which additional DNA segments can be ligated.

[0107] The vector can be transformed or transfected into a suitable host cell to provide protein expression, which process may include culturing a host cell transformed with an expression vector under conditions that provide expression of the vector encoding the protein target nucleic acid sequence, and optionally recovering the expressed protein.

[0108] The vector may be, for example, a plasmid or viral vector equipped with an origin of replication, a promoter optionally used to express the target nucleic acid sequence, and optional regulators of the promoter. In the case of a bacterial plasmid, the vector may contain one or more selectable marker genes, such as a kanamycin resistance gene.

[0109] The present invention also relates to vectors comprising the polynucleotides of the present invention, and host cells genetically engineered with the vectors of the present invention or the fusion protein coding sequences of the present invention, and to methods of producing said polypeptides of the present invention via recombinant techniques.

[0110] Through conventional recombinant DNA techniques, the polynucleotide sequences of the present invention can be used to express or purify recombinant mutant proteins. (1) transforming or transducing a suitable host cell with a polynucleotide (or variant) of the invention encoding a mutant protein of the invention, or with a recombinant expression vector comprising said polynucleotide; (2) culturing the host cells in a suitable medium; (3) isolating and purifying the protein from the medium or the cells.

[0111] In the present invention, the polynucleotide sequence encoding the mutant protein can be inserted into a recombinant expression vector. The term "recombinant expression vector" refers to bacterial plasmids, phages, yeast plasmids, plant cell viruses, mammalian cell viruses such as adenoviruses, retroviruses or other vectors known in the art. Any plasmids and vectors can be used as long as they can be replicated and stabilized in the host. Important features of an expression vector usually include an origin of replication, a promoter, a marker gene and a translation control element.

[0112] Methods well known to those skilled in the art can be used to construct expression vectors containing a DNA sequence encoding the mutant protein of the invention and appropriate transcriptional / translational control signals. These methods include in vitro recombinant DNA techniques, DNA synthesis techniques, in vivo recombinant techniques, etc. The DNA sequence can be effectively linked to an appropriate promoter in the expression vector to guide mRNA synthesis. Representative examples of these promoters include the lac or trp promoters of E. coli, the lambda phage PL promoter, the eukaryotic promoter encompassing the CMV immediate early promoter, the HSV thymidine kinase promoter, the early and late SV40 promoters, the LTRs of retroviruses, and several other known promoters capable of suppressing gene expression in prokaryotic or eukaryotic cells or viruses. The expression vector contains a ribosome binding site for translation initiation and a transcription terminator.

[0113] In addition, the expression vector preferably contains one or more selectable marker genes that provide a phenotypic trait for selection of transformed host cells, such as dihydrofolate reductase, neomycin resistance and green fluorescent protein (GFP) for eukaryotic cell culture, or tetracycline or ampicillin resistance for E. coli.

[0114] The vector containing the appropriate DNA sequence as described above and an appropriate promoter or control sequence can be used to transform an appropriate host cell so as to express the protein.

[0115] The host cell may be a prokaryotic cell, such as a bacterial cell, or a lower eukaryotic cell, such as a yeast cell, or a higher eukaryotic cell, such as a mammalian cell. Representative examples include bacterial cells of Escherichia coli, Streptomyces, Salmonella typhimurium, fungal cells such as yeast and plant cells (e.g., ginseng cells).

[0116] When the polynucleotide of the present invention is expressed in higher eukaryotic cells, the transcription is enhanced when an enhancer sequence is inserted into the vector. Enhancers are cis-acting DNA elements, usually about 10-300 base pairs, that act on promoters to enhance gene transcription. Examples that can be cited include the SV40 enhancer, which is 100-270 base pairs behind the replication origin, the polyoma enhancer, and the adenovirus enhancer, which are behind the replication origin. A person skilled in the art knows how to select appropriate vectors, promoters, enhancers and host cells.

[0117] Transformation of host cells with recombinant DNA can be carried out by conventional techniques well known to those skilled in the art. When the host is a prokaryotic organism such as E. coli, competent cells capable of absorbing DNA can be obtained after the exponential growth phase, and the steps of treating and using CaCl2 method are well known in the art. Another method is to use MgCl2. Optionally, transformation is carried out by electroporation method. When the host is a eukaryotic organism, DNA transfection methods such as calcium phosphate co-precipitation, microinjection, electroporation, liposome packaging, etc. can be selected.

[0118] The obtained transformant can be cultured by a conventional method to express the polypeptide encoded by the gene of the present invention. Depending on the host cell used, the medium used for the culture can be selected from various conventional media. The culture is carried out under conditions suitable for the growth of the host cells. After the host cells have grown to an appropriate cell density, the selected promoter is induced by an appropriate method (e.g., temperature change or chemical induction), and the cells are cultured for a certain period of time.

[0119] The recombinant polypeptide in the above method can be expressed intracellularly or on the cell membrane, or can be secreted extracellularly. If necessary, the recombinant protein can be separated and purified by various separation methods using physical, chemical and other properties. These methods are well known to those skilled in the art. Examples of these methods include, but are not limited to, conventional renaturation, treatment with protein precipitants (salting out), centrifugation, osmotic sterilization, ultratreatment, ultracentrifugation, molecular sieve chromatography (gel filtration), adsorption chromatography, ion exchange chromatography, high performance liquid chromatography (HPLC) and various other liquid chromatography techniques, as well as combinations of these methods. The term "operably linked" refers to the fact that the target gene to be transcribed and expressed is linked to its regulatory sequences in a manner conventional in the art to be expressed.

[0120] Plasmid Systems The present invention provides a plasmid system as described in the sixth aspect of the present invention. Specifically, the plasmid system comprises the following (1) and (2): (1) a first expression cassette, the first expression cassette comprising a first coding sequence encoding a target protein, the first coding sequence comprising a codon for introducing a predetermined modified amino acid, the codon being UAG (amber), UAA (ochre), or UGA (opal); and

[0121] (2) a second expression cassette, said second expression cassette comprising a second coding sequence encoding an aminoacyl-tRNA synthetase, wherein said aminoacyl-tRNA synthetase is a mutant protein according to the first aspect of the invention;

[0122] The system also includes a third expression cassette, the third expression cassette including a third coding sequence encoding an artificial tRNA, the artificial tRNA including an anticodon corresponding to the codon;

[0123] Additionally, the aminoacyl-tRNA synthetase specifically catalyzes the artificial tRNA to form an "artificial tRNA-Xa" complex, where Xa is the predetermined modified amino acid in the form of an aminoacyl group. In another preferred embodiment, the plasmid system is a single plasmid system or a multiple plasmid system. In another preferred embodiment, the multiple plasmid system includes a double plasmid system, a three plasmid system and a four plasmid system. In another preferred embodiment, the first expression cassette, the second expression cassette and the third expression cassette are each located on a different plasmid.

[0124] In another preferred embodiment, any two or three of the first expression cassette, the second expression cassette and the third expression cassette are located on the same plasmid.

[0125] In another preferred embodiment, the plasmid is an expression vector selected from the group consisting of: pBAD / gIII ABC, pBAD / His ABC, pET28a, pETDuet-1, or pEvol-pBpF vectors.

[0126] In another preferred embodiment, the plasmid further comprises a resistance gene, a tag sequence, a repressor gene (araC), a promoter gene (araBAD), or a combination thereof.

[0127] In another preferred embodiment, the resistance gene is selected from the group consisting of an ampicillin resistance gene (AmpR), a chloramphenicol resistance gene (CmR), a kanamycin resistance gene (KanaR), a tetracycline resistance gene (TetR), or a combination thereof. In another preferred embodiment, the DNA sequence of the promoter glnS is as shown in SEQ ID NO.:10.

[0128] TTTTAAAAAAACTAACAGTTGTCAGCCTGTCCCGCTTTAATATCATACGCCGTTATACGTTGTTTACGCTTTG(SEQ ID NO.:10) In another preferred embodiment, the DNA sequence of said terminator glnST is as shown in SEQ ID NO.:11. CAAACAATCCAAAACGCCGCGTTCAGCGGCGTTTTTTCTGCTTTT(SEQ ID NO.:11) In another preferred embodiment, the DNA sequence of said promoter proK is as shown in SEQ ID NO.:12.

[0129] TGTGCTTCTCAAATGCCTGAGGCCAGTTTGCTCAGGCTCTCCCCGTGGAGGTAATAATTGACGATATGATCAGTGCACGGCTAACTAAGCGGCCTGCTGACTTTCTCGCCGATCAAAAGGCATTTTGCTATTAAGGGATTGACGAGGGCGT(SEQ ID NO.:12) In another preferred embodiment, the DNA sequence of said terminator proKT is as shown in SEQ ID NO.:13. AATTCGAAAAGCCTGCTCAACGAGCAGGCTTTTTTGCATG(SEQ ID NO.:13)

[0130] Compared with the prior art, the present invention mainly has the following advantages: After extensive screening and modification, the present invention has for the first time discovered that the resulting truncated mutant aminoacyl-tRNA synthetase (e.g., SEQ ID NO.:3), in which the amino acid residues at positions 10, 128-140, and 159-179 corresponding to the wild-type aminoacyl-tRNA synthetase (e.g., SEQ ID NO.:1 or 2) are deleted, can not only introduce lysine derivatives with large functional groups into proteins, but also has significantly improved enzyme activity, high expression level, good solubility, and can significantly increase the insertion amount of unnatural amino acids and the expression level of target proteins containing unnatural amino acids. Furthermore, the mutant lysyl-tRNA synthetase of the present invention can improve the stability of the target protein, making it less easily destroyed.

[0131] The present invention further provides a method for mutating other sites of the isolated mutant aminoacyl-tRNA synthetase, such that the resulting mutant proteins (e.g., SEQ ID NOs.: 4-6) can further improve the amount of unnatural amino acid inserted, the amount of target protein containing the unnatural amino acid, and / or the stability of the target protein.

[0132] The present invention will be further described below in conjunction with specific examples. It should be understood that these examples are only used to explain the present invention and do not limit the scope of the present invention. In the following examples, the experimental methods that do not show specific conditions usually follow conventional conditions, such as those described in Sambrook et al., Molecular Cloning: A Laboratory Manual (New York: Cold Spring Harbor Laboratory Press, 1989), or conditions suggested by manufacturers. Unless otherwise specified, percentages and parts are calculated by weight percentages and parts by weight. Unless otherwise specified, all reagents and materials used in the practice of the present invention are commercially available products.

[0133] Example 1. Construction of mutants According to the amino acid sequence 1 (SEQ ID NO.:1) of wild-type lysyl-tRNA synthetase pylRs, the DNA sequence of pylRs (SEQ ID NO.:8) is synthesized according to the codon preference of E. coli and cloned into the SpeI-SalI site downstream of the araBAD promoter of expression vector plasmid pEvol-pBpF (purchased from NTCC company, chloramphenicol resistant), where the SpeI restriction site is increased by PCR method and the SalI site is owned by the vector itself. The original glutamine promoter glnS of the expression vector plasmid pEvol-pBpF is retained. The DNA sequence of the non-natural tRNA (pylT) (SEQ ID NO.:7) is inserted downstream of the proK promoter of the expression vector plasmid pEvol-pBpF by PCR method.

[0134] GGAAACCTGATCATGTAGATCGAATGGACTCTAAATCCGTTCAGCCGGGTTAGATTCCCGGGGTTTCCGCCA(SEQ ID NO.:7)

[0135] DNA sequence of pylRs (SEQ ID NO.:8) 1365bp

[0136] The sequence is excised from the cloning vector with the restriction endonucleases SpeI and SalI, and the plasmid pEvol-pylRs-pylT is excised with SpeI and SalI at the same time (the target DNA fragment is the large fragment of 4.3 kb), separated by nucleic acid electrophoresis, extracted with an agarose gel DNA recovery kit, ligated with T4 DNA Ligase, transformed into large E. coli Top10 competent cells by chemical method (CaCl2 method), and the transformed cells are cultured overnight at 37°C in LB agar medium containing chloramphenicol (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl, 1.5% agar). A single live colony is selected and cultured overnight at 37°C, 220 rpm in liquid LB medium containing chloramphenicol (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl). The plasmid was extracted using a small volume plasmid extraction kit, and the plasmid was named pEvol-pylRs-pylT.

[0137] According to the amino acid sequence of wild-type lysyl-tRNA synthetase pylRs (SEQ ID NO.:1), knock out the original three-segment sequence (i.e., 102T, 128Q-140V, 159I-179M, a total of 35 amino acids). The amino acid sequence of synthetase suppylRs (SEQ ID NO.:3) is obtained, and the plasmid is named pEvol-suppylRs-pylT, and the plasmid map is shown in FIG. 1.

[0138] According to the amino acid sequence (SEQ ID NO.:1) of wild-type lysyl-tRNA synthetase pylRs, the entire amino acid sequence from 1 to 184 is replaced with another 149 amino acids, and the amino acid sequence of three fragments (i.e., 102T, 128Q to 140V, 159I to 179M, a total of 35 amino acids) of the above plasmid pEvol-suppylRs-pylT in which the wild-type lysyl-tRNA synthetase pylRs is knocked out is knocked out. The amino acid sequence (SEQ ID NO.:4) of synthetase IPYEpylRs is obtained, and the DNA sequence (SEQ ID NO.:9) of IPYEpylRs is synthesized according to the codon preference of E. coli. The plasmid is named pEvol-IPYEpylRs-pylT, and the plasmid map is shown in FIG. 2.

[0139] DNA sequence of IPYEpylRs (SEQ ID NO.:9) 1260bp

[0140] According to the amino acid sequence of mutant lysyl-tRNA synthetase IPYEpylRs (SEQ ID NO.:4), mutations H29Y, D76G, D89G, N91T, R96K, D121P, N129D, S145P, and A148T are introduced to obtain mutant lysyl-tRNA synthetase optpylRs with the amino acid sequence shown in SEQ ID NO.:5. The plasmid is named pEvol-optpylRs-pylT, and the plasmid map is shown in FIG.

[0141] According to the amino acid sequence of mutant lysyl-tRNA synthetase IPYEpylRs (SEQ ID NO.:4), mutations L274A, C313S, F349Y are introduced to obtain mutant lysyl-tRNA synthetase IPYEpylRs(L274A, C313S, F349Y) with the amino acid sequence as shown in SEQ ID NO.:6. The plasmid is named pEvol-IPYEpylRs(L274A, C313S, F349Y)-pylT, and the plasmid map is shown in FIG.

[0142] Example 2. Construction of single plasmid mutant expression strains According to the amino acid sequence of mutant lysyl-tRNA synthetase IPYEpylRs (SEQ ID NO.:4), according to the DNA sequence of the non-natural tRNA (pylT) (SEQ ID NO.:7), according to the DNA sequences derived from the glutamine promoter glnS and promoter proK and its corresponding terminator of the pEvol-pBpF vector (SEQ ID NO.:10-13), according to the codon preference of E. coli, the DNA sequence of glnS[pylRs]-proK[pylT] (SEQ ID NO.:14) was synthesized and cloned into the AvrII-XbaI site downstream of the terminator rrnB in the plasmid pBAD-A1-u4-u5-TEV-R-MiniINS (the plasmid is constructed by our company and is Kana resistant), where the AvrII and XbaI restriction sites are increased by PCR method.

[0143] DNA sequence of glnS[pylRs]-proK[pylT]: (SEQ ID NO.:14)

[0144] The sequence shown in SEQ ID NO.:14 is excised from the cloning vector pUC57-glnS[pylRs]-proK[pylT] with the restriction endonucleases AvrII and XbaI, and at the same time, the plasmid pBAD-A1-u4-u5-TEV-R-MiniINS is excised with AvrII and XbaI, separated by nucleic acid electrophoresis, extracted with an agarose gel DNA recovery kit, ligated with T4 DNA Ligase, transformed into E. coli Top10 competent cells by chemical method (CaCl2 method), and the transformed cells are cultured overnight at 37°C in LB agar medium containing kanamycin (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl, 1.5% agar). Select a single live colony and grow it overnight at 37 °C and 220 rpm in liquid LB medium (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl) containing kanamycin. Add glycerol to a final concentration of 20% to preserve the strain. Extract the plasmid with a small volume plasmid extraction kit, and the resulting plasmid containing wild-type lysyl-tRNA synthetase is named pBAD-araBAD[A1-u4-u5-TEV-R-MiniINS]-glnS[IPYEpylRs]-proK[pylT]. See Figure 5 for the plasmid map.

[0145] Example 3. Construction of double-plasmid expression strain and high-density expression of tert-butoxycarbonyl (Boc)-modified fusion proteins The plasmid pEvol-pylRs-pylT, plasmid pEvol-suppylRs-pylT, plasmid pEvol-IPYEpylRs-pylT, plasmid pEvol-optpylRs-pylT and plasmid pEvol-IPYEpylRs(L274A, C313S, F349Y)-pylT were co-transformed with insulin fusion protein expression vector pBAD-INS (plasmid constructed by us, kanamycin resistant) into E. coli Top10 competent cells (competent cells purchased from Thermo) by chemical method (CaCl2 method), and the transformed cells were cultured overnight at 37 °C in LB agar medium (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl, 1.5% agar) containing 25 μg / mL kanamycin and 17 μg / mL chloramphenicol. Select a single viable colony and culture it overnight at 37 °C and 220 rpm in liquid LB medium (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl) containing 25 μg / mL kanamycin and 17 μg / mL chloramphenicol. Preserve the strain by adding glycerol to a final concentration of 20%.

[0146] Each strain is inoculated into liquid LB medium and cultured overnight at 37°C and 220 rpm, then 1% (v / v) is inoculated into tank fermentation medium (12 g / L yeast peptone, 24 g / L yeast extract powder, 4 mL / L glycerol, 12.8 g / L disodium hydrogen phosphate, 3 g / L potassium dihydrogen phosphate, 0.3‰ antifoaming agent) and cultured under conditions of 35 (±3)°C, 200-1000 rpm, and air flow rate of 2-6 L / min. After 3-10 hours of culture, supplementary medium containing glycerol and yeast peptone is fed stepwise until fermentation is completed. OD 600 The culture was incubated until the OD reached 25-80, at which point induction was performed by adding L-ara (final concentration: 0.25%) and Boc-Lys (final concentration: 5 mM). 600The culture is continued until the β-amino acid concentration reaches 180-220, and the cells are discharged from the tank. They are then collected by centrifugation (5000 rpm, 30 min, 25°C). The expression status of the fusion protein containing Boc-modified lysine in the whole cells of each strain is detected using SDS-polyacrylamide gel electrophoresis.

[0147] The fusion protein is expressed in the form of an insoluble "inclusion body". To release the inclusion bodies, E. coli cells are disrupted with a high-pressure homogenizer. Nucleic acids, cell debris and soluble proteins are removed by centrifugation at 10,000 g. The inclusion bodies containing the fusion protein are washed with pure water, and the resulting inclusion body precipitate is used as the raw material for folding. The expression levels of the fusion proteins of the different mutant enzymes are shown in the following table. [Table 2]

[0148] To refold the fusion protein, the inclusion bodies are dissolved in a 7.5 M urea solution at pH 10.5 containing 2-10 mM mercaptoethanol so that the concentration of total protein after dissolution is 10-25 mg / mL. The sample is diluted 5-10 times and conventional folding is carried out for 16-30 hours at 4-8 °C and pH 10.5-11.7. The fusion protein is enzymatically hydrolyzed with trypsin and carboxypeptidase B for 10-20 hours at 18-25 °C, maintaining the pH value at 8.0-9.5, and then 0.45 M ammonium sulfate is added to stop the enzymatic hydrolysis reaction. The results of reversed-phase HPLC analysis show that the yield of the enzymatic hydrolysis step is higher than 90%. The insulin analog obtained after enzymatic hydrolysis with trypsin and carboxypeptidase B is named BOC-lysine insulin. Boc-lysine insulin is not enzymatically hydrolyzed under the above conditions. The sample was clarified by membrane filtration, and purified by hydrophobic chromatography for the first time using 0.45 mM ammonium sulfate as a buffer, and the purity of SDS-polyacrylamide gel electrophoresis reached 90%. In addition, the obtained Boc-human insulin was analyzed by MALDI-TOF mass spectrometry, and the result showed that its molecular weight was consistent with the theoretical 5907.7 Da. The sample was collected by elution with hydrophobic chromatography, and hydrochloric acid was added to carry out the Boc-human insulin deprotection reaction. The reaction was stopped by adding sodium hydroxide solution to control the pH to 2.8-3.2, and two-stage high-pressure reversed-phase chromatography was further carried out, and the yield of recombinant human insulin was more than 85%. The expression levels of recombinant human insulin for the different mutant enzymes are shown in the following table. [Table 3]

[0149] The results show that using the mutant enzymes of the invention to prepare target proteins containing Boc-lysine can significantly increase the amount of unnatural amino acid insertion and the amount of target protein containing the unnatural amino acid.

[0150] Example 4. Construction of double-plasmid expression strain and high-density expression of butynyloxycarbonyl group-modified fusion protein The plasmid pEvol-pylRs-pylT, plasmid pEvol-IPYEpylRs-pylT, plasmid pEvol-optpylRs-pylT and plasmid pEvol-IPYEpylRs(L274A, C313S, F349Y)-pylT were co-transformed with insulin fusion protein expression vector pBAD-INS (plasmid constructed by us, Kana resistance) into large E. coli Top10 competent cells (competent cells purchased from Thermo) by chemical method (CaCl2 method), and the transformed cells were cultured overnight at 37 °C in LB agar medium (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl, 1.5% agar) containing 25 μg / mL kanamycin and 17 μg / mL chloramphenicol. Select a single viable colony and culture it overnight at 37 °C and 220 rpm in liquid LB medium (10 g / L yeast peptone, 5 g / L yeast extract powder, 10 g / L NaCl) containing 25 μg / mL kanamycin and 17 μg / mL chloramphenicol. Preserve the strain by adding glycerol to a final concentration of 20%.

[0151] Each strain is inoculated into liquid LB medium and cultured overnight at 37°C and 220 rpm, then 1% (v / v) is inoculated into tank fermentation medium (12 g / L yeast peptone, 24 g / L yeast extract powder, 4 mL / L glycerol, 12.8 g / L disodium hydrogen phosphate, 3 g / L potassium dihydrogen phosphate, 0.3‰ antifoaming agent) and cultured under conditions of 35 (±3)°C, 200-1000 rpm, and air flow rate of 2-6 L / min. After 3-10 hours of culture, supplementary medium containing glycerol and yeast peptone is fed stepwise until fermentation is completed. OD 600 The culture was incubated until the OD reached 25-80, at which point induction was performed by adding L-ara (final concentration: 0.25%) and butynyloxycarbonyl-Lys (final concentration: 5 mM). 600The culture is continued until the pH reaches 180-220, and then the cells are discharged from the tank. They are then collected by centrifugation (5000 rpm, 30 min, 25°C). SDS-polyacrylamide gel electrophoresis is used to detect the expression status of the fusion protein containing butynyloxycarbonyl-modified lysine in the whole cells of each strain. [Table 4]

[0152] The fusion protein is expressed in the form of an insoluble "inclusion body". To release the inclusion bodies, E. coli cells are disrupted with a high-pressure homogenizer. Nucleic acids, cell debris and soluble proteins are removed by centrifugation at 10,000 g. The inclusion bodies containing the fusion protein are washed with pure water, and the resulting inclusion body precipitate is used as the raw material for folding. To refold the fusion protein, the inclusion bodies are dissolved in a 7.5 M urea solution at pH 10.5 containing 2-10 mM mercaptoethanol to a total protein concentration of 10-25 mg / mL after dissolution. The sample is diluted 5-10 times and conventional folding is performed at 4-8 °C and pH 10.5-11.7 for 16-30 h. The fusion protein is enzymatically hydrolyzed with trypsin and carboxypeptidase B for 10-20 hours at 18-25°C, pH value is maintained at 8.0-9.5, and then 0.45M ammonium sulfate is added to stop the enzymatic hydrolysis. The results of reversed-phase HPLC analysis show that the yield of the enzymatic hydrolysis step is higher than 90%. The insulin analog obtained after enzymatic hydrolysis with trypsin and carboxypeptidase B is named butynyloxycarbonyl-lysine insulin. Butynyloxycarbonyl-lysine insulin is not enzymatically hydrolyzed under the above conditions. The sample is clarified by membrane filtration and purified by hydrophobic chromatography for the first time using 0.45mM ammonium sulfate as a buffer, and the purity of SDS-polyacrylamide gel electrophoresis reaches 90%. The molecular weight of the obtained butynyloxycarbonyl-human insulin was detected by MALDI-TOF mass spectrometry, which was consistent with the theoretical molecular weight of 5907.7Da. [Table 5]

[0153] The results show that using the mutant enzymes of the invention to prepare target proteins containing butynyloxycarbonyl group modifications can significantly increase the amount of unnatural amino acid insertion and the amount of target protein containing the unnatural amino acid.

[0154] All documents mentioned in the present invention are incorporated by reference in this application as if each document was incorporated by reference individually. Furthermore, after reading the above teachings of the present invention, those skilled in the art may make various changes or modifications to the present invention, and these equivalents are also included in the scope defined by the appended claims of this application.

Claims

1. A mutant protein of aminoacyl-tRNA synthetase, the amino acid sequence of which is shown in any one of SEQ ID NO.: 3 to 6; The mutant protein.

2. An isolated polynucleotide encoding the mutant protein of claim 1.

3. A vector comprising the polynucleotide of claim 2.

4. A host cell comprising the vector of claim 3 or having integrated into its genome the polynucleotide of claim 2 or expressing the mutant protein of claim 1.

5. (a) a mutant protein according to claim 1; (b) an artificial tRNA capable of binding to a selected modified amino acid in the presence of said mutant protein; and (c) a first nucleic acid sequence encoding a target protein, the first nucleic acid sequence including a codon recognized by said artificial tRNA; The host cell of claim 4 .

6. (1) a first expression cassette comprising a first coding sequence encoding a target protein, said first coding sequence comprising a codon for introducing a predetermined modified amino acid, said codon being UAG (amber), UAA (ochre), or UGA (opal); and (2) A second expression cassette comprising a second coding sequence encoding an aminoacyl-tRNA synthetase, wherein the aminoacyl-tRNA synthetase is the mutant protein of claim 1. wherein the system further comprises a third expression cassette, the third expression cassette comprising a third coding sequence encoding an artificial tRNA, the artificial tRNA comprising an anticodon corresponding to the codon; Also, the aminoacyl-tRNA synthetase specifically catalyzes the artificial tRNA to form an "artificial tRNA-Xa" complex, where Xa is the predetermined modified amino acid in the form of an aminoacyl group.

7. A kit comprising: (a) a container; and (b) a mutant protein described in claim 1, or a polynucleotide described in claim 2, or a vector described in claim 3, or a plasmid system described in claim 6, located within the container.

8. A mutant protein as described in claim 1, or a host cell as described in claim 4, or a plasmid system as described in claim 6, or a kit as described in claim 7, for use in incorporating an unnatural amino acid into a target protein or for preparing a target protein containing an unnatural amino acid.

Images