Lipid nanoparticles and methods of manufacture and use thereof
Antibody-targeted lipid nanoparticles deliver CD22 CAR-encoding mRNA to CD8+ T-cells in vivo, addressing CAR-T cell therapy challenges by enhancing specificity and reducing off-target effects, thereby improving cancer treatment efficacy.
Patent Information
- Application Number
- PCT/US2025/039746
- Authority / Receiving Office
- WO · WO
- Patent Type
- Applications
- Current Assignee / Owner
- Priority Date
- 2025-04-10
- Filing Date
- 2025-07-29
- Publication Date
- 2026-02-05
AI Technical Summary
Current CAR-T cell therapy for cancer treatment faces challenges such as complex and expensive ex vivo production methods, limited efficacy against solid tumors, treatment-associated toxicities, and off-target effects, necessitating a more efficient and targeted delivery platform for mRNA encoding chimeric antigen receptors.
Development of antibody-targeted lipid nanoparticles (LNPs) that encapsulate CD22 CAR-encoding mRNA to selectively reprogram CD8+ T-cells in vivo, using an immunoglobulin single variable domain (ISVD) for targeted delivery and transient functional expression, minimizing off-target effects and enabling repeated dosing.
The approach achieves specific transfection of CD8+ T-cells, reduces undesirable cytokine responses, and mediates tumor cell growth inhibition in humanized mouse models, demonstrating improved tolerability and therapeutic efficacy.
Smart Images

Figure US2025039746_05022026_PF_FP_ABST
Abstract
Description
LIPID NANOPARTICLES AND METHODS OF MANUFACTURE AND USE THEREOFCROSS REFERENCE TO RELATED APPLICATIONS
[0001] This application claims priority benefit to U.S. Provisional Application No.63 / 677,381, filed July 30, 2024, and U.S. Provisional Application No. 63 / 786,916, filed April 10, 2025, the disclosures of each of which are hereby incorporated herein by reference in their entireties for all purposes.REFERENCE TO AN ELECTRONIC SEQUENCE LISTING
[0002] The contents of the electronic sequence listing (183952035440seqlist.xml; Size: 821,053 bytes; and Date of Creation: July 25, 2025) are herein incorporated by reference in their entirety.FIELD
[0003] The present disclosure relates generally to compositions and methods for gene therapy, and more specifically to delivering mRNA-based therapeutics to immune cells in vivo.BACKGROUND
[0004] Genetic modification of T-cells with chimeric antigen receptors (CARs) to target specific diseases has shown impressive clinical responses in patients with hematologic malignancies [1], However, several barriers remain before this therapy is available to a broader patient population. Currently, CAR-T cell therapy production is carried out ex vivo, including genetic modification of the patient’s T-cells in culture before infusing the cells back into the patient [2], The ex vivo methods required to generate sufficient numbers of tumor-specific T- cells are complex thereby hindering widespread application to treat cancer patients [3], Additionally, two CAR-T therapies approved by the U.S. Food and Drug Administration (FDA) are priced at US$373,000 (Yescarta) and US$475,000 (Kymriah), making it economically challenging to provide this personalized treatment to a broader array of cancer patients worldwide [4], Finally, CAR T-cell therapy results in acute and chronic toxicities that limit its overall therapeutic index in cancer patients [5], The onset of immune activation, known as cytokine release syndrome (CRS), is the most prevalent adverse effect following CAR T- cell infusion. Additionally, other side effects reported in patients receiving CAR T-cells include the development of neurological toxicities, on-target / off-tumor recognition, anaphylaxis, andinsertional oncogenesis [6-8], In order to overcome these significant challenges and limitations, more innovative strategies are required to program T-cells to express CARs.
[0005] Particularly, Ex vivo chimeric antigen receptor (CAR) T-cell therapy has proven successful in patients with B-cell hematologic malignancies. However, its broad application still faces significant challenges due to current approaches requiring elaborate and expensive techniques to engineer and manufacture T-cells. Additionally, barriers such as limited efficacy against solid tumors, treatment-associated toxicities, lack of CAR-T cell trafficking to the tumor microenvironment, on-target off-tumor effects, and tumor antigen escape must be overcome.
[0006] In-vitro transcribed (IVT) mRNA has, in recent years, proven an effective technology to express therapeutic proteins and antigens in cells, making it a promising alternative to DNA-based products. By utilizing IVT mRNA, researchers allow for transient protein expression without causing integration into the genome [9-11], and do not require nuclear import or slow cytoplasmic diffusion
[0012] , However, to function in vivo, effective and stable delivery platforms, protecting the mRNA from degradation and allowing for specific target cell uptake, are required
[0013] , One such delivery system that has entered the clinic and proven successful is lipid nanoparticles (LNPs), employing an ionizable cationic lipid to condense nucleic acids into a relatively uniform solid lipid nanoparticle approximating 100 nm in diameter [14-16], Remarkably, the recent authorization of two coronavirus (COVID-19) vaccines [17, 18] utilizing LNPs to deliver mRNA intramuscularly stands out as noticeable examples. However, to date, the use and design of LNPs for systemic delivery have primarily allowed for cellular uptake by hepatocytes and Kupffer cells of the liver [19, 20], To solve this, the advantages of adding targeting ligands to nanoparticles and thereby guiding the specificity and delivery of a nucleic acid payload toward a cell type of interest have been shown [21-33],
[0007] Thus, what is needed is a delivery platform that overcomes some of the barriers in existing T-cell therapies. More particularly, what is needed is a delivery platform that overcomes some of the barriers in existing CAR T-cell therapies for B-cell hematologic malignancies.BRIEF SUMMARY
[0008] In one aspect, provided herein is a lipid nanoparticle (LNP) comprising: (a) a lipid- immune cell targeting group conjugate comprising the compound of Formula (II): [Lipid] -[optional linker] - [antibody], (b) an ionizable cationic lipid, and (c) a nucleic acid wherein the nucleic acid is encapsulated in the LNP. In some embodiments, the antibody is an immunoglobulin single variable domain (ISVD) that specifically binds to human CD8alpha. In some embodiments, the ISVD comprises complementarity-determining regions 1 (CDR1), 2 (CDR2), and 3 (CDR3) of an ISVD having the sequence selected from the group consisting of SEQ ID NOs: 160 to 179. In some embodiments, the antibody is an ISVD that specifically binds to human CD8alpha, and the nucleic acid encodes a polypeptide comprising CD22- chimeric antigen receptor (CAR).
[0009] In another aspect, provided herein is an immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha. In some embodiments, the ISVD essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively). In some embodiments, CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of the amino acid sequence of SEQ ID NO: 244; amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 244; and amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 244. In some embodiments, CDR2 (according to AbM definition) has an amino acid sequence selected from the group consisting of: the amino acid sequence of SEQ ID NO: 246; amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 246; and amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 246. In some embodiments, CDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: the amino acid sequence of SEQ ID NO: 248; amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 248; and amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 248.
[0010] In another aspect, provided herein is a conjugate comprising an ISVD linked to a phospholipid-PEG-maleimide derivative.
[0011] In another aspect, provided herein is a method for the preparation of a composition comprising monomers of an ISVD with a cysteine containing linker at its C-terminal end. In some embodiments, the method comprises the following sequential steps: (a) reducing a composition comprising ISVD dimers to ISVD monomers with a first reducing agent, wherein the ISVD dimers are formed through the cysteine containing linker at the C-terminal end of theISVD; (b) purifying the ISVD monomers obtained in step (a) to get a purified composition comprising the ISVD monomers; (c) reducing the purified composition obtained in step (b) with a second reducing agent; and (d) purifying the reduced composition obtained in step (c) to obtain a composition comprising monomers of the ISVD.
[0012] In another aspect, provided herein is a method for the preparation of a phospholipid- PEG-ISVD conjugate. In some embodiments, the method comprises the following sequential steps: (a) mixing a first composition comprising monomers of an ISVD comprising a cysteine containing linker, with a second composition comprising phospholipid-PEG molecules comprising a bioconjugation linker under conditions that the phospholipid-PEG molecules and the ISVD monomers can form a conjugate through clicking chemistry; and (b) adding cysteine to the conjugate obtained in step (a) under conditions that the conjugation reaction is quenched, wherein a composition comprising the phospholipid-PEG ISVD conjugate is obtained.
[0013] In one aspect, provided herein is a novel delivery platform, employing targeted lipid nanoparticles (LNPs) encapsulating CD22 CAR-encoding mRNA to reprogram circulating human T-cells in vivo, thus providing a strategy for overcoming some of these barriers. In some embodiments, the approach can be utilized to deliver mRNA encoding a novel CD22 CAR specifically to CD8+T-cell using an immunoglobulin single variable domain (ISVD)-based targeting moiety, thereby enabling transient functional CAR expression in vitro and in vivo. In some embodiments, the targeted LNP formulation allows for repeated dosing strategies while minimizing off-target cell mRNA expression. In some embodiments, the in vivo reprogramming of non-stimulated T-cells to express a CD22 CAR mediates tumor cell growth inhibition in a humanized Nalm6 cancer mouse model.
[0014] In one aspect, provided herein is a novel approach to selectively reprogram human CD8+ T-cells in vivo by delivering IVT mRNA via antibody-targeted LNPs. In some embodiments, the clinical relevance of the technology is shown by specifically delivering mRNA encoding a novel CD22 CAR to T-cells in vivo. In some embodiments, functional CAR-mediated cancer cell killing in a humanized mouse model is reported. In some embodiments, de-targeting of the liver and lung, as well as off-target immune cell populations in the blood, is achieved through careful engineering of the surface charge, pegylation strategy, and particle size, allowing for relatively specific transfection of CD8+ T-cells. In some embodiments, the tolerability is improved through decrease in undesirable cytokine responsesvia meticulous design and selection of the ionizable lipid, targeting ligand, and CAR sequence, and by limiting the presence of mRNA impurities, including double-stranded mRNA.
[0015] The present disclosure provides lipid nanoparticles (LNPs). In some embodiments, the LNPs comprise a lipid-immune cell targeting group conjugate comprising (a) the compound of Formula (II): [Lipid] - [optional linker] - [antibody]. In some embodiments, the LNPs further comprise (b) an ionizable cationic lipid. In some embodiments, the LNPs further comprise (c) a nucleic acid, wherein the nucleic acid is encapsulated in the LNP. In some embodiments, the antibody is an immunoglobulin single variable domain (ISVD) that specifically binds to human CD8alpha. In some embodiments, the ISVD comprises complementarity-determining regions 1 (CDR1), 2 (CDR2), and 3 (CDR3) of an ISVD having the sequence selected from the group consisting of SEQ ID NOs: 160 to 179. In some embodiments, the antibody is an ISVD that specifically binds to human CD8alpha, and the nucleic acid encodes a polypeptide comprising CD22-chimeric antigen receptor (CAR). In some embodiments, the ISVD comprises complementarity-determining regions 1 (CDR1), 2 (CDR2), and 3 (CDR3) of an ISVD having the sequence selected from the group consisting of SEQ ID NOs: 160 to 179, and the nucleic acid encodes a polypeptide comprising CD22- chimeric antigen receptor (CAR).
[0016] In some embodiments, the ISVD specifically binding to CD8alpha comprises CDR1, CDR2, and CDR3 according to the Abm CDR definition, and CDR1 is chosen from the group consisting of: (i) SEQ ID NO: 244; and (ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 244. In some embodiments, CDR2 is chosen from the group consisting of: (i) SEQ ID NO: 246; and (ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 246. In some embodiments, CDR3 is chosen from the group consisting of (i) SEQ ID NO: 248 and (ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 248.
[0017] In some embodiments, the antibody of the LNPs specifically binds to human CD8alpha is covalently coupled to the Lipid in Formula (II) via a linker comprising polyethylene glycol (PEG). In some embodiments, the Lipid in Formula (II) covalently coupled to the antibody is di stearoylglycerol (DSG), distearoyl-phosphatidylethanolamine (DSPE), dimyrstoyl-phosphatidylethanolamine (DMPE), distearoyl-glycero-phosphoglycerol (DSPG),dimyristoyl-glycerol (DMG), dipalmitoyl-phosphatidylethanolamine (DPPE), dipalmitoylglycerol (DPG), or ceramide.
[0018] In some embodiments, the Lipid in Formula (II) covalently coupled to the antibody is DSPE. In some embodiments, the PEG has a molecular weight of about Ik Daltons to about 5k Daltons. In some embodiments, the PEG is PEG 3400 (PEG 3.4K).
[0019] In some embodiments, the immunoglobulin single variable domain comprises SEQ ID NO: 9, SEQ ID NO: 169 or SEQ ID NO: 44, or a sequence having at least 85%, at least 90%, at least 95%, at least 99% identity to SEQ ID NO: 9, SEQ ID NO: 169 or SEQ ID NO: 44.
[0020] In some embodiments, the LNPs further comprise a structural lipid, a neutral phospholipid, or a free PEG-lipid, or any combination thereof.
[0021] In some embodiments, the structural lipid comprises or is sterol. In some embodiments, the sterol comprises or is cholesterol. In some embodiments, the neutral phospholipid is selected from the group consisting of phosphatidylcholine, phosphatidylethanolamine, distearoyl-sn-glycero-3 -phosphoethanolamine (DSPE), 1,2- distearoyl-sn-glycero-3-phosphocholine (DSPC), l,2-dioleoyl-sn-glycero-3- phosphoethanolamine (DOPE), l,2-dioleoyl-sn-glycero-3 -phosphocholine (DOPC), and sphingomyelin. In some embodiments, the neutral phospholipid comprises or is DSPC.
[0022] In some embodiments, the free PEG-lipid is selected from the group consisting of PEG-modified phosphatidylethanolamines, PEG-modified phosphatidic acids, PEG-modified ceramides, PEG-modified dialkylamines, PEG-modified diacylglycerols, and PEG-modified dialkylglycerols. In some embodiments, the free PEG lipid is PEG-dioleoylgylcerol (PEGDOG), PEG-dimyristoyl-glycerol (PEG-DMG), PEG-dipalmitoyl-glycerol (PEG-DPG), PEG- dilinoleoyl-glycero-phosphatidyl ethanolamine (PEG-DLPE), PEG-dimyrstoyl- phosphatidylethanolamine (PEG-DMPE), PEG-dipalmitoyl- phosphatidylethanolamine (PEG- DPPE), PEG-di stearoylglycerol (PEG-DSG), PEG-diacylglycerol (PEG-DAG), PEG- ceramide, PEG-di stearoyl -glycero-phosphoglycerol (PEG-DSPG), PEG-dioleoyl-glycero- phosphoethanolamine (PEG-DOPE), 2-[(polyethylene glycol)-2000]-N,N- ditetradecylacetamide, diacylphosphatidylethanolamine comprising Dipalmitoyl (Cl 6) chain or Distearoyl (C18) chain, or a PEG-distearoyl-phosphatidylethanolamine (PEG-DSPE) lipid. In some embodiments, the PEG-lipid comprises PEG-DMG, PEG-DPG, or PEG-DSG, or anycombination thereof. In some embodiments, free PEG-lipid comprises PEG-DPG. In some embodiments, the PEG-DPG comprises or is PEG 2000-DPG (DPG-PEG 2000).
[0023] In some embodiments, the nucleic acid comprises or is RNA. In some embodiments, the RNA comprises or is mRNA. In some embodiments, the mRNA encodes a synthetic T cell receptor (synTCR) or a Chimeric Antigen Receptor (CAR). In some embodiments, the mRNA comprises a 5’ Cap, a 5’ untranslated region (UTR), a sequence encoding a polypeptide, a 3’ UTR, and optionally a poly A tail.
[0024] In some embodiments, the nucleic acid comprises (1) optionally, a 5’ cap; (2) optionally, a 5’ UTR region; (3) optionally, nucleotides encoding a Lead peptide sequence; (4) nucleotides encoding an antibody heavy chain variable region (VH); (5) optionally, nucleotides encoding a Linker A; (6) nucleotides encoding an antibody light chain variable region (VL); (7) nucleotides encoding a Linker B, (8) nucleotides encoding a Hinge domain; (9) nucleotides encoding a Transmembrane domain; (10) nucleotides encoding a Co-stimulatory domain; (11) nucleotides encoding a Signaling domain; (12) optionally, a 3’ UTR region; and (13) optionally, a polyA tail.
[0025] In some embodiments, the nucleic acid comprises the following formula, arranged from 5’ to 3’: 5’ UTR (optional) - nucleotides encoding the Lead peptide sequence (optional)- nucleotides encoding the antibody heavy chain variable region (VH) - nucleotides encoding the Linker A (optional) - nucleotides encoding the antibody light chain variable region (VL) - nucleotides encoding Linker B (optional) - nucleotides encoding the Hinge - nucleotides encoding the Transmembrane domain - nucleotides encoding the Co-stimulatory domain - nucleotides encoding the Signaling domain - 3’ UTR (optional).
[0026] In some embodiments, the polypeptide encoded by the nucleic acid comprises an antibody specifically binding to B-cell, a Hinge domain and a Transmembrane domain (Hinge and Transmembrane domains), a Co-stimulatory domain, and a Signaling domain.
[0027] In some embodiments, the polypeptide encoded by the nucleic acid comprises the following formula, arranged from N-terminus to C-terminus: [Lead peptide sequence (optional)] - [antibody specifically binding to B-cell] - [Linker B (optional)] - [Hinge domain]- [Transmembrane domain] - [Co-stimulatory domain] - [Signaling domain].
[0028] In some embodiments, the optional Lead peptide sequence comprises a signal peptide. In some embodiments, the signal peptide is derived from CD8 (SEQ ID NO: 565). In some embodiments, the signal peptide comprises SEQ ID NO: 515 or SEQ ID NO: 520, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or higher identity to SEQ ID NO: 515 or SEQ ID NO: 520.
[0029] In some embodiments, the antibody specifically binding to B-cell comprises the following formula: [antibody specifically binding to B-cell, heavy chain variable region (VH)] - [Linker A (optional)] - [antibody specifically binding to B-cell, light chain variable region (VL)]. In some embodiments, the antibody specifically binding to B-cell is an antibody that specifically binds to human CD22. In some embodiments, the antibody specifically binding to B-cell comprises an anti-CD22 ScFv. In some embodiments, the anti-CD22 ScFV comprises a heavy chain variable (VH) domain and an antibody light chain variable (VL) domain, wherein the VH and VL domains comprise: (1) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 433 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 434; (2) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 447 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 448; (3) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 457 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 458; (4) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 481 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 482; (5) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 495 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 496; (6) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 509 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 510; (7) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chainvariable region (VH) comprising the amino acid sequence of SEQ ID NO: 523 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 524; (8) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 525 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 526; (9) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 527 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 528; (10) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 529 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 530; or (11) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 531 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 532.
[0030] In some embodiments, the VH domain of the anti-CD22 ScFV comprises a CDR- H1 sequence comprising the amino acid sequence of SYGMH (SEQ ID NO: 427), a CDR-H2 sequence comprising the amino acid sequence of IIYYDGSKKYYADSVKG (SEQ ID NO: 428), and a CDR-H3 sequence comprising the amino acid sequence of ELTGDAFDI (SEQ ID NO: 429); and the VL domain of the anti-CD22 ScFV comprises a CDR-L1 sequence comprising the amino acid sequence of RASQSIGSSLH (SEQ ID NO: 430), a CDR-L2 sequence comprising the amino acid sequence of YASQSFS (SEQ ID NO:431), and a CDR- L3 sequence comprising the amino acid sequence of HQSSTLPYT (SEQ ID NO: 432). In some embodiments, the anti-CD22 ScFV comprises a VH domain comprising SEQ ID NO: 523, and a VL domain comprising SEQ ID NO: 524.
[0031] In some embodiments, the VH domain and the VL domain is connected through Linker A, wherein the Linker A is selected from the group consisting of SEQ ID Nos 337-348. In some embodiments, the Linker A is (GGGGS)4 (SEQ ID NO: 344).
[0032] In some embodiments, the Linker B is AS or AAA. In some embodiments, the hinge and transmembrane domains are derived from CD 8 hinge and transmembrane domains.
[0033] In some embodiments, the hinge and transmembrane domains comprise SEQ ID NO: 538, SEQ ID NO: 539, or SEQ ID NO: 540. In some embodiments, the hinge and transmembrane domains are derived from CD28 hinge and transmembrane domains. In some embodiments, the CD28 hinge and transmembrane domains have the amino acid sequence selected from the group consisting of (i) SEQ ID NO: 522; (ii) sequences having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or higher identity with SEQ ID NO: 522; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 522.
[0034] In some embodiments, the Co-stimulatory domain is a CD28 Co-stimulatory domain. In some embodiments, the CD28 Co-stimulatory domain comprises SEQ ID NO: 543.
[0035] In some embodiments, the Signaling domain is derived from a CD3z signaling domain. In some embodiments, the Signaling domain has the amino acid sequence selected from the group consisting of (i) sequence of SEQ ID NO: 544; (ii) sequences that have at least 80% sequence identity with SEQ ID NO: 544; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 544.
[0036] In some embodiments, the polypeptide encoded by the nucleic acid comprises or consists of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127. In some embodiments, the nucleic acid sequence encoding a polypeptide comprises a sequence encoding the polypeptide of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127.
[0037] In some embodiments, the nucleic acid sequence comprises SEQ ID NO: 108, SEQ ID NO: 124, or SEQ ID NO: 125. In some embodiments, the nucleic acid sequence comprises SEQ ID NO: 139 or SEQ ID NO: 147.
[0038] In some embodiments, the nucleic acid comprises pseudouridine. In some embodiments, the pseudouridine is N1 -methyl -pseudouridine.
[0039] In some embodiments, the ionizable cationic lipid of the LNPs comprises a compound of Formula (I):or a salt thereof, or both.
[0040] In some embodiments, Rl, R2, and R3 are each independently a bond or Cl -3 alkylene; RIA, R2A, and R3A are each independently a bond or Cl -10 alkylene; R1A1, R1A2, R1A3, R2A1, R2A2, R2A3, R3A1, R3A2, and R3A3 are each independently H, Cl-20 alkyl, Cl-20 alkenyl, -(CH2)0-10C(O)ORal, or -(CH2)0-100C(0)Ra2; Rai and Ra2 are each independently Cl-20 alkyl or Cl-20 alkenyl;alkylene; and R3B2 and R3B3 are each independently H, unsubstituted Cl -6 alkyl, or Cl -6 alkyl substituted with 1 or 2 -OH. In some embodiments, Rl, R2, and R3 are each independently a bond or methylene; RIA and R2A are each Cl-10 alkylene; R3A is Cl-5 alkylene; R1A1, R1A2, R2A1, R2A2, R3A1, and R3A2 are each H; R1A3 and R2A3 are each Cl-20 alkenyl;R3A3 is -C(O)O(Cl-20 alkyl);alkylene; and R3B2 and R3B3 are each methyl. In some embodiments, R3B1 is -(CH2)3-. In some embodiments, the ionizable cationic lipid comprisessalt thereof, or both.
[0041] In some embodiments, the cationic lipid has a concentration between about 10 mol% and about 60 mol% of the LNP. In some embodiments, the LNP comprises cationic lipid at a concentration between about 49 mol% and about 50 mol% of the LNP, such as about 49.1, 49.2, 49.3, 49.4, 49.5, 49.6, 49.7, 49.8, or 49.9 mol%.
[0042] In some embodiments, the LNP comprises cholesterol at a concentration between about 25 mol% and about 45 mol% of the LNP. In some embodiments, the LNP comprises cholesterol at a concentration between about 25 mol% and about 30 mol% of the LNP, such as about 25, 26, 27, 28, 29, or 30 mol%.
[0043] In some embodiments, the LNP comprises DSPC at a concentration between about 5 mol% and about 25% mol% of the LNP. In some embodiments, the LNP comprises DSPC at a concentration between about 9 mol% and about 21 mol% of the LNP.
[0044] In some embodiments, the LNP comprises DPG-PEG2K at a concentration between about 0.5 mol% and about 2.5 mol% of the LNP. In some embodiments, the LNP comprises DPG-PEG2K at a concentration between about 1.4 mol% and about 1.6 mol% of the LNP.
[0045] In some embodiments, the LNP comprises cationic lipid at a concentration between about 10 and about 20 g per gram of mRNA in the LNP. In some embodiments, the LNP comprises cholesterol at a concentration between about 3.0 and about 5.0 g per gram of mRNA in the LNP. In some embodiments, the LNP comprises DSPC at a concentration between about 2.0 and about 5.0 g per gram of mRNA in the LNP. In some embodiments, the LNP comprises DPG-PEG2K at a concentration between about 1.0 and about 1.5 g per gram of mRNA in the LNP.
[0046] In some embodiments, the LNP comprises DSPE-PEG3.4K-antibody conjugate at a concentration between about 0.05 to 0.1 g per gram of mRNA in the LNP. In some embodiments, the cationic lipid has a concentration about 49.2 mol% of the LNP; the cholesterol has a concentration about 39.4 mol% of the LNP; the DSPC has a concentration about 9.8 mol% of the LNP; and the DPG-PEG2K has a concentration about 1.5 mol% of the LNP.
[0047] In some embodiments, the cationic lipid has a concentration about 49.2 mol% of the LNP; the cholesterol has a concentration about 29.3 mol% of the LNP; the DSPC has aconcentration about 20.0 mol% of the LNP; and the DPG-PEG2K has a concentration about 1.5 mol% of the LNP.
[0048] In some embodiments, the cationic lipid has a concentration about 14.2 g / g mRNA in the LNP; the cholesterol has a concentration about 4.64 g / g mRNA in the LNP; the DSPC has a concentration about 2.37 g / g mRNA in the LNP; the DPG-PEG2K has a concentration about 1.15 g / g mRNA in the LNP; and the DSPE-PEG3.4K-anti-CD8 antibody conjugate has a concentration about 0.084 g / g to 0.15 g / g mRNA in the LNP.
[0049] The present disclosure also provides isolated polynucleotides that have the following formula, arranged from 5’ to 3’ : 5 ’Cap (optional) - 5’ UTR (optional) - nucleotides encoding a Lead peptide sequence (optional) - nucleotides encoding an antibody heavy chain variable region (VH) - nucleotides encoding a Linker A (optional) - nucleotides encoding an antibody light chain variable region (VL) - nucleotides encoding Linker B (optional) - nucleotides encoding a Hinge - nucleotides encoding a Transmembrane domain - nucleotides encoding Co-stimulatory domain - nucleotides encoding Signaling domain - 3’ UTR (optional) - polyA tail (optional), wherein the VH and VL form a binding domain that specifically binds to human B-cell. In some embodiments, the VH and VL forms a binding domain that specifically binds to human CD22. In some embodiments, the VH, the Linker A, and VL form an anti-CD22 ScFv. In some embodiments, the VH and VL domain comprises: (1) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 433 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 434; (2) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 447 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 448; (3) complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 457 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 458; (4) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 481 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 482; (5) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chainvariable region (VH) comprising the amino acid sequence of SEQ ID NO: 495 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 496; (6) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 509 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 510; (7) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 523 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 524; (8) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 525 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 526; (9) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 527 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 528; (10) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 529 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 530; or (11) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 531 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 532. In some embodiments, the VH domain of the anti-CD22 ScFV comprises a CDR-H1 sequence comprising the amino acid sequence of SYGMH (SEQ ID NO: 427), a CDR-H2 sequence comprising the amino acid sequence of IIYYDGSKKYYADSVKG (SEQ ID NO: 428), and a CDR-H3 sequence comprising the amino acid sequence of ELTGDAFDI (SEQ ID NO: 429); and the VL domain of the anti-CD22 ScFV comprises a CDR-L1 sequence comprising the amino acid sequence of RASQSIGSSLH (SEQ ID NO: 430), a CDR-L2 sequence comprising the amino acid sequence of YASQSFS (SEQ ID NO:431), and a CDR-L3 sequence comprising the amino acid sequence of HQSSTLPYT (SEQ ID NO: 432). In some embodiments, the anti-CD22 ScFV comprises a VH domain comprising SEQ ID NO: 523, and a VL domain comprising SEQ ID NO: 524. In some embodiments, the VH domain and the VL domain is connected through a Linker A, wherein the Linker A is selected from the group consisting of SEQ ID Nos 337-348. In some embodiments, the Linker A is (GGGGS)4 (SEQ ID NO: 344). In some embodiments, theLinker B is AS or AAA. In some embodiments, the hinge and transmembrane domains are derived from CD8 hinge and transmembrane domains. In some embodiments, the hinge and transmembrane domains have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, at least 98%, at least 99%, or 100% identity with SEQ ID NO: 538, SEQ ID NO: 539, or SEQ ID NO: 540. In some embodiments, the hinge and transmembrane domains comprise SEQ ID NO: 538, SEQ ID NO: 539, or SEQ ID NO: 540. In some embodiments, the hinge and transmembrane domains are derived from CD28 hinge and transmembrane domains. In some embodiments, the CD28 hinge and transmembrane domains have the amino acid sequence selected from the group consisting of (i) sequence of SEQ ID NO. 522; (ii) sequences that have at least 80% sequence identity with SEQ ID NO: 522; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 522. In some embodiments, the Co-stimulatory domain is a CD28 Co-stimulatory domain. In some embodiments, the CD28 Co-stimulatory domain has the amino acid sequence selected from the group consisting of (i) sequence of SEQ ID NO: 544; (ii) sequences that have at least 80% sequence identity with SEQ ID NO: 544; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 544. In some embodiments, the Signaling domain is derived from a CD3z signaling domain. In some embodiments, the Signaling domain comprises or consists of SEQ ID NO: 544. In some embodiments, the polypeptide encoded by the polynucleotide comprises or consists of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127. In some embodiments, the polynucleotide encoding a polypeptide comprises a sequence encoding the polypeptide of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127. In some embodiments, the polynucleotide comprises SEQ ID NO: 108, SEQ ID NO: 124, or SEQ ID NO: 125, or the corresponding DNA sequence. In some embodiments, the nucleic acid sequence comprises SEQ ID NO: 139 or SEQ ID NO: 147, or the corresponding DNA sequence. In some embodiments, the nucleic acid comprises pseudouridine. In some embodiments, the pseudouridine is Nl-methyl-pseudouridine.
[0050] The present disclosure also provides expression constructs comprising a polynucleotide described here.
[0051] The present disclosure also provides vectors comprising the expression construction described herein.
[0052] The present disclosure also provides host cells comprising the expression construct described herein.
[0053] The present disclosure also provides in vitro transcribed mRNA derived from the isolated polynucleotide described herein.
[0054] The present disclosure also provides immune cells comprising the in vitro transcribed mRNA described herein.
[0055] The present disclosure also provides recombinant polypeptides encoded by the isolated polynucleotide described herein.
[0056] The present disclosure also provides immune cells expressing the recombinant polypeptide described herein.
[0057] The present disclosure further provides methods of producing a polypeptide of interest in a cell, tissue, or bodily fluid of a subject. In some embodiments, the method comprises using the isolated polynucleotide as described herein.
[0058] The present disclosure further provides methods of preparing LNPs. In some embodiments, the method comprises combining the isolated polynucleotide described herein with mixture of lipids.
[0059] Also provided in the present disclosure, are pharmaceutical compositions. In some embodiments, the pharmaceutical compositions comprise LNPs as described herein. In some embodiments, the pharmaceutical compositions comprise the isolated polynucleotide as described herein. In some embodiments, the pharmaceutical compositions comprise the expression construct as described herein. In some embodiments, the pharmaceutical compositions comprise the vector as described herein. In some embodiments, the pharmaceutical compositions comprise the host cell and / or the recombinant polypeptide as described herein.
[0060] Also provided in the present disclosure, are methods of delivering a nucleic acid sequence into a human cell. In some embodiments, the methods comprise using the LNP of the present disclosure. In some embodiments, the LNP comprises the nucleic acid sequence to be delivered.
[0061] Also provided in the present disclosure, are methods of modulating immune response in a human subject. In some embodiments, the method comprises administering the LNP of the present disclosure, the isolated polynucleotide of the present disclosure, theexpression construct of the present disclosure, the vector of the present disclosure, and / or the host cell of the present disclosure to the human subject, and / or expressing the recombinant polypeptide of the present disclosure in the human subject.
[0062] The present disclosure further provides methods of treating B-cell malignancy in a human subject in need thereof. In some embodiments, the methods comprise administering the LNP of the present disclosure, the isolated polynucleotide of the present disclosure, the expression construct of the present disclosure, the vector of the present disclosure, and / or the host cell of the present disclosure to the human subject, and / or expressing the recombinant polypeptide of the present disclosure in the human subject. In some embodiments, the B-cell malignancy is a B-cell lymphoma. In some embodiments, the B-cell lymphoma is diffuse large B-cell lymphoma (DLBCL).
[0063] The present disclosure further provides methods use of the LNPs, the isolated polynucleotides, the expression constructs, the vectors, the host cells and / or the pharmaceutical composition as described herein for the manufacture of a medicament for the treatment of a B- cell malignancy.
[0064] The present disclosure further provides methods use of the LNP of the present disclosure for the manufacture of a medicament for delivering a nucleic acid to a target cell. In some embodiments, the target cell is an immune cell.
[0065] The present disclosure further provides immunoglobulin single variable domains (ISVDs). In some embodiments, the ISVDs specifically bind human CD8alpha. In some embodiments, the ISVDs essentially consist of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively).
[0066] In some embodiments, in the ISVDs of the present disclosure, (i) CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 244; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 244; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 244; and (ii) CDR2 (according to AbM definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 246, e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 246; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the aminoacid sequence of SEQ ID NO: 246; and (iii) CDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 248; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 248; and amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 248.
[0067] In some embodiments, in the ISVDs, the amino acid sequences of the CDRs (according to AbM definition) have at least 80% amino acid sequence identity, more preferably at least 90% amino acid sequence identity, such as 95% amino acid sequence identity or 99% amino acid sequence identity or more, or even essentially 100% amino acid sequence identity with the amino acid sequences of the CDRs of the ISVD with the amino acid sequence selected from the group consisting of SEQ ID NOs: 169 and SEQ ID NOsl60 to 168, SEQ ID NOs: 28- 36 and 44, and SEQ ID NOs: 10 to 27.
[0068] In some embodiments, in the ISVDs described herein, CDR1 consists of the amino acid sequence of SEQ ID NO: 244; CDR2 consists of the amino acid sequence of SEQ ID NO: 246; and CDR3 consists of the amino acid sequence of SEQ ID NO: 248.
[0069] In some embodiments, the immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: (i) CDR1 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 314; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 314; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 314; and (ii) CDR2 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 316; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 316; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 316; and (iii) CDR3 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 318; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 318; and amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 318. In some embodiments, the amino acid sequences of the CDRs(according to Kabat definition) have at least 80% amino acid sequence identity, more preferably at least 90% amino acid sequence identity, such as 95% amino acid sequence identity or 99% amino acid sequence identity or more, or even essentially 100% amino acid sequence identity with the amino acid sequences of the CDRs of the ISVD with the amino acid sequence selected from the group consisting of SEQ ID NO: 179 and SEQ ID NOs 170 to 178.
[0070] In some embodiments, in the ISVDs described herein, CDR1 consists of the amino acid sequence of SEQ ID NO: 314; CDR2 consists of the amino acid sequence of SEQ ID NO: 316; and CDR3 consists of the amino acid sequence of SEQ ID NO: 318.
[0071] In some embodiments, in the ISVDs described herein, amino acid sequence of the ISVDs has 80% amino acid sequence identity with one of the amino acid sequences of SEQ ID NO: 169, SEQ ID Nos: 160 to 168, and SEQ ID Nos: 28-36 and 44, or any one of SEQ ID Nos: 10 to 27, in which for the purposes of determining the degree of amino acid identity, the amino acid residues that form the CDR sequences are disregarded; and preferably one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table A.
[0072] In some embodiments, the ISVDs described herein essentially consist of a heavy chain variable domain sequence that is derived from a conventional four-chain antibody or that essentially consist of a heavy chain variable domain sequence that is derived from heavy chain antibody. In some embodiments, the ISVDs essentially consist of a VHH, a humanized VHH, a camelized VH, a domain antibody, a single domain antibody, or a dAb, or any combination thereof. In some embodiments, the ISVD is a humanized ISVD. In some embodiments, the human ISVD is chosen from the group consisting of SEQ ID NO: 9, SEQ ID NO: 169 (EVQLVESGGGVVQPGGSLRLSCAASGFTFEDYAIGWFRQAPGKEREEVSCIRTYDE QTYYADSVKGRFTISRDNAKNTVSLQMNSLRPEDTALYYCAAGSYYACAYYSRPDP SEGHVDLDYWGQGTLVTVSS) and SEQ ID NOs 160 to 168, and SEQ ID NOs 28-36 and 44, or any one of SEQ ID Nos: 10 to 27, or from the group consisting of amino acid sequences that have more than 80%, preferably more than 90%, more preferably more than 95%, such as 99% or more amino acid sequence identity with at least one of the amino acid sequences of SEQ ID NO: 9, SEQ ID NO: 169 and SEQ ID NO 160 to 168, and SEQ ID NOs 28-36 and 44, or any one of SEQ ID Nos: 10 to 27.
[0073] In some embodiments, the ISVDs described herein comprise the amino acid sequence chosen from the group consisting of SEQ ID NO: 9, SEQ ID NO: 169 and SEQ ID NOs: 160 to 168, and SEQ ID NOs: 28-36 and 44, or any one of SEQ ID Nos: 10 to 27.
[0074] In some embodiments, the ISVDs described herein specifically bind to human CD8a with a dissociation constant (KD) of 5.10’9to 10’11moles / litre or less, and preferably 10’9to 5.10'11moles / litre or less and more preferably 5.1 O’10to 10’10moles / litre, as determined by Surface Plasmon Resonance.
[0075] In some embodiments, the ISVDs described herein specifically bind to human CD8a with a kon-rate of between 105M^s’1to about 107M’1, preferably between 5.105M’ and 107M’1, more preferably between 106M^s’1and 107M’1, such as between 106M’ and 5.106M’1, as determined by Surface Plasmon Resonance.
[0076] In some embodiments, the ISVDs described herein specifically bind to humanCD8a with a koff rate between 10’3s'1(tl / 2=0.69 s) and 10’6s'1(providing a near irreversible complex with a 11 / 2 of multiple days), preferably between 10’3s'1and 5.10’6s’1, more preferably between 5.1 O’4s’1and 5.1 O’6s’1, such as between 5.1 O’4s’1and 10’5s’1, as determined by Surface Plasmon Resonance.
[0077] In some embodiments, the ISVDs described herein specifically bind to human and cyno CD8a and does not bind to other T-cell surface glycoproteins.
[0078] In some embodiments, the ISVDs described herein antagonize an activity of CD8a, CD8a homodimer, and / or CD8a / CD8p heterodimer.
[0079] In some embodiments, the ISVDs described herein block the interaction of human CD8 co-receptor with human Major Histocompatibility Complex (MHC) class I protein with a potency (EC50 value) of 10-8 M or lower, more preferably of 10’9M or lower, or even of 5.10’10M or lower, such as between 10’11M and 10’8M, between 10’10M and 10’9M, between 10’10M and 10’8M or between 10’11M and 10’9M, for example, as measured in a FACS binding assay.
[0080] In some embodiments, the ISVDs described herein block the interaction of cyno CD8 co-receptor with cyno Major Histocompatibility Complex (MHC) class I protein with a potency (EC50 value) of 10’8M or lower, more preferably of 10’9M or lower, or even of 5.10’10M or lower, such as between 10'11M and 10'8M, between IO'10M and 10'9M, between 10’10M and 10'8M or between 10'11M and 10'9M, for example, as measured in a FACS binding assay.
[0081] In some embodiments, the ISVDs described herein block the binding of hCD8 coreceptor to hMHC class I protein by at least 50%, such as at least 60%, 70%, 80%, 90%, 95%, 99% or even more, as determined by ligand competition, AlphaScreen, or competitive binding assays (such as competition ELISA or competition FACS).
[0082] In some embodiments, the ISVDs described herein block the interaction of CD8 coreceptor with lymphocyte-specific protein tyrosine kinase with a potency (EC50 value) of 10'8M or lower, more preferably of 10'9M or lower, or even of 5.10'10M or lower, such as between 10'11M and 10'8M, between 10'10M and 10'8M, between 10'10M and 10'9M or between 10’11M and 10'9M, as determined in a functional assay.
[0083] The present disclosure further provides polypeptides or constructs that comprises or essentially consists of one or more ISVDs described herein, or nucleic sequences encoding the ISVDs. In some embodiments, the polypeptides or constructs optionally further comprise one or more other groups, residues, moi eties or binding units, optionally linked via one or more linkers. In some embodiments, said one or more other groups, residues, moieties or binding units are amino acid sequences. In some embodiments, said one or more linkers are one or more amino acid sequences. In some embodiments, said one or more other groups, residues, moieties or binding units are immunoglobulin sequences. In some embodiments, said one or more other groups, residues, moieties or binding units are ISVDs. In some embodiments, said one or more other groups, residues, moieties or binding units are chosen from the group consisting of VHHs, humanized VHHs, camelized VHs, domain antibodies, single domain antibodies and dAbs. In some embodiments, the construct as described herein is a multivalent construct. In some embodiments, the is a multispecific construct. In some embodiments, said one or more other groups, residues, moieties or binding units provide the polypeptide or construct with increased half-life, compared to the ISVD without the one or more other groups, residues, moieties or binding units.
[0084] In some embodiments, said one or more other groups, residues, moieties or binding units that provide the polypeptide or construct with increased half-life is chosen from the group consisting of a polyethylene glycol molecule (PEG), serum proteins or fragments thereof,binding units that specifically bind to serum proteins, an Fc portion, and small proteins or peptides that specifically bind to serum proteins.
[0085] In some embodiments, said one or more other groups, residues, moieties or binding units that provide the polypeptide or construct with increased half-life is chosen from the group consisting of human serum albumin or fragments thereof.
[0086] In some embodiments, said one or more other groups, residues, moieties or binding units that provides the polypeptide or construct with increased half-life are chosen from the group consisting of binding units that specifically bind to serum albumin (such as human serum albumin) or a serum immunoglobulin (such as IgG).
[0087] In some embodiments, said one or more other groups, residues, moieties or binding units that provides the polypeptide or construct with increased half-life are chosen from the group consisting of VHHs, humanized VHHs, camelized VHs, domain antibodies, single domain antibodies, or dAbs that specifically bind to serum albumin (such as human serum albumin) or a serum immunoglobulin (such as IgG).
[0088] In some embodiments, said one or more other groups, residues, moieties or binding units that provides the polypeptide or construct with increased half-life is an ISVD that specifically binds human serum albumin. In some embodiments, said ISVD that specifically binds human serum albumin essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively), in which: (i) CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of a) the amino acid sequence of GFTFRSFGMS (SEQ ID NO:566); b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO:566; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO:566; and (ii) CDR2 (according to AbM definition) has an amino acid sequence selected from the group consisting of d) the amino acid sequence of SISGSGSDTL (SEQ ID NO: 567); e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO:567; f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ IDNO:567; and (iii) CDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of GGSLSR (SEQ ID NOs: 568); h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequenceof SEQ ID NO:568; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO:568. In some embodiments, in the ISVDs of the present disclosure, CDR1 consists of the amino acid sequence of SEQ ID NO:566, CDR2 consists of the amino acid sequence of SEQ ID NO:567, and CDR3 consists of the amino acid sequence of SEQ ID NO:568.
[0089] In some embodiments, said ISVD that specifically binds human serum albumin is selected from the group consisting of ALB8 (SEQ ID NO: 320), ALB23 (SEQ ID NO: 321), ALBX00001 (SEQ ID NO: 334) and ALB23002 (SEQ ID NO: 335).
[0090] In some embodiments, the polypeptides or constructs optionally further comprise one or more other groups, residues, moi eties or binding units, optionally linked via one or more linkers. In some embodiments, said linker is chosen from the group consisting of SEQ ID NOs: 336 to 352.
[0091] In some embodiments, the polypeptide or construct of the present disclosure further comprises a C-terminal extension. In some embodiments, said C-terminal extension is a C- terminal extension (X)n, in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I).
[0092] The present disclosure further provides nucleic acids that encode an ISVD or a polypeptide as described herein. In some embodiments, the nucleic acid is in a genetic construct.
[0093] The present disclosure further provides non-human host or host cells. In some embodiments, non-human host or host cells comprise the nucleic acid as described herein. In some embodiments, the non-human host or host cells expresses, or that under suitable circumstances is capable of expressing, an ISVD or a polypeptide as described herein.
[0094] The present disclosure further provides methods for producing an ISVD or a polypeptide. In some embodiments, the methods comprise a) expressing, in a suitable non- human host cell or host organism or in another suitable expression system, a nucleic acid described herein. In some embodiments, the methods further optionally comprise b) isolating and / or purifying the ISVD or the polypeptide.
[0095] The present disclosure further provides methods for producing an ISVD or a polypeptide. In some embodiments, the methods comprise a) cultivating and / or maintaining a non-human host or host cell under conditions that are such that said non-human host or host cell expresses and / or produces at least one ISVD as described herein, or at least one polypeptide as described herein. In some embodiments, the methods further optionally comprise b) isolating and / or purifying the ISVD or the polypeptide.
[0096] The present disclosure further provides compositions comprising at least one ISVD, at least one polypeptide or construct, or at least one nucleic acid as described herein, or any combination thereof. In some embodiments, the composition is a pharmaceutical composition. In some embodiments, the pharmaceutical composition further comprises at least one pharmaceutically acceptable carrier, diluent or excipient and / or adjuvant, and that optionally comprises one or more further pharmaceutically active polypeptides and / or compounds.
[0097] The present disclosure further provides the ISVD, the polypeptide, or the construct, or the composition as described herein, for use as a medicament.
[0098] The present disclosure further provides the ISVD, the polypeptide, or the construct, or the composition as described herein, for use in the diagnosis, prevention and / or treatment of at least one disease and / or disorder.
[0099] The present disclosure further provides the ISVD, the polypeptide, or the construct, or the composition as described herein, for use in the diagnosis, prevention and / or treatment of at least one disease and / or disorder that is associated with CD8alpha, with its biological or pharmacological activity, and / or with the biological pathways or signaling in which CD8alpha is involved.
[0100] The present disclosure further provides the ISVD, the polypeptide, or the construct, or the composition as described herein, for use in the diagnosis, prevention and / or treatment of an immunological disease, an infectious disease, or a proliferative disease, such as B cell leukemias and lymphomas.
[0101] The present disclosure further provides methods for the diagnosis, prevention and / or treatment of at least one disease and / or disorder. In some embodiments, the methods comprise the administration, to a subject, of the ISVD, the polypeptide, the construct, the composition as described herein. In some embodiments, the disease or disorder that isassociated with CD8alpha, with its biological or pharmacological activity, and / or with the biological pathways or signaling in which CD8alpha is involved. In some embodiments, said methods comprise administering, to a subject, at least one ISVD, a polypeptide, a construct, or a composition as described herein.
[0102] The present disclosure further provides immunoglobulin single variable domains (ISVDs) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: (i) CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO. 181 or 188; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 181 or 188; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 181 or 188; and (ii) CDR2 (according to AbM definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 183 or 190; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 183 or 190; f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 183 or 190; and CDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206; or i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206. In some embodiments, the ISVD is selected from the group consisting of: a) an ISVD comprising SEQ ID NOs: 181, 183, and 185; b) an ISVD comprising SEQ ID NOs: 188, 190, and 192; c) an ISVD comprising SEQ ID NOs: 188, 190, and 199; d) an ISVD comprising SEQ ID NOs: 188, 190, and 206. In some embodiments, the FR1 to FR4 in the ISVD is selected from the group consisting of: a) an FR1 comprising SEQ ID NO: 180 or 187; b) an FR2 comprising SEQ ID NO: 182; c) an FR3 comprising SEQ ID NO: 184, 191, 198 or 233; and d) an FR4 comprising SEQ ID NO: 186 or 193. In some embodiments, the ISVD is selected from the group consisting of: a) an ISVD comprising SEQ ID NO: 160; b) an ISVD comprising SEQ ID NO: 161; c) an ISVD comprising SEQ ID NO: 162; d) an ISVD comprising SEQ ID NO: 163; e) an ISVD comprising SEQ ID NO: 164; f) an ISVD comprising SEQ ID NO: 165; g) an ISVD comprising SEQ ID NO: 166; h) an ISVD comprising SEQ ID NO: 167; and i) an ISVD comprising SEQ ID NO: 168.
[0103] The present disclosure further provides immunoglobulin single variable domains (ISVDs) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which: (i) CDR1 (according to Kabat definition) has an amino acid sequence selected from: a) the amino acid sequence of SEQ ID NO: 251; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 251; c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 251; and (ii) CDR2 (according to Kabat definition) has an amino acid sequence selected from: d) the amino acid sequence of SEQ ID NO: 253 or 260; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 253 or 260; f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 253 or 260; and (iii) CDR3 (according to Kabat definition) has an amino acid sequence selected from: g) the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276; and i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276. In some embodiments, the ISVD is selected from the group consisting of: a) an ISVD comprising SEQ ID NOs: 251, 253, and 255; b) an ISVD comprising SEQ ID NOs: 258, 260, and 262; c) an ISVD comprising SEQ ID NOs: 265, 267, and 269; and d) an ISVD comprising SEQ ID NOs: 272, 274, and 276. In some embodiments, the FR1 to FR4 in the ISVD is selected from the group consisting of: a) an FR1 comprising SEQ ID NO: 250 or 257; b) an FR2 comprising SEQ ID NO: 252; c) an FR3 comprising SEQ ID NO: 254, 261, 282, or 303; and d) an FR4 comprising SEQ ID NO: 256 or 263. In some embodiments, the ISVD is selected from the group consisting of: a) an ISVD comprising SEQ ID NO: 170; b) an ISVD comprising SEQ ID NO: 171; c) an ISVD comprising SEQ ID NO: 172; d) an ISVD comprising SEQ ID NO: 173; e) an ISVD comprising SEQ ID NO: 174; f) an ISVD comprising SEQ ID NO: 175; g) an ISVD comprising SEQ ID NO: 176; h) an ISVD comprising SEQ ID NO: 177; and i) an ISVD comprising SEQ ID NO: 178. In some embodiments, the ISVD has a cysteine containing linker at its C-terminal end. In some embodiments, the cysteine containing linker is a GGC linker. In some embodiments, the ISVD comprises a C-terminal extension sequence of any one of SEQ ID Nos: 353 to 371. In some embodiments, the C-terminal extension consists of VTVSS(X)n (SEQ ID NO: 353). In some embodiments, the C-terminal extension consists of VTVSS (SEQ ID NO: 371).
[0104] The present disclosure further provides conjugates comprising an ISVD as described herein linked to a phospholipid-PEG-maleimide derivative. In some embodiments, the phospholipid-PEG-maleimide derivative is a derivative of phosphatidylethanolamine. In some embodiments, the phospholipid-PEG-maleimide derivative comprises stearic acid acyl chains. In some embodiments, the phospholipid is l,2-Distearoyl-sn-glycero-3- phosphoethanolamine-maleimide (DSPE). In some embodiments, the PEG has a molecular weight from about 1.5 kDa to about 6 kDa. In some embodiments, the PEG has a molecular weight of 2kDa, 3.4 kDa or 5 kDa. In some embodiments, the PEG has a molecular weight of 3.4 kDa. In some embodiments, the phospholipid-PEG-maleimide derivative is DSPE-PEG 3.4 K-maleimide.
[0105] The present disclosure further provides methods for the preparation of a composition comprising monomers of an ISVD with a cysteine containing linker at its C- terminal end. In some embodiments, the methods comprise the following sequential steps: (a) reducing a composition comprising ISVD dimers to ISVD monomers with a first reducing agent, wherein the ISVD dimers are formed through the cysteine containing linker at the C- terminal end of the ISVD. In further embodiments, the methods comprise (b) purifying the ISVD monomers obtained in step (a) to get a purified composition comprising the ISVD monomers. In further embodiments, the methods comprise (c) reducing the purified composition obtained in step (b) with a second reducing agent. In some embodiments, the methods further comprise (d) purifying the reduced composition obtained in step (c) to obtain a composition comprising monomers of the ISVD. In some embodiments, the composition comprising the ISVD dimers in step (a) is obtained through expressing the ISVD in a host cell. In some embodiments, the composition comprises the ISVD dimers is purified to remove host cell proteins and DNA before being subjected to step (a). In some embodiments, the first reducing agent comprises tris(2-carboxyethyl)phosphine (TCEP). In some embodiments, the step (a) is conducted around 15 to 25 °C, optionally around 20-22 °C. In some embodiments, the step (a) takes about 16 to 20 hours. In some embodiments, the step (b) comprises using a chromatography. In some embodiments, the chromatography comprises an ion exchange chromatography (TEX). In some embodiments, the second reducing agent in step (c) comprises tris(2-carboxyethyl)phosphine (TCEP). In some embodiments, the step (c) is conducted around 15 to 25 °C, optionally around 20-22 °C. In some embodiments, the step (c) takes about 16 to 20 hours. In some embodiments, the step (d) comprises Ultrafiltration / Diafiltration (UF / DF). In some embodiments, at least 80% of the ISVD in the composition obtained in step (d) is inmonomeric form. In some embodiments, the cysteine containing linker is a GGC linker. In some embodiments, the C-terminal end comprises the sequence VTVSS (SEQ ID NO: 371) before the cysteine linker. In some embodiments, the ISVD comprises two internal disulphide bridges. In some embodiments, before being subjected to step (a), the ISVD dimers is purified using protein A chromatography to remove host cell proteins and DNA. In some embodiments, both the first reducing agent and second reducing agent comprise TCEP. In some embodiments, the first reducing agent comprises 20X TCEP. In some embodiments, the second reducing agent comprise 10X TCEP. In some embodiments, the UF / DF membrane has a molecular weight cut-off of 10 kDa.
[0106] The present disclosure further provides methods for the preparation of a phospholipid-PEG-ISVD conjugate. In some embodiments, the methods comprise the following sequential steps: (a) mixing a first composition comprising monomers of an ISVD comprising a cysteine containing linker, with a second composition comprising phospholipid- PEG molecules comprising a bioconjugation linker under conditions that the phospholipid- PEG molecules and the ISVD monomers can form a conjugate through clicking chemistry; and (b) adding cysteine to the conjugate obtained in step (a) under conditions that the conjugation reaction is quenched, wherein a composition comprising the phospholipid-PEG ISVD conjugate is obtained. In some embodiments, at least 80% of the ISVD in the first composition is in monomeric form. In some embodiments, the phospholipid in the phospholipid-PEG is a derivative of phosphatidylethanolamine. In some embodiments, the phospholipid comprises stearic acid acyl chains. In some embodiments, the phospholipid is 1,2-Distearoyl-sn-glycero- 3 -phosphoethanolamine (DSPE). In some embodiments, the PEG has a molecular weight of about 1 ,5kDa to about 6.5kDa. In some embodiments, the PEG has a molecular weight of about 2kDa, about 3.4 kDa, or about 5 kDa. In some embodiments, the PEG has a molecular weight of 3.4 kDa. In some embodiments, the conjugate is a DSPE-PEG 3.4K-ISVD conjugate. In some embodiments, the bioconjugation linker in the phospholipid-PEG has a maleimide group. In some embodiments, the second composition further comprises molecules of a second phospholipid-PEG that does not have the bioconjugation linker in addition to the phospholipid- PEG molecules comprising the bioconjugation linker. In some embodiments, the size of PEG in the second phospholipid-PEG is different compared to the size of PEG in the phospholipid- PEG comprising the bioconjugation linker. In some embodiments, the size of PEG in the second phospholipid-PEG is smaller compared to the size of PEG in the phospholipid-PEG comprising the bioconjugation linker. In some embodiments, the size of PEG in the secondphospholipid-PEG is about 2 kDa, and the size of PEG in the phospholipid-PEG comprising the bioconjugation linker is 3.4 KDa. In some embodiments, the second composition comprises DSPE-PEG 3.4 kDa with a bioconjugation linker, and DSPE-PEG 2.0kDa without the bioconjugation linker. In some embodiments, the DSPE-PEG 2.0 kDa has the structure below or a salt thereof:
[0107] (DSPE-PEG2.0 kDa-OCH3). In some embodiments, the DSPE-PEG 3.4 kDa has a maleimide linker. In some embodiments, the cysteine containing linker in the ISVD is a GGC linker. In some embodiments, the cysteine containing linker comprising a sequence of any one of SEQ ID Nos: 353 to 370. In some embodiments, the ISVD comprising VTVSS(X)n (SEQ ID NO: 353) before the GGC linker. In some embodiments, the ISVD comprising VTVSS (SEQ ID NO: 371) before the GGC linker. In some embodiments, the molar ratio of the phospholipid-PEG molecules comprising the bioconjugation linker to the second phospholipid- PEG that does not have the bioconjugation linker is about 1 :3 to about 1 : 1. In some embodiments, the molar ratio of the phospholipid-PEG molecules comprising the bioconjugation linker to the second phospholipid-PEG that does not have the bioconjugation linker is about 2:3. In some embodiments, the molar ratio of the ISVD monomers, the phospholipid-PEG molecules comprising the bioconjugation linker, and the second phospholipid-PEG that does not have the bioconjugation linker is about 1 : 1 :4 or 1 :2:3. In some embodiments, a clicking chemistry reaction takes place in the mixture in step (a) under 15 to 25 °C, or optionally under 20 to 22 °C. In some embodiments, a clicking chemistry reaction takes place in the mixture in step (a) for about 2 hours. In some embodiments, the molar ratio of the cysteine added in step (b) for quenching the conjugation reaction to the phospholipid- PEG molecules comprising a bioconjugation linker is at least 3. In some embodiments, the molar ratio is about 3.1 to about 4.1. In some embodiments, the quenching in step (b) is carried out for about 30 min. In some embodiments, the quenching in step (b) takes place under 15 to 25 °C, or optionally under 20 to 22 °C. In some embodiments, the method further comprises purifying the obtained composition comprising the phospholipid-PEG ISVD conjugate using ultrafiltration / diafiltration (UF / DF). In some embodiments, the UF / DF has a molecular weight cut-off of about 10 kDa. In some embodiments, the composition comprising the phospholipid-PEG ISVD conjugate is formulated in buffer. In some embodiments, the buffer comprises HEPES pH7.4, NaCl, and sucrose. In some embodiments, the buffer comprises 1.5 mM HEPES pH7.4, 150 mM NaCl, and 10% sucrose buffer.
[0108] The present disclosure further provides phospholipid-PEG-ISVD conjugates produced by the method as described herein.
[0109] The present disclosure further provides a composition comprising a phospholipid- PEG-ISVD conjugate produced by the method as described herein. In some embodiments, the composition comprises micelles comprising the phospholipid-PEG-ISVD conjugate. In some embodiments, the micelles comprise the phospholipid-PEG-ISVD conjugate, and a second phospholipid-PEG molecule that does not have a bioconjugation linker. In some embodiments, the micelles comprise DSPE-PEG 3.4K-anti-CD8a ISVD conjugate, and DSPE-PEG2.0k- OMeH. In some embodiments, the molar ratio among the CD8a ISVD, DSPE-PEG 3.4K, and DSPE-PEG2.0K is about 1 : 1 :4 or 1 :2:3. In some embodiments, the CD8a ISVD comprises or consists of SEQ ID NO: 44.
[0110] The present disclosure further provides methods of producing a composition comprising lipid nanoparticles (LNPs), wherein the LNPs comprising: (a) a lipid-immune cell targeting group conjugate comprising the compound of Formula (II): [Lipid] - [optional linker] - [antibody], (b) an ionizable cationic lipid, (c) a nucleic acid, wherein the nucleic acid is encapsulated in the LNP, (d) a structural lipid (e.g., a sterol), (e) a neutral phospholipid, and (f) a free PEG-lipid. In some embodiments, the method comprises: (i) producing a first composition comprising the lipid-immune cell targeting group conjugate in (a); (ii) producing a second composition comprising (b) to (f); and (iii) incubating the first composition obtained from step (i) and the second composition obtained from step (ii), to produce the final composition comprising the LNPs. In some embodiments, the antibody in the lipid-immune cell targeting group conjugate comprises an ISVD. In some embodiments, the lipid-immune cell targeting group conjugate is a phospholipid-PEG-ISVD. In some embodiments, the phospholipid-PEG-ISVD is produced by the method of a method as described herein. In some embodiments, the phospholipid-PEG-ISVD is DSPE-PEG3.4K-ISVD. In some embodiments, the ISVD is an anti-CD8 ISVD. In some embodiments, the anti-CD8 ISVD comprises a sequence selected from the group consisting of SEQ ID NOs: 160 to 169, and SEQ ID NOs: 28-36 and 44, and SEQ ID NOs: 10 to 27. In some embodiments, the anti-CD8 ISVD comprises SEQ ID NO: 44. In some embodiments, the LNPs comprises Lipid 15, DSPC, Cholesterol,DPG-PEG, DSPE-PEG3.4K-A044300805_v8_GGC (SEQ ID NO: 44), and mRNA encoding a CD22 CAR. In some embodiments, the mRNA comprises SEQ ID NO: 139 or SEQ ID NO: 147. In some embodiments, the mRNA is produced through in vitro transcription. In some embodiments, the mRNA comprises pseudouridine. In some embodiments, the pseudouridine is Nl-methyl-pseudouridine.[OHl] The present disclosure further provides compositions produced by methods of producing a composition comprising lipid nanoparticles (LNPs) as described herein.DESCRIPTION OF THE FIGURES
[0112] The present application can be understood by reference to the following description taken in conjunction with the accompanying figures.
[0113] FIG. 1 depicts proton NMR spectrum of intermediate 13-11.
[0114] FIG. 2A depicts proton NMR spectrum of intermediate 13-1 la; FIG. 2B depicts proton NMR spectrum of intermediate 13-1 lb; and FIG. 2C depicts LC-ELSD of intermediate 13-1 lb.
[0115] FIG. 3 A depicts proton NMR spectrum of intermediate 13-10; FIG. 3B depicts LC- CAD chromatogram of intermediate 13-10.
[0116] FIG. 4A-1 depicts proton NMR spectrum for Lipid 1; FIG. 4A-2 depicts the LC- CAD chromatogram of Lipid 1.
[0117] FIG. 4B-1 depicts proton NMR spectrum of Lipid 3; FIG. 4B-2 depicts the LC- CAD chromatogram of Lipid 3.
[0118] FIG. 4C-1 depicts proton NMR spectrum of Lipid 4; FIG. 4C-2 depicts the LC- CAD chromatogram L of Lipid 4.
[0119] FIG. 4D-1 depicts proton NMR spectrum of Lipid 5A; FIG. 4D-2 depicts the LC- CAD chromatogram of Lipid 5 A.
[0120] FIG. 4E-1 depicts proton NMR spectrum of Lipid 6; FIG. 4E-2 depicts the LC-CAD chromatogram of Lipid 6.
[0121] FIG. 4F-1 depicts proton NMR spectrum of Lipid 7; FIG. 4F-2 depicts the LC-CAD chromatogram of Lipid 7.
[0122] FIG. 4G-1 depicts proton NMR spectrum of Lipid 2; FIG. 4G-2 depicts the LC- CAD chromatogram of Lipid 2;
[0123] FIG. 4H-1 depicts proton NMR spectrum of Lipid 8; FIG. 4H-2 depicts the LC- CAD chromatogram of Lipid 8.
[0124] FIG. 41-1 depicts proton NMR spectrum of Lipid 9; FIG. 41-2 depicts the LC-CAD chromatogram of Lipid 9.
[0125] FIG. 4J-1 depicts proton NMR spectrum of Lipid 10A; FIG. 4J-2 depicts the LC- CAD chromatogram of Lipid 10 A.
[0126] FIG. 4K-1 depicts proton NMR spectrum of Lipid 11 A; FIG. 4K-2 depicts the LC- CAD chromatogram of Lipid 11 A.
[0127] FIG. 4L-1 depicts proton NMR spectrum of Lipid 12; FIG. 4L-2 depicts the LC- CAD chromatogram of Lipid 12.
[0128] FIG. 4M-1 depicts proton NMR spectrum of Lipid 13; FIG. 4M-2 depicts the LC- CAD chromatogram of Lipid 13.
[0129] FIG. 4N-1 depicts proton NMR spectrum of Lipid 15; FIG. 4N-2 depicts the LC- CAD chromatogram of Lipid 15.
[0130] FIG. 40-1 depicts proton NMR spectrum of Lipid 16; FIG. 40-2 depicts the LC- CAD of Lipid 16.
[0131] FIG. 4P-1 depicts proton NMR spectrum of Lipid 19; FIG. 4P-2 depicts the LC- ELSD chromatogram of Lipid 19.
[0132] FIG. 4Q-1 depicts proton NMR spectrum of Lipid 20; FIG. 4Q-2 depicts the LC- ELSD chromatogram of Lipid 20.
[0133] FIG. 4R-1 depicts proton NMR spectrum of Lipid 31; FIG. 4R-2 depicts the LC- CAD chromatogram of Lipid 31.
[0134] FIG. 4S-1 depicts proton NMR spectrum of Lipid 32; FIG. 4S-2 depicts the LC- CAD chromatogram of Lipid 32.
[0135] FIG. 4T-1 depicts proton NMR spectrum of Lipid 33; FIG. 4T-2 depicts the LC- CAD chromatogram of Lipid 33.
[0136] FIG. 4U-1 depicts proton NMR spectrum of Lipid 34; FIG. 4U-2 depicts the LC- CAD chromatogram of Lipid 34.
[0137] FIG. 4V-1 depicts proton NMR spectrum of Lipid 14A; FIG. 4V-2 depicts the LC- CAD chromatogram of Lipid 14A.
[0138] FIG. 4W-1 depicts proton NMR spectrum of Lipid 17A; FIG. 4W-2 depicts the LC- CAD chromatogram of Lipid 17 A.
[0139] FIG. 4X-1 depicts proton NMR spectrum of Lipid 18A; FIG. 4X-2 depicts the LC- CAD chromatogram of Lipid 18 A.
[0140] FIG. 4Y-1 depicts proton NMR spectrum of Lipid 21 A; FIG. 4Y-2 depicts the LC- CAD chromatogram of Lipid 21 A.
[0141] FIG. 4Z-1 depicts proton NMR spectrum of Lipid 22; FIG. 4Z-2 depicts the LC- CAD chromatogram of Lipid 22.
[0142] FIG. 4AA-1 depicts proton NMR spectrum of Lipid 23 A; FIG. 4AA-2 depicts the LC-CAD chromatogram of Lipid 23 A.
[0143] FIG. 4AC-1 depicts proton NMR spectrum of Lipid 25A; FIG. 4AC-2 depicts the LC-CAD chromatogram of Lipid 25 A.
[0144] FIG. 4AE-1 depicts proton NMR spectrum of Lipid 27; FIG. 4AE-2 depicts the LC- CAD chromatogram of Lipid 27.
[0145] FIG. 4AF-1 depicts proton NMR spectrum of Lipid 28; FIG. 4AF-2 depicts the LC- CAD chromatogram of Lipid 28.
[0146] FIG. 4AG-1 depicts proton NMR spectrum of Lipid 29; FIG. 4AG-2 depicts the LC-CAD chromatogram of Lipid 29.
[0147] FIG. 4AH-1 depicts proton NMR spectrum of Lipid 37A; FIG. 4AH-2 depicts the LC-CAD chromatogram of Lipid 37 A.
[0148] FIG. 4A 1 depicts proton NMR spectrum of Lipid 19A; FIG. 4A 2 depicts the LC-CAD chromatogram of Lipid 19 A.
[0149] FIG. 4AJ-1 depicts proton NMR spectrum of Lipid 20A; FIG. 4AJ-2 depicts the LC-CAD chromatogram of Lipid 20 A.
[0150] FIG. 5A depicts diameter (DLS, nm) of LNPs based on Lipid 1 to Lipid 8 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0151] FIG. 5B depicts poly dispersity (DLS) of LNPs based on Lipid 1 to Lipid 8 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0152] FIG. 5C depicts charge (Zeta potential, DLS) of LNPs based on Lipid 1 to Lipid 8 in pH 5.5 MBS, pH 7.4 HBS.
[0153] FIG. 5D depicts % RNA recovery and dye accessible RNA in LNPs based on Lipid 1 to Lipid 8.
[0154] FIG. 6 A depicts diameter (DLS, nm) of LNPs based on Lipids 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0155] FIG. 6B depicts poly dispersity (DLS) of LNPs based on Lipids 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0156] FIG. 6C depicts charge (Zeta potential, DLS) of LNPs based on Lipids 9, 10, 11, and 15 in pH 5.5 MBS, pH7.4 HBS.
[0157] FIG. 6D depicts % RNA recovery and dye accessible RNA in LNPs based on Lipids 9, 10, 11, and 15.
[0158] FIG. 7A depicts diameter (DLS, nm) of LNPs based on Lipid 31 to Lipid 34 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0159] FIG. 7B depicts poly dispersity (DLS) of LNPs based on Lipid 31 to Lipid 34 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0160] FIG. 7C depicts charge (Zeta potential, DLS) of LNPs based on Lipid 31 to Lipid 34 in pH 5.5 MBS, pH 7.4 HBS.
[0161] FIG. 7D depicts % RNA recovery and dye accessible RNA in LNPs based on Lipid 31 to Lipid 34.
[0162] FIG. 8A depicts diameter (DLS, nm) of LNPs based on Lipids 1, 3, 4, 5, 9, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post inserted with aCD8 antibody conjugates TRX-2 and T8.
[0163] FIG. 8B depicts poly dispersity (DLS) of LNPs based on Lipids 1, 3, 4, 5, 9, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post inserted with aCD8 antibody conjugates TRX-2 and T8.
[0164] FIG. 9A depicts diameter (DLS, nm) of LNPs based on Lipids 1, 8, 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post inserted with aCD8 antibody conjugates TRX-2 and T8.
[0165] FIG. 9B depicts poly dispersity (DLS) of LNPs based on Lipids 1, 8, 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, Post inserted with aCD8 antibody conjugates TRX-2 and T8.
[0166] FIG. 10A depicts diameter (DLS, nm) of LNPs based on Lipid 3, 4, 33, and 34 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0167] FIG. 10B depicts poly dispersity (DLS) of LNPs based on Lipid 3, 4, 33, and 34 in pH 7.4 HBS, pH 6.5 MBS, Post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0168] FIG. 10C depicts charge (Zeta potential, DLS) of LNPs based on Lipid 3, 4, 33, and 34 in pH 5.5 MBS, pH7.4 HBS, pH6.5 MBS, post antibody (aCD3, hSP34) insertion and post freeze-thaw (-80° C).
[0169] FIG. 10D depicts % RNA recovery and dye accessible RNA in LNPs based on Lipid 3, 4, 33, and 34.
[0170] FIG. 11A depicts GFP expression in primary human T-cells; transfected by aCD8 (hsp34) targeted LNPs based on ALC-0315, DLin-MC3-DMA, Lipid 3, Lipid 6, and Lipid 7, stored at 4° C.; % GFP+ T cells at 24 hours.
[0171] FIG. 11B depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on ALC-0315, DLin-MC3-DMA, Lipid 3, Lipid 6, and Lipid 7, after 1 freeze-thaw cycle (-80° C. storage); % GFP+ T cells at 24 hours.
[0172] FIG. 11C depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on ALC-0315, DLin-MC3-DMA, Lipid 3, Lipid 6, and Lipid 7, stored at 4° C.; GFP MFI in live T-cells at 24 hours.
[0173] FIG. 11D depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on ALC-0315, DLin-MC3-DMA, Lipid 3, Lipid 6, and Lipid 7, after 1 freeze-thaw cycle (-80° C. storage); GFP MFI in live T-cells at 24 hours.
[0174] FIG. 1 IE depicts % live T-cells transfected by aCD3 (hsp34) targeted LNPs based on ALC-0315, DLin-MC3-DMA, Lipid 3, Lipid 6, and Lipid 7, after 1 freeze-thaw cycle (-80° C. storage); % live T-cells at 24 hours.
[0175] FIG. 12A depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on SM-102, DLin-KC2-DMA, Lipid 3, Lipid 4 stored at 4° C.; % GFP+ T cells at 24 hours.
[0176] FIG. 12B depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on SM-102, DLin-KC2-DMA, Lipid 3, Lipid 4, after 1 freezethaw cycle (-80° C. storage); % GFP+ T cells at 24 hours.
[0177] FIG. 12C depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on SM-102, DLin-KC2-DMA, Lipid 3, Lipid 4, stored at 4° C.; GFP MFI in live T-cells at 24 hours.
[0178] FIG. 12D depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on SM-102, DLin-KC2-DMA, Lipid 3, Lipid 4, after 1 freezethaw cycle (-80° C. storage); GFP MFI in live T-cells at 24 hours.
[0179] FIG. 12E depicts % live T-cells transfected with by aCD3 (hsp34) targeted LNPs based on SM-102, DLin-KC2-DMA, Lipid 3, Lipid 4, after 1 freeze-thaw cycle (-80° C. storage); % live T-cells at 24 hours.
[0180] FIG. 13 A depicts GFP expression in primary human T-cells; transfected by targetedLNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 1 (4° C. stored), Lipid 3 (4° C. stored), and Lipid 5 (4° C. stored); % GFP+ T cells.
[0181] FIG. 13B depicts GFP expression in primary human T-cells; transfected by targeted LNPs based on DLin-KC2-DMA, Lipid 1, Lipid 3, and Lipid 5 after freeze-thaw cycle (-80° C. storage); % GFP+ T cells.
[0182] FIG. 13C depicts GFP expression in primary human T-cells; transfected by targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 1 (4° C. stored), Lipid 3 (4° C. stored), and Lipid 5 (4° C. stored), GFP MFI in live T-cells.
[0183] FIG. 13D depicts GFP expression in primary human T-cells; transfected by a targeted LNPs based on DLin-KC2-DMA, Lipid 1, Lipid 3, and Lipid 5 after freeze-thaw cycle (-80° C. storage); GFP MFI in live T-cells.
[0184] FIG. 13E depicts % live T-cells transfected with targeted LNPs based on DLin- KC2-DMA, Lipid 1, Lipid 3, and Lipid 5 stored at -80° C.
[0185] FIG. 14A depicts GFP expression in primary human T-cells; transfected by aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA, Lipid 1 (4° C. stored), Lipid 8 (4° C. stored), and Lipid 8 (-80° C. stored); % GFP+ T cells.
[0186] FIG. 14B depicts GFP expression in primary human T-cells; transfected by aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA, Lipid 1 (4° C. stored), Lipid 8 (4° C. stored), and Lipid 8 (-80° C. stored); GFP MFI in live T-cells.
[0187] FIG. 14C depicts % living cells with targeted LNPs based on DLin-KC2-DMA, Lipid 1 (4° C. stored), Lipid 8 (4° C. stored), and Lipid 8 (-80° C. stored).
[0188] FIG. 15A depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 10 (4° C. stored); % GFP+ T cells.
[0189] FIG. 15B depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (-80° C. stored) and Lipid 10 (-80° C. stored); % GFP+ T cells.
[0190] FIG. 15C depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 10 (4° C. stored); GFP MFI in live T-cells.
[0191] FIG. 15D depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (-80° C. stored) and Lipid 10 (-80° C. stored); GFP MFI in live T-cells.
[0192] FIG. 15E depicts % live T-cells transfected with aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 10(4° C. stored); % live T-cells.
[0193] FIG. 15F depicts % live T-cells transfected with aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 8 (-80° C. stored) and Lipid 10 (-80° C. stored); % live T-cells.
[0194] FIG. 16A depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 15 (4° C. stored); % GFP+ T cells.
[0195] FIG. 16B depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 15 (-80° C. stored); % GFP+ T cells.
[0196] FIG. 16C depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 15 (4° C. stored), GFP MFI in live T-cells.
[0197] FIG. 16D depicts GFP expression in primary human T-cells; transfected by aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 15 (-80° C. stored); GFP MFI in live T-cells.
[0198] FIG. 16E depicts % live T-cells transfected with aCD3 (hsp34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), and Lipid 15 (-80° C. stored).
[0199] FIG. 17A depicts GFP expression in primary human T-cells; transfected by aCD8 (TRX2) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs; % GFP+ T cells.
[0200] FIG. 17B depicts GFP expression in primary human T-cells; transfected by aCD8 (TRX2) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs; GFP MFI in live T-cells.
[0201] FIG. 17C depicts % +Dil T-cell with aCD8 (TRX2) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0202] FIG. 17D depicts Dil MFI in live T-cells with aCD8 (TRX2) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0203] FIG. 17E depicts % live T-cells transfected with aCD8 (TRX2) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0204] FIG. 18A depicts GFP expression in primary human T-cells; transfected by aCD8 (T8) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs; % GFP+ T cells.
[0205] FIG. 18B depicts GFP expression in primary human T-cells; transfected by aCD8 (T8) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs; GFP MFI in live T-cells.
[0206] FIG. 18C depicts % +Dil T-cell with aCD8 (T8) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0207] FIG. 18D depicts Dil MFI in live T-cells with aCD8 (T8) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0208] FIG. 18E depicts % live T-cells transfected with aCD8 (T8) targeted LNPs based on Lipid 3, Lipid 4, Lipid 9, Lipid 15, and compared with the corresponding non-targeted parent LNPs.
[0209] FIG. 19A depicts GFP expression in primary human T-cells; transfected by aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA, Lipid 2, Lipid 3, Lipid 31, and Lipid 32; stored at 4° C.; % GFP+ T cells.
[0210] FIG. 19B depicts GFP expression in primary human T-cells; transfected by aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA, Lipid 2, Lipid 3, Lipid 31, and Lipid 32; stored at 4° C.; GFP MFI in live T-cells.
[0211] FIG. 19C depicts % living T-cells with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA, Lipid 2, Lipid 3, Lipid 31, and Lipid 32; stored at 4° C.
[0212] FIG. 20A depicts GFP expression in primary human T-cells; transfected with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (4° C. stored), Lipid 33 (4° C. stored), Lipid 34 (4° C. stored), or transfected with aCD8 (muOKT8) targeted LNPs based on Lipid 33 (4° C. stored) Lipid 34 (4° C. stored); % GFP+ T cells.
[0213] FIG. 20B depicts GFP expression in primary human T-cells; transfected with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 33 (-80° C. stored), Lipid 34 (-80° C. stored); % GFP+ T cells.
[0214] FIG. 20C depicts GFP expression in primary human T-cells; transfected with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 33 (4° C. stored), Lipid 34 (4° C. stored), or transfected with aCD8 (muOKT8) targeted LNPs based on Lipid 33 (4° C. stored) Lipid 34 (4° C. stored); GFP MFI in live T-cells.
[0215] FIG. 20D depicts GFP expression in primary human T-cells; transfected with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 33 (-80° C. stored), Lipid 34 (-80° C. stored); GFP MFI in live T-cells.
[0216] FIG. 20E depicts % live T-cells transfected with aCD3 (hSP34) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 33 (-80° C. stored), Lipid 34 (-80° C. stored), or transfected with aCD8 (muOKT8) targeted LNPs based on Lipid 33 (4° C. stored) and Lipid 34 (4° C. stored).
[0217] FIG. 21 A depicts % aCD20 (TTR-023) CAR+ T-cells transfected by aCD3 (hSP34) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 33 (4° C. stored); as illustrated by % Ml value.
[0218] FIG. 2 IB depicts % aCD20 (TTR-023) CAR+ T-cells transfected by aCD3 (hSP34) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored); as illustrated by % Ml value.
[0219] FIG. 21C depicts % aCD20 (TTR-023) CAR MFI in T-cells transfected by aCD3 (hSP34) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 33 (4° C. stored).
[0220] FIG. 2 ID depicts % aCD3 (hSP34) CAR MFI in T-cells transfected by aCD3 (hSP34) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored).
[0221] FIG. 21E depicts % live T-cells transfected with aCD3 (hSP34) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), and Lipid 33 (4° C. stored).
[0222] FIG. 21F depicts % live T-cells transfected with aCD3 (hSP34) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored).
[0223] FIG. 22A depicts % aCD20 (TTR-023) CAR+ T-cells (CD8 population) with aCD8 (T8) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 33 (4° C. stored), as illustrated by CD4- % Ml value.
[0224] FIG. 22B depicts aCD20 (TTR-023) CAR MFI in T-cells (CD8 population) with aCD8 (T8) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 33 (4° C. stored), as illustrated by CD4- Ml MFI value.
[0225] FIG. 22C depicts aCD20 (TTR-023) CAR level in CD4+ T-cells transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 33 (4° C. stored); as illustrated by the Ml% value.
[0226] FIG. 22D depicts aCD20 (TTR-023) CAR level in CD4+ T-cells transfected with aCD8 (T8) targeted LNPs based on DLin-KC2-DMA (-80° C. stored), Lipid 3 (-80° C. stored), Lipid 33 (-80° C. stored), Lipid 34 (-80° C. stored); as illustrated by the Ml MFI value.
[0227] FIG. 22E depicts % live T-cells (CD4 / CD8 populations) transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (4° C. stored), Lipid 4 (4° C. stored), Lipid 9 (4° C. stored), Lipid 33 (4° C. stored).
[0228] FIG. 23 A depicts % aCD20 (TTR-023) CAR+ T-cells (CD8 population) transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored) after one Freeze-Thaw cycle, as illustrated by CD4-% Ml value.
[0229] FIG. 23B depicts aCD20 (TTR-023) CAR MFI in T-cells (CD8 population) transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored) after one Freeze-Thaw cycle, as illustrated by CD4-M1 MFI value.
[0230] FIG. 23C depicts aCD20 (TTR-023) CAR level in CD4+ T-cells transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored); as illustrated by CD4+% Ml value.
[0231] FIG. 23D depicts aCD20 (TTR-023) CAR level in CD4+ T-cells transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored); as illustrated by CD4+M1 MFI value.
[0232] FIG. 23E depicts % live T-cells transfected with aCD8 (T8) targeted LNPs based on Lipid 3 (-80° C. stored), Lipid 4 (-80° C. stored), Lipid 9 (-80° C. stored), Lipid 33 (-80° C. stored).
[0233] FIG. 24A depicts GFP expression in CD8+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by % GFP+ T cells.
[0234] FIG. 24B depicts GFP expression in CD8+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by GFP MFI.
[0235] FIG. 24C depicts GFP expression in CD4+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by % GFP+ T cells.
[0236] FIG. 24D depicts GFP expression in CD4+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by GFP MFI.
[0237] FIG. 24E depicts % DH+CD8+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by % Dil+ T-cells.
[0238] FIG. 24F depicts Dil MFI in CD8+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by Dil MFI.
[0239] FIG. 24G depicts % DH+CD4+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by % Dil+ T-cells.
[0240] FIG. 24H depicts Dil MFI in CD4+ T-cells transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to vector control (mutOKT8) and un-transfected; as illustrated by Dil MFI.
[0241] FIG. 25A depicts GFP expression in NK cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by % GFP+NK cells.
[0242] FIG. 25B depicts GFP expression in NK cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by GFP MFI.
[0243] FIG. 25C depicts GFP expression in granulocytes in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and untransfected; as illustrated by % GFP+ granulocytes.
[0244] FIG. 25D depicts GFP expression in granulocytes in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and untransfected; as illustrated by GFP MFI.
[0245] FIG. 25E depicts GFP expression in B cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by % GFP+ B cells.
[0246] FIG. 25F depicts GFP expression in B cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin- KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by GFP MFI.
[0247] FIG. 26A depicts LNP binding to NK cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin- KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by % Dil+NK cells.
[0248] FIG. 26B depicts LNP binding to NK cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin- KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by Dil MFI.
[0249] FIG. 26C depicts LNP binding to granulocytes in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by % Dil+ granulocytes.
[0250] FIG. 26D depicts LNP binding to granulocytes in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin-KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by Dil MFI.
[0251] FIG. 26E depicts LNP binding to B cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin- KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by % Dil+ B cells.
[0252] FIG. 26F depicts LNP binding to B cells in whole blood samples transfected with aCD3 (hSP34) targeted or aCD8 (TRX2) targeted LNPs based on Lipid 9, Lipid 15, or DLin- KC3-DMA compared to non-binding control (mutOKT8) and un-transfected; as illustrated by Dil MFI.
[0253] FIG. 27A depicts % live T-cells 24 hours after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3- DMA.
[0254] FIG. 27B depicts % of CD8 (CD4-) T-cells expressing Ml (TRR-023) CAR after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0255] FIG. 27C depicts Ml (TTR-023) expression Mean Fluorescence Intensity (MFI) in CD8 (CD4-) T-cells transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR- 023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0256] FIG. 27D depicts % of CD8 (CD4-) T-cells with mCherry expression after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0257] FIG. 27E depicts mCherry expression Mean Fluorescence Intensity (MFI) in CD8 (CD4-) T-cells transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0258] FIG. 27F depicts % of CD4+ T-cells with Ml (TTR-023) CAR expression after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0259] FIG. 27G depicts Ml (TTR-023) expression Mean Fluorescence Intensity (MFI) in CD4+ T-cells after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0260] FIG. 27H depicts % of CD4+ T-cells with mCherry expression after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0261] FIG. 271 depicts % dead Raji cells in Raji (B-cell) co-culture experiment with CAR- T generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA.
[0262] FIG. 28A depicts % of dead Raji cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA, with an effector Target ratio of 1: 1, 4: 1, and 8: 1.
[0263] FIG. 28B depicts % of live CD8 (CD4-) T-cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA, with an effector Target ratio of 1:1, 4:1, and 8:1.
[0264] FIG. 28C depicts % of live CD4+ T-cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 9 or DLin-KC3-DMA, with an effector Target ratio of 1: 1, 4: 1, and 8: 1.
[0265] FIG. 29A depicts % live T-cells 24 hours after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin- KC3-DMA.
[0266] FIG. 29B depicts % of CD8 (CD4-) T-cells expressing Ml (TRR-023 CAR) after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin-KC3-DMA.
[0267] FIG. 29C depicts Ml (TTR-023 CAR) expression Mean Fluorescence Intensity (MFI) in CD8 (CD4-) T-cells transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin-KC3-DMA.
[0268] FIG. 29D depicts % of CD8 (CD4-) T-cells with mCherry expression after being transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin-KC3-DMA.
[0269] FIG. 29E depicts mCherry expression Mean Fluorescence Intensity (MFI) in CD8 (CD4-) T-cells transfected with aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin-KC3-DMA.
[0270] FIG. 30A depicts % of dead Raji cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 orDLin-KC3-DMA, with an effectortarget ratio of 0.31 : 1, 1 : 1, 3.16: 1, 10: 1, and 31.6: l.
[0271] FIG. 30B depicts % of live CD8 (CD4-) T-cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 or DLin-KC3-DMA, with an effector Target ratio of 0.31 : l, 1 : 1, 3.16: 1, 10: 1, and 31.6: l.
[0272] FIG. 30C depicts % of live CD4+ T-cells in Raji (B-cell) co-culture experiment with CAR-T cells generated using aCD8 (TRX2) targeted LNPs expressing aCD20 (TTR-023) CAR or mCherry based on Lipid 15 orDLin-KC3-DMA, with an effectortarget ratio of 0.31 : 1, 1 : 1, 3.16: 1, 10: 1, and 31.6: l.
[0273] FIG. 31 depicts structures of various Fab, VHH (Nb), ScFv, Fab-ScFv and Fab- VHH hybrids.
[0274] FIG. 32A depicts GFP expression in T-cells transfected with aCD3 targeted LNPs based on Lipid 9, Lipid 10, Lipid 13, Lipid 15, or DLin-KC2-DMA, stored at either 4° C. or post freeze-thaw (-80° C. stored), as illustrated by % GFP+ T cells.
[0275] FIG. 32B depicts GFP expression in T-cells transfected with aCD3 targeted LNPs based on Lipid 9, Lipid 10, Lipid 13, Lipid 15, or DLin-KC2-DMA, stored at either 4° C. or post freeze-thaw (-80° C. stored), as illustrated by GFP MFI.
[0276] FIG. 32C depicts % Dil+ T-cells transfected with aCD3 targeted LNPs based on Lipid 9, Lipid 10, Lipid 13, Lipid 15, or DLin-KC2-DMA, stored at either 4° C. or post freezethaw (-80° C. stored), as illustrated by % Dil+ T-cells.
[0277] FIG. 32D depicts Dil MFI in live T-cells transfected with aCD3 targeted LNPs based on Lipid 9, Lipid 10, Lipid 13, Lipid 15, or DLin-KC2-DMA, stored at either 4° C. or post freeze-thaw (-80° C. stored), as illustrated by Dil % MFI.
[0278] FIG. 32E depicts % live T-cells transfected with aCD3 targeted LNPs based on Lipid 9, Lipid 10, Lipid 13, Lipid 15, or DLin-KC2-DMA, stored at either 4° C. or post freezethaw (-80° C. stored).
[0279] FIG. 33 A to FIG. 33C depict % GFP+ T-cells (CD4 and CD8 populations) in Blood (FIG. 33A), Spleen (FIG. 33B), and Liver (FIG. 33C) samples (analyzed for additional cell types of interest per legend) at 24 hours post injection of GFP RNA using Lipid 15, DLin-KC3- DMA, and Lipid 9 LNP formulations and a-CD8 targeting with TRX-2 antibody.
[0280] FIG. 34A to FIG. 34C depict % Dil+ T-cells (CD4 and CD8 populations) in Blood (FIG. 34A), Spleen (FIG. 34B), and Liver (FIG. 34C) samples (analyzed for additional cell types of interest per legend) at 24 hours post injection of GFP RNA using Lipid 15 (DiLdye labelled), DLin-KC3-DMA (No DiLdye label used), and Lipid 9 LNP (DiLdye labelled) formulations and a-CD8 targeting with TRX-2 antibody.
[0281] FIG. 35A depicts %DiI+ CD8+ T-cells transfected with aCD8 targeted LNPs based on Lipids 10, 15, 16, 24, and 26 and ALC-0315 as a comparator, as illustrated by %DiI+ T- cells.
[0282] FIG. 35B depicts Dil MFI of CD8+ T-cells transfected with aCD8 targeted LNPs based on Lipids 10, 15, 16, 24, and 26 and ALC-0315 as a comparator, as illustrated by Dil MFI.
[0283] FIG. 35C depicts %GFP+ CD8+ T-cells transfected with aCD8 targeted LNPs based on Lipids 10, 15, 16, 24, and 26 and ALC-0315 as a comparator, as illustrated by %GFP+ T-cells.
[0284] FIG. 35D depicts GFP MFI of CD8+ T-cells transfected with aCD8 targeted LNPs based on Lipids 10, 15, 16, 24, and 26 and ALC-0315 as a comparator, as illustrated by GFP MFI.
[0285] FIG. 36-1A depicts the viability of CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by % Live T-cells.
[0286] FIG. 36-1B depicts %DiI+ CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by %DiI+ T-cells.
[0287] FIG. 36-1C depicts Dil MFI in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by Dil MFI.
[0288] FIG. 36-1D depicts GFP expression in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by %GFP+ T-cells.
[0289] FIG. 36-1E depicts GFP MFI in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by GFP MFI.
[0290] FIG. 36-2A depicts %DiI+ CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by %DiI+ T-cells.
[0291] FIG. 36-2B depicts Dil MFI in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by Dil MFI.
[0292] FIG. 36-2C depicts GFP expression in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by %GFP+ T-cells.
[0293] FIG. 36-2D depicts GFP MFI in CD8+ T-cells transfected with aCD8 targeted LNPs based on DLn-KC2-DMA, as illustrated by GFP MFI.
[0294] FIG. 36-3A depicts CAR expression in CD3+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by %CAR+ of CD3+ in CD3 T-cells.
[0295] FIG. 36-3B depicts CAR MFI in CD3+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by CAR MFI of CD3+ in CD3 T-cells.
[0296] FIG. 36-3C depicts CAR expression in CD4+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by %CAR+ of CD4+ in CD3 T-cells.
[0297] FIG. 36-3D depicts CAR MFI in CD4+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by CAR MFI of CD4+ in CD3 T-cells.
[0298] FIG. 36-3E depicts CAR expression in CD8+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by %CAR+ of CD8+ in CD3 T-cells.
[0299] FIG. 36-3F depicts CAR MFI in CD8+ T-cells of isolated CD3+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by CAR MFI of CD8+ in CD3 T-cells.
[0300] FIG. 36-3G depicts CAR expression in CD4+ T-cells of isolated CD4+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by %CAR+ of CD4+ in CD4 T-cells.
[0301] FIG. 36-3H depicts CAR MFI in CD4+ T-cells of isolated CD4+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by CAR MFI of CD4+ in CD4 T-cells.
[0302] FIG. 36-31 depicts CAR expression in CD8+ T-cells of isolated CD8+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by %CAR+ of CD8+ in CD8 T-cells.
[0303] FIG. 36-3 J depicts CAR MFI in CD8+ T-cells of isolated CD8+ T-cells transfected with aCD8 and aCD4 dual -targeted LNPs based on Lipid 15, as illustrated by CAR MFI of CD8+ in CD8 T-cells.
[0304] FIG. 37A depicts Dil expression in CD8+ T-cells transfected with aCD3- and aCD8-targeted LNPs based on Lipid 15, at mRNA doses of 3, 1, 0.33, 0.11, and 0.037 ug / mL, as illustrated by %DiI+ T-cells.
[0305] FIG. 37B depicts Dil MFI in CD8+ T-cells transfected with aCD3- and aCD8- targeted LNPs based on Lipid 15, at mRNA doses of 3, 1, 0.33, 0.11, and 0.037 ug / mL, as illustrated by Dil MFI.
[0306] FIG. 37C depicts GFP expression in CD8+ T-cells transfected with aCD3- and aCD8-targeted LNPs based on Lipid 15, at mRNA doses of 3, 1, 0.33, 0.11, and 0.037 ug / mL, as illustrated by %GFP+ T-cells.
[0307] FIG. 37D depicts GFP MFI in CD8+ T-cells transfected with aCD3- and aCD8- targeted LNPs based on Lipid 15, at mRNA doses of 3, 1, 0.33, 0.11, and 0.037 ug / mL, as illustrated by GFP MFI.
[0308] FIG. 38A depicts GFP expression in CD8+ T-cells transfected with aCD3- and aCD8-targeted LNPs based on Lipid 15, at various time points, as illustrated by Green Integrated Intensity.
[0309] FIG. 38B depicts level of LNP association (Dil signal) in CD8+ T-cells transfected with aCD3- and aCD8-targeted LNPs based on Lipid 15, at various time points, as illustrated by NIR Integrated Intensity.
[0310] FIG. 39A depicts level of LNP association (Dil signal) in CD8+ T-cells transfected with DLin-KC3-DMA (KC3) LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by %DiI+ CD8+ T-cells.
[0311] FIG. 39B depicts level of LNP association (Dil signal) in CD8+ T-cells transfected with KC3 LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by Dil MFI of CD8+ T-cells.
[0312] FIG. 39C depicts level of GFP expression in CD8+ T-cells transfected with KC3 LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by %GFP+ CD8+ T-cells.
[0313] FIG. 39D depicts level of GFP expression in CD8+ T-cells transfected with KC3 LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by GFP MFI of CD8+ T-cells.
[0314] FIG. 39E depicts level of GFP expression in CD4+ T-cells transfected with KC3 LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by %GFP+ CD4+ T-cells.
[0315] FIG. 39F depicts level of GFP expression in CD4+ T-cells transfected with KC3 LNPs containing different densities of aCD8 (TRX2 and 15C01), at various dose levels, as illustrated by GFP MFI of CD4+ T-cells.
[0316] FIG. 40A depicts viability of CD8+ T-cells transfected with Lipid 15 LNPs containing different variants of the 15C01 aCD8 targeting moiety, at various densities and dose levels, as illustrated by %Live T-cells.
[0317] FIG. 40B depicts LNP association levels (Dil signal) of CD8+ T-cells transfected with Lipid 15 LNPs containing different variants of the 15C01 aCD8 targeting moiety, at various densities and dose levels, as illustrated by %DiI+ T-cells.
[0318] FIG. 40C depicts LNP association levels (Dil signal) of CD8+ T-cells transfected with Lipid 15 LNPs containing different variants of the 15C01 aCD8 targeting moiety, at various densities and dose levels, as illustrated by Dil MFI of T-cells.
[0319] FIG. 40D depicts GFP expression levels of CD8+ T-cells transfected with Lipid 15 LNPs containing different variants of the 15C01 aCD8 targeting moiety, at various densities and dose levels, as illustrated by %GFP+ T-cells.
[0320] FIG. 40E depicts GFP expression levels of CD8+ T-cells transfected with Lipid 15 LNPs containing different variants of the 15C01 aCD8 targeting moiety, at various densities and dose levels, as illustrated by GFP MFI of T-cells.
[0321] FIG. 41A depicts CD69 expression levels of CD8+ T-cells transfected with Lipid 15 LNPs containing aCD3 (SP34) or aCD8 (15C01v8 or TRX2) targeting moi eties, at various dose levels, as illustrated by CD69 MFI of T-cells.
[0322] FIG. 4 IB illustrates a histogram of CD69 expression levels of CD8+ T-cells transfected with Lipid 15 LNPs containing aCD3 (SP34) or aCD8 (15C01v8 or TRX2) targeting moieties, at a dose of 1 ug / mL mRNA.
[0323] FIG. 42 depicts mCherry expression levels of primary NHP CD8+ T-cells transfected with Lipid 15 LNPs containing different aCD8 targeting moieties (15C01 and TRX2) as illustrated by mCherry MFI of T-cells.
[0324] FIG. 43A depicts CD22 CAR (TTR-102 (SEQ ID 294)) expression levels of primary NHP CD8+ T-cells transfected with Lipid 15 or KC3 LNPs containing the 15C01 aCD8 targeting moiety as illustrated by %CD22 CAR+ in CD8+ T-cells.
[0325] FIG. 43B depicts CD22 CAR (TTR-102 (SEQ ID 294)) expression levels of primary NHP CD8+ NK cells transfected with Lipid 15 or KC3 LNPs containing the 15C01 aCD8 targeting moiety as illustrated by %CD22 CAR+ in CD8+ NK cells.
[0326] FIG. 44A depicts T-cell viability of primary human CD8+ cells resulting from Lipid 15 and KC3 LNPs with an aCD8-targeting moiety (15C01 (SEQ ID 1)) after up to 5 freezethaw cycles as illustrated by %Live T-cells.
[0327] FIG. 44B depicts CD22 CAR (TTR-102 (SEQ ID 307)) expression of primary human CD8+ cells resulting from Lipid 15 and KC3 LNPs with an aCD8-targeting moiety (15C01 (SEQ ID 1)) after up to 5 freeze-thaw cycles as illustrated by %CD22 CAR+ T-cells.
[0328] FIG. 44C depicts CD22 CAR (TTR-102 (SEQ ID 307)) expression of primary human CD8+ cells resulting from Lipid 15 and KC3 LNPs with an aCD8-targeting moiety (15C01 (SEQ ID 1)) after up to 5 freeze-thaw cycles as illustrated by CD22 CAR MFI.
[0329] FIG. 44-1 A depicts viability of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by %Live cells.
[0330] FIG. 44-1B CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by %CAR+ cells.
[0331] FIG. 44-1C CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by CAR MFI.
[0332] FIG. 44-1D CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by %CAR+ cells at different mRNA doses.
[0333] FIG. 44-1E CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by CAR MFI at different mRNA doses.
[0334] FIG. 44-1F CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by %CAR+ cells at different time points.
[0335] FIG. 44-1G CAR expression (TTR-102 (SEQ ID 316)) of primary human CD8+ cells resulting from Lipid 15 LNPs with varying DSPC content and with an aCD8-targeting moiety (15C01v8 (SEQ ID 9)) as illustrated by CAR MFI at different time points.
[0336] FIG. 45 illustrates the general 2nd generation CAR design (top panel) consisting of an antiCD22 ScFv with a VH and VL domain connected by a linker, an extracellular hinge domain, a transmembrane domain, and an intracellular co-stimulatory domain and signaling domain. The bottom panel illustrates four different CAR cassette designs with varying extracellular hinge domains.
[0337] FIG. 46 depicts the CD22 CAR expression in HEK293T cells transfected with CAR plasmid DNA as illustrated by %CAR expression.
[0338] FIG. 47 depicts the upregulation of the early T-cell activation marker, CD69, in Jurkat cells transfected with CAR plasmid DNA and co-cultured with target-expressing Raji cells, as illustrated by the fold-over background of CD69 expression.
[0339] FIG. 48A depicts the CD22 CAR expression in Jurkat cells transfected with mRNA encoding various CD22 CAR constructs as illustrated by %CAR Expression.
[0340] FIG. 48B depicts the CD22 CAR expression in Jurkat cells transfected with mRNA encoding various CD22 CAR constructs as illustrated by CAR MFI expression.
[0341] FIG. 49A depicts the CD22 CAR expression in primary human T-cells transfected with mRNA encoding various CD22 CAR constructs as illustrated by %CAR Expression.
[0342] FIG. 49B depicts the CD22 CAR expression in primary human T-cells transfected with mRNA encoding various CD22 CAR constructs as illustrated by CAR MFI expression.
[0343] FIG. 50 depicts CAR-mediated cytotoxicity of Raji cells co-cultured with human T-cells transfected with mRNA encoding various CD22 CAR constructs by electroporation as illustrated by %Dead Raji cells.
[0344] FIG. 51 A depicts CAR-mediated cytotoxicity of Nalm6 cells co-cultured with human T-cells transfected with mRNA encoding various CD22 CAR constructs by electroporation as illustrated by %Dead Nalm6 cells.
[0345] FIG. 5 IB depicts CAR-mediated cytotoxicity of K562 cells co-cultured with human T-cells transfected with mRNA encoding various CD22 CAR constructs by electroporation as illustrated by %Dead K562 cells.
[0346] FIG. 52 depicts the epitope binning of anti-CD22 binders against CD22.
[0347] FIG. 53 depicts the fraction of T-cells transfected with mRNA encoding various CD22 CAR constructs binding human CD22 antigen and Rhesus CD22 antigen, receptively, as illustrated by %CD22 CAR+ cells.
[0348] FIG. 54 depicts the CD22 CAR protein expression levels over a time course of 120 hours in primary human T-cells resulting from CAR mRNA transfection, as illustrated by %CD22 CAR+ cells.
[0349] FIG. 55 depicts the level of cytokine secretion (TNF-alpha, IFN-gamma, Granzyme A, Granzyme B, and GM-CSF) in primary human T-cells transfected with Lipid 15 LNPs containing antiCD8 (15C01) targeting moiety and encapsulating various CAR mRNA constructs as illustrated by the level of cytokine secreted in pg / mL.
[0350] FIG. 56 depicts the levels of CD22 expression on various cancer cell lines as illustrated by CD22 receptors per cell.
[0351] FIG. 57A depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with wild-type Nalm6 cells, as illustrated by %Dead Nalm6 WT cells.
[0352] FIG. 57B depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with CD22 knockout (KO) Nalm6 cells, as illustrated by %Dead Nalm6 CD22KO cells.
[0353] FIG. 57C depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with wild-type Raji cells, as illustrated by %Dead Raji WT cells.
[0354] FIG. 57D depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with CD22 knockout (KO) Raji cells, as illustrated by %Dead Raji CD22KO cells.
[0355] FIG. 57E depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with Daudi cells, as illustrated by %Dead Daudi cells.
[0356] FIG. 57F depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with K562 cells, as illustrated by %Dead K562 cells.
[0357] FIG. 57G depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with JVM-2 cells, as illustrated by %Dead JVM-2 cells.
[0358] FIG. 57H depicts the level of cytotoxicity resulting from T-cells transfected with Lipid 15 LNPs with inserted antiCD8 (15C01v8)-targeting moiety encapsulating various CAR- encoding mRNA payloads and co-cultured with Reh cells, as illustrated by %Dead Reh cells.
[0359] FIG. 58A depicts the CD22 CAR protein expression in primary human CD8+ T- cells resulting from Lipid 15 LNPs with an antiCD8-targeting moiety (15C01v8) encapsulating various mRNA-encoding CARs or reporter protein (mCherry), as illustrated by CD22 CAR MFI.
[0360] FIG. 58B depicts the mCherry protein expression in primary human CD8+ T-cells resulting from Lipid 15 LNPs with an antiCD8-targeting moiety (15C01v8 (SEQ ID 9)) encapsulating various mRNA-encoding CARs (SEQ ID 316 and SEQ ID 313) or reporter protein (mCherry), as illustrated by %mCherry+ cells.
[0361] FIG. 59A depicts repeated CAR-mediated cytotoxicity of Nalm6 target cells resulting from co-culture with CD8+ T-cells after transfection with Lipid 15 LNPs inserted with a CD8-targeting moiety (15C01 (SEQ ID 1)) and encapsulating CD22 CAR mRNA (TTR- 102 (SEQ ID 307)), as illustrated by %Nalm6 cell (normalized to T=0). Nalm6 cells were added to the culture every 48 hours and LNPs were added every 96 hours.
[0362] FIG. 59B depicts repeated CAR-mediated cytotoxicity of Nalm6 target cells resulting from co-culture with CD8+ T-cells after transfection with Lipid 15 LNPs inserted with a CD8-targeting moiety (15C01 (SEQ ID 1)) and encapsulating CD22 CAR mRNA (TTR- 102 (SEQ ID 307)), as illustrated by %Nalm6 cell (normalized to T=0). Nalm6 cells were added to the culture every 96 hours.
[0363] FIG. 60A depicts CD22 CAR expression in T-cells after transfection with anti-CD8 (15C01 (SEQ ID 1)) targeted LNPs based on Lipid 15 encapsulating mRNA encoding various UTR- and codon-optimized variants of TTR-102 (SEQ ID 307 and SEQ ID 316) and TTR-121 (SEQ ID 315 and SEQ ID 317), respectively, as illustrated by %CAR+ cells.
[0364] FIG. 60B depicts CD22 CAR expression in T-cells after transfection with anti-CD8 (15C01 (SEQ ID 1)) targeted LNPs based on Lipid 15 encapsulating mRNA encoding various UTR- and codon-optimized variants of TTR-102 (SEQ ID 307 and SEQ ID 316) and TTR-121 (SEQ ID 315 and SEQ ID 317), respectively, as illustrated by CAR MFI.
[0365] FIG. 61 A depicts CAR-mediated cytotoxicity of Raji target cells resulting from coculture with CD8+ T-cells after transfection with Lipid 15 LNPs inserted with a CD8-targeting moiety (15C01 (SEQ ID 1)) and encapsulating mRNA encoding various UTR- and codon- optimized variants of TTR-102 (SEQ ID 307 and SEQ ID 316) and TTR-121 (SEQ ID 315 and SEQ ID 317), respectively, as illustrated by %Dead Raji cells at various effector-to-target cell ratios (E:Ts).
[0366] FIG. 6 IB depicts CAR-mediated cytotoxicity of Nalm6 target cells resulting from co-culture with CD8+ T-cells after transfection with Lipid 15 LNPs inserted with a CD8- targeting moiety (15C01 (SEQ ID 1)) and encapsulating mRNA encoding various UTR- and codon-optimized variants of TTR-102 (SEQ ID 307 and SEQ ID 316) and TTR-121 (SEQ ID 315 and SEQ ID 317), respectively, as illustrated by %Dead Nalm6 cells at various effector- to-target cell ratios (E:Ts).
[0367] FIG. 62A depicts in vivo CAR T expression in blood 24 hr after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown to multiple dose levels. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0368] FIG. 62B depicts in vivo CAR T expression in blood after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown at diverse time points after administrating one dose of LNP / mRNA at 0.3 mg / kg. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0369] FIG. 62C depicts in vivo CAR T expression in blood 24 hr after in vivo delivery via tail vein of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown 24 hr post administration of Dose# 1 or Dose #3 at 0.3 mg / kg. PBMC-engrafted NSG mice were dosed at day 14 (Dose #1) or 21 (Dose #3) post PBMC engraftment.
[0370] FIG. 62D depicts in vivo CAR T expression in spleen 24 hr after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+T cells is shown to multiple dose levels. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0371] FIG. 62E depicts in vivo CAR T expression in bone marrow (BM) 24 hr after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown to multiple dose levels. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0372] FIG. 62F depicts in vivo CAR T expression in lung 24 hr after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown to multiple dose levels. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0373] FIG. 62G depicts in vivo CAR T expression in spleen after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown at diverse time points after administrating one dose of LNP / mRNA at 0.3 mg / kg. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0374] FIG. 62H depicts in vivo CAR T expression in bone marrow (BM) after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown at diverse time points after administrating one dose of LNP / mRNA at 0.3 mg / kg. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0375] FIG. 621 depicts in vivo CAR T expression in lung after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. % of anti-CD22 CAR T in total alive gated CD8+ T cells is shown at diverse time points after administrating one dose of LNP / mRNA at 0.3 mg / kg. PBMC-engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0376] FIG. 63A depicts in vivo CAR T function in spleen after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. B cell aplasia was used as a tool to evaluatefunctional CAR T persistence in vivo. % of CD 19+ B cells in total alive gated hCD45+ T cells is shown at 24 hr post one single dose of LNP / mRNA at 0.3 mg / kg. PBMC -engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0377] FIG. 63B depicts in vivo CAR T function in bone marrow (BM) after in vivo delivery via tail vein of one single dose of LNP inserted with a CD8-Targeting moiety (15C01) and encapsulating mRNA encoding for TTR-102. B cell aplasia was used as a tool to evaluate functional CAR T persistence in vivo. % of CD 19+ B cells in total alive gated hCD45+ T cells is shown at 24 hr post one single dose of LNP / mRNA at 0.3 mg / kg. PBMC -engrafted NSG mice were dosed at day 14 post PBMC engraftment.
[0378] FIG. 64A depicts cytokine secretion of IFN-alpha2 from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0379] FIG. 64B depicts cytokine secretion of IFN-gamma from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0380] FIG. 64C depicts cytokine secretion of IL-10 from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0381] FIG. 64D depicts cytokine secretion of IL-6 from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0382] FIG. 64E depicts cytokine secretion of MIP-lbeta from MIMIC® assay when induced with CD8-targeted (15C01v8 SEQ ID 9) LNPs encapsulating various concentrations of dsRNA.
[0383] FIG. 64F depicts cytokine secretion of RANTES from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0384] FIG. 64G depicts cytokine secretion of TNF-alpha from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) LNPs encapsulating various concentrations of dsRNA.
[0385] FIG. 65 depicts cytokine secretion of TNF-alpha, IL-2, IFN-gamma, IL-4, MIP- Ibeta, IL-6, and IFN-alpha2 from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) Lipid 15 LNPs or non-targeted (NT) Lipid 15 LNPs encapsulating CD22 CAR mRNA (TTR-102 (SEQ ID 307)).
[0386] FIG. 66 depicts cytokine secretion of TNF-alpha, IL-2, IFN-gamma, IL-4, MIP- Ibeta, IL-6, and IFN-alpha2 from MIMIC® assay when induced with CD8-targeted (15C01v8 (SEQ ID 9)) Lipid 15 LNPs encapsulating TTR-102 (SEQ ID 307), TTR-121 (SEQ ID 315), or TTR-103 (SEQ ID 306) CD22 CAR mRNAs, or mCherry mRNA.
[0387] FIG. 67 depicts cytokine secretion of TNF-alpha, IL-2, IFN-gamma, IL-4, MIP- Ibeta, IL-6, and IFN-alpha2 from MIMIC® assay when induced with LNPs based on Lipid 15, KC3, MC3, or Lipid 9.
[0388] FIG. 68 depicts cytokine secretion of TNF-alpha, IL-2, IFN-gamma, IL-4, MIP- Ibeta, IL-6, and IFN-alpha2 from MIMIC® assay when induced with targeted (15C01 (SEQ ID 1)) or non-targeted (NT) LNPs based on Lipid 15, KC3, MC3, or Lipid 9.
[0389] FIG. 69. Anion Exchange Chromatography profile of VHH 15C01-GGC after capture and subsequent polish. The product was loaded on Capto Q ImpRes (Cytiva) in a 25 mM Tris pH7.5 buffer and eluted with the same buffer with a salt gradient from 0 to 2000 mM ofNaCl.
[0390] FIG. 70. Anion Exchange Chromatography profile of VHH 15C01-GGC after capture, a reduction step in TCEP and subsequent polish. The product was loaded on Capto Q ImpRes (Cytiva) in a 25 mM Tris pH7.5 buffer and eluted with the same buffer with a salt gradient from 0 to 2000 mM of NaCl.
[0391] FIG. 71 depicts concept and compositions of an exemplary targeted LNP.
[0392] FIG. 72. depicts exemplary method for making phospholipid-PEG-ISVD conjugate.
[0393] FIG. 73 depicts an example of using click chemistry to make phospholipid-PEG- ISVD conjugate.
[0394] FIG. 74 depicts an exemplary method for making targeted LNP through antibody conjugated lipid-PEG micelles and parent LNPs.
[0395] FIG. 75 depicts the concept of reprogramming CD22 CAR-T cells in vivo using targeted mRNA LNPs. Upon intravenous infusion, the LNPs engage with the receptor on the T-cells via the inserted targeting moiety. Receptor engagement results in endocytosis of the LNP followed by endosomal escape of the mRNA. The mRNA is then available for translation by the ribosome and the encoded protein, being the chimeric antigen receptor (CAR) molecule, is expressed on the surface of the T-cell. Once the CAR is expressed, the T-cell can mediate its effector function - killing of malignant CD22-expressing B-cells.
[0396] FIG. 76 A to FIG. 76G depicts Lipid 15-based LNPs show highly efficient mRNA delivery to primary human T-cells in vitro and 1.5% DPG-PEG shows superior transfection in vivo. FIG. 76A) Illustration of the LNP formulation workflow. The left panel depicts how an aqueous solution containing the mRNA and an organic solution containing the various lipids are mixed by microfluidic mixing using a NanoAssemblr Ignite. The right panel depicts how a protein-based targeting moiety conjugate is post-inserted into the non-targeted LNP to form a targeted LNP. Created with BioRender.com. FIG. 76B) The fraction of DiLpositive primary human T-cells, demonstrating the level of association and binding to T-cells 24 hours after incubation with 1 pg / mL CD8-targeted LNPs formulated with different ionizable lipids and encapsulating mRNA encoding GFP. FIG. 76C) The fraction of GFP -positive T-cells and FIG. 76D) the GFP MFI evaluating the level of protein expression in T-cells 24 hours after incubation with 1 pg / mL and 0.25 pg / mL CD8-targeted LNPs formulated with different ionizable lipids and encapsulating mRNA encoding GFP. Data are mean of values in n = 2 replicates. The displayed p-values are from a two-way ANOVA. FIG. 76E) Histograms of Dil and GFP values in one representative donor illustrating the differences between CD8 -targeted LNPs based on Lipid 15 and ALC-0315. FIG. 76F) In vivo comparison of 1 mg / kg CD3- targeted (SP34) LNPs based on DLin-KC2-DMA (KC2) and with 2.5% DMG-PEG, DPG- PEG, and DSG-PEG, respectively, demonstrating the level of GFP -positive cells of CD4+ and CD8+ T-cells, 24 hours after intravenous injection into humanized NSG mice. Data are from biologically independent mice (n = 4 in LNP -treated groups, n = 3 in vehicle group). The displayed p-values are from a two-way ANOVA. FIG. 76G) In vivo comparison of 0.3 mg / kgCD3-targeted (SP34) LNPs based on KC2 and with different percentages of DMG-PEG, DPG- PEG, and DPPE-PEG, demonstrating the level of GFP-positive cells of CD8+ T-cells, 24 hours after intravenous injection into humanized NSG mice. Data are from biologically independent mice (n = 4 in LNP groups, n = 2 in vehicle group). The displayed p-values are from an ordinary one-way ANOVA.
[0397] FIG. 77A to FIG. 77E depicts aCD8 ISVD-targeted LNPs show dose-dependent and specific delivery to CD8+ cells without inducing cytokine release in vitro. FIG. 77A) The fraction of Dil- and FIG. 77B) GFP-positive primary human T-cells 24 hours after incubation with 0.33 pg / mL mRNA encapsulated in targeted LNPs inserted with aCD8 (anti-CD8 Fab (TRX2) or Nb8), aCD3 (anti-CD3 Fab (SP34)), or non-binding (Fab (mutOKT8)) targeting moieties in three independent donors. Each bar represents the mean of technical replicates (n = 3). The displayed p-values are from a two-way ANOVA. FIG. 77C) The level of GFP expression over time in T-cells evaluated with the Incucyte SX5 and illustrated as the Green Integrated Intensity (GCU). Data are from biologically independent replicates (n = 3). FIG. 77D) Levels of IFN-y detected in the supernatants 24 hours after incubation with 0.33 pg / mL mRNA encapsulated in targeted LNPs. Each bar represents the mean of technical replicates (n = 3). FIG. 77E) Ex vivo whole blood experiment enabling investigation of expression in Granulocytes, B-cells, T-cells, and NK cells by flow cytometry (left panel). Fraction of GFP- positive cells in various cell subsets 24 hours after incubation with mRNA-encapsulating LNPs inserted with the humanized aCD8 VHH (Nb8-H3) or non-binding (Fab (mutOKT8)) targeting moieties (right panel). Data are from biologically independent replicates (n = 8). Created with BioRender.com.
[0398] FIG. 78A to FIG. 78L depicts aCD8 ISVD-targeted LNPs allow for specific and functional CAR T-cell reprogramming in vitro. FIG. 78A) Illustration of the PBMC transfection workflow. PBMCs from healthy donors were seeded into a 12-well plate and rested for 2 hours before transfecting with 0.3 pg / mL mRNA encapsulated in LNPs targeted with the humanized aCD8 VHH (Nb8-H3). 4 hours after LNP addition, unbound LNPs were washed away, and cells were incubated for 24 hours until staining and analysis. Created with BioRender.com. FIG. 78B) The fraction of CD22 CAR-positive of CD8+ human T-cells and FIG. 78C) of CD4+ human T-cells, 24 hours after incubation with aCD8 (Nb8-H3) targeted LNPs encapsulating mRNA encoding a CD22 (22-V4) chimeric antigen receptor (CAR) or a non-CAR payload (LNP control). FIG. 78D) The number of live B-cells per 100 pL of theacquired sample. Data are from biologically independent replicates (n = 4). The displayed p- values are from a two-way ANOVA. CAR T-cells were co-cultured with FIG. 78E) Nalm6 wildtype (WT) and FIG. 78F) Nalm6 CD22 knock-out (KO) cancer cell lines, respectively, at increasing effector-to-target cell ratios (E:Ts) and the level of CAR-mediated cytotoxicity was evaluated 48 hours later. Data are from biologically independent replicates (n = 3). The displayed p-value is from a two-tailed paired t-test comparing 22-V4 to m971. FIG. 78G) Representative ImageStream images of LNP -transfected CD8+ T-cells 24 hours after LNP addition. Staining shows CD8 and CAR expression in live single cells in 22-V4-LNP treated T-cells (left panel) and untreated T-cells (right panel). FIG. 78H) Representative ImageStream images (left panel) of LNP -transfected CD8+ T-cells co-cultured with CTV-stained Nalm6 for 24 hours demonstrating CAR-mediated target cell binding. Staining shows CD8, CAR, and CTV in live doublets. The percent live touching doublet events of total live doublet events was quantified and compared between treatment groups (right panel). Data are mean of values in n > 2 technical replicates. The displayed p-values are from one-way ANOVA. FIG. 781) Repeated killing of Nalm6 cells with re-addition of LNPs every 4 days and Nalm6 cell every 2 days or FIG. 78 J) without re-addition of LNPs and with re-addition of Nalm6 cells every 4 days. Data are from biologically independent replicates (n = 3). The displayed p-values are from two-tailed paired t-tests comparing 22- V4 to the LNP control. Created with BioRender.com. FIG. 78K) MIMIC® data showing cytokine levels in samples treated with non-CAR LNPs (LNP control) and CAR-LNPs (22-V4), respectively, and compared to PBS- treated samples. Data are from biologically independent replicates (n = 6). The displayed p- values are from a two-way ANOVA. FIG. 78L) MIMIC® data showing cytokine levels in groups treated with CAR-LNPs (22-V4) containing RP-HPLC-purified CAR mRNA and 0.2% spiked in dsRNA, respectively. Data are from biologically independent replicates (n = 6). The displayed p-values are from multiple paired t-tests.
[0399] FIG. 79A to FIG. 79F depicts CD8-targeted Lipid 15 LNPs enable efficient reprogramming of CAR-T cells directly in vivo. FIG. 79A) The fraction of CD22 CAR-positive primary human CD8+ T-cells in the blood, spleen, bone marrow (BM), and lungs, respectively, 24 hours after intravenous tail vein injection of 0.3 mg / kg aCD8 (Nb8-H3) targeted LNPs encapsulating mRNA encoding a CD22 (22-V4) CAR. Data are from biologically independent mice (n = 3). The displayed p-values are from a two-way ANOVA. FIG. 79B) The fraction of CD22 CAR-positive primary human CD8+ T-cells in the blood 24 hours after the first (Day 2) and fourth (Day 11) dose of 0.3 mg / kg aCD8 (Nb8-H3) targeted LNPs encapsulating mRNAencoding a CD22 (22-V4) CAR. Data are from biologically independent mice (n > 3). The displayed p-values are from a two-way ANOVA. FIG. 79C) Fraction of CD 19-positive cells in the spleen and BM demonstrating B-cell aplasia. Data are from biologically independent mice (n > 4). The displayed p-values are from a two-way ANOVA. FIG. 79D) The percent body weight (BW) changes after dosing twice per week. Data are from biologically independent mice (n > 3). The displayed p-values are from two-tailed paired t-tests comparing 22-V4 to the vehicle group. FIG. 79E) The spleen weight is reported as the % weight of the spleen per BW 24 hours after the fourth dose. Data are from biologically independent mice (n > 3). The displayed p-value is from an unpaired t-test. FIG. 79F) The fraction of GFP-positive cells in different subsets of the liver. Data are from biologically independent mice (n = 3). The displayed p-values are from a two-way ANOVA.
[0400] FIG. 80A to FIG. 80D depicts In vivo reprogrammed CAR-T cells suppress the growth of a humanized orthotopic tumor efficacy model. FIG. 80 A) Illustration of the humanized Nalm6 tumor model. Nalm6-Luc tumor cells were intravenously (IV) injected into NSGMHC VII KO mice on Day 0. On day 6, human PBMCs were engrafted by an IV injection followed by IV administration of vehicle buffer or Nb 8 -H3 -targeted LNPs containing mCherry or CAR-encoding mRNA (22-V4) on days 7, 11, 14, 18, and 21 and imaging by IVIS on days 6, 11, 14, 18, 21, and 26. FIG. 80B) Luciferase imaging was performed at the respective time points. FIG. 80C) Tumor growth over time as illustrated by the quantified luciferase signals shown as the average radiance (p / sec / cm2 / sr). Data are from biologically independent mice (n = 9). The displayed p-values are from a two-way ANOVA comparing 22-V4 to the vehicle group at each time point. FIG. 80D) Immunohistochemistry (H4C) of the liver and spleen on Day 26 of the study. The arrows indicate CD22-positive tumor cells. The displayed images are from left to right, Mouse ID 1-5, Mouse ID 2-3, and Mouse ID 3-3.
[0401] FIG. 81 A to FIG. 8 ID depicts characterization of Lipid 15-based LNPs encapsulating CAR- or GFP-encoding mRNA. FIG. 81 A) Size distribution, poly dispersity index (PDI), and FIG. 8 IB) zeta potential at pH 5.5 and pH 7.4 were measured using a Zetasizer. FIG. 81C) The RNA encapsulation efficiency was quantified using the Quant -iT RiboGreen RNA Assay Kit. Measurements were performed in triplicates. FIG. 8 ID) Representative CryoEM images of aCD8 (Nb8-H3) targeted Lipid 15 LNPs. 200 pM (top panel) and 500 pM scale shown (bottom panel). Created with BioRender.com.
[0402] FIG. 82A to FIG. 82F depicts Lipid chemistry of various lipids. Chemical structures of FIG. 82A) DLin-KC2-DMA (KC2-DMA), FIG. 82B) KC3-DMA, FIG. 82C) ALC-0315, FIG. 82D) SM-102, FIG. 82E) Dialkyl lipid, and FIG. 82F) phospholipid degradation.
[0403] FIG. 83 A to FIG. 83C depicts chemical structures of novel ionizable lipids and PEG lipids. Chemical structures of FIG. 83 A) proprietary branched lipids 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 15, 16, 24A, and 26. FIG. 83B) Chemical structures of DMG-PEG, DPG-PEG, and DSG-PEG. FIG. 83C) Chemical structures of DMPE-PEG, DPPE-PEG, and DSPE-PEG.
[0404] FIG. 84A to FIG. 84L depicts Lipid 15-based LNPs show low immunogenicity and efficient mRNA delivery after freeze-thaw. (FIG. 84A-FIG. 84C) Cytokine levels (pg / mL) comparing the effect of different ionizable lipid formulations in the MIMIC® assay. Data are from biologically independent replicates (n = 6). The displayed p-values are from one-way ANOVA. FIG. 84D) The fraction of Dil-positive primary human T-cells and (FIG. 84E) the Dil MFI demonstrating the level of association and binding to T-cells 24 hours after incubation with LNPs formulated with different ionizable lipids and pre- (4C) and post- freeze-thawing (FT). (FIG. 84F) The fraction of GFP -positive T-cells and (FIG. 84G) the GFP MFI evaluating the level of protein expression in T-cells 24 hours after incubation with LNPs formulated with different ionizable lipids and pre- (4C) and post-freeze-thawing (FT). (FIG. 84H) The fraction of live primary human T-cells normalized to a PBS-treated control demonstrating no significant decrease in T-cell viability 24 hours after incubation with LNPs formulated with different ionizable lipids and pre- (4C) and post-freeze-thawing (FT). Data are mean of values in n = 2 replicates. The displayed p-values are from one-way ANOVA. (FIG. 84I-FIG. 84L) In vivo comparison of 1 mg / kg CD3-targeted LNPs based on KC2 and with 2.5% DMG-PEG, DPG- PEG, and DSG-PEG, respectively, demonstrating the level of GFP -positive cells of CD4+ and CD8+ T-cells, 24 hours after intravenous injection into humanized NSG mice in various organs. Data are from biologically independent mice (n = 4 in LNP -treated groups, n = 3 in vehicle group). The displayed p-values are from a two-way ANOVA.
[0405] FIG. 85A to FIG. 85B depicts size and PDI of LNPs formulated with novel ionizable lipids 1-8. FIG. 85A) Diameter (DLS, nm) of LNPs based on Lipid 1 to Lipid 8 in pH 7.4 HBS, pH 6.5 MBS, post antibody (aCD3, SP34) insertion and post freeze-thaw (-80°C). FIG. 85B) Poly dispersity (DLS) of LNPs based on Lipid 1 to Lipid 8 in pH 7.4 HBS, pH 6.5 MBS, post antibody (aCD3, SP34) insertion and post freeze-thaw (-80°C). Data are mean of values in n = 2 replicates
[0406] FIG. 86A to FIG. 86B depicts size and PDI of LNPs formulated with novel ionizable lipids 9, 10, 11, and 15. FIG. 86 A) Diameter (DLS, nm) of LNPs based on Lipids 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, post antibody (aCD3, SP34) insertion and post freeze-thaw (-80°C). FIG. 86B) Poly dispersity (DLS) of LNPs based on Lipids 9, 10, 11, and 15 in pH 7.4 HBS, pH 6.5 MBS, post antibody (aCD3, SP34) insertion and post freeze-thaw (- 80°C). Data are mean of values in n = 2 replicates.
[0407] FIG. 87A to FIG. 87D depicts LNP characterization of LNPs formulated with ionizable lipids 10, 15, 16, 24A, and 26. FIG. 87A) Diameter (DLS, nm) of targeted LNPs (aCD8, Nb8 VHH) based on Lipids 10, 15, 16, 24A, 26, and ALC-0315 pre and post freezethaw. FIG. 87B) Poly dispersity of targeted LNPs (aCD8, Nb8 VHH) based on Lipids 10, 15, 16, 24A, 26, and ALC-0315 pre and post freeze-thaw. FIG. 87C) Zeta Potential (mV) of targeted LNPs (aCD8, Nb8 VHH) based on Lipids 10, 15, 16, 24A, 26, and ALC-0315 pre and post freeze-thaw in pH 5.5 MES and pH 7.4 HBS. FIG. 87D) Total mRNA recovery (ug / mL) and % dye-accessible mRNA of targeted LNPs (aCD8, Nb8 VHH) based on Lipids 10, 15, 16, 24 A, 26, and ALC-0315 pre and post freeze-thaw.
[0408] FIG. 88A to FIG. 88E depicts transfection of human T-cells with CD3-targeted LNPs based on Lipids 1, 3, and 5 pre- and post freeze-thaw. FIG. 88 A) %GFP+ primary human T-cells after transfection with CD3 -targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 1 (4°C stored), Lipid 3 (4°C stored), and Lipid 5 (4°C stored). FIG. 88B) %GFP+ primary human T-cells after transfection with CD3 -targeted LNPs based on DLn-KC2-DMA, Lipid 1, Lipid 3, and Lipid 5 after freeze-thaw cycle (-80°C storage). FIG. 88C) GFP MFI in primary human T-cells after transfection with CD3-targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 1 (4°C stored), Lipid 3 (4°C stored), and Lipid 5 (4°C stored). FIG. 88D) GFP MFI in primary human T-cells after transfection with CD3-targeted LNPs based on DLn-KC2- DMA, Lipid 1, Lipid 3, and Lipid 5 after freeze-thaw cycle (-80°C storage). FIG. 88E) %Live primary human T-cells after transfection with CD3-targeted LNPs based on DLn-KC2-DMA, Lipid 1, Lipid 3, and Lipid 5 after freeze-thaw cycle (-80°C storage).
[0409] FIG. 89A to FIG. 89C depicts transfection of human T-cells with CD3-targeted LNPs based on Lipids 1 and 8 pre- and post freeze-thaw. FIG. 89A) %GFP+ primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA, Lipid 1 (4°C stored), Lipid 8 (4°C stored), and Lipid 8 (-80°C stored). FIG. 89B) GFP MFI in primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA,Lipid 1 (4°C stored), Lipid 8 (4°C stored), and Lipid 8 (-80°C stored). FIG. 89C) %Live primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2- DMA, Lipid 1 (4°C stored), Lipid 8 (4°C stored), and Lipid 8 (-80°C stored).
[0410] FIG. 90A to FIG. 90D depicts transfection of human T-cells with CD3-targeted LNPs based on Lipids 8, 9, and 10 pre- and post freeze-thaw. FIG. 90 A) %GFP+ primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 8 (4°C stored), Lipid 9 (4°C stored), and Lipid 10 (4°C stored). FIG. 90B) %GFP+ primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 8 (-80°C stored), and Lipid 10 (-80°C stored). FIG. 90C) GFP MFI in primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 8 (4°C stored), Lipid 9 (4°C stored), and Lipid 10 (4°C stored). FIG. 90D) GFP MFI in primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 8 (-80°C stored), and Lipid 10 (-80°C stored).
[0411] FIG. 91A to FIG. 91E depicts transfection of human T-cells with CD3-targeted LNPs based on Lipids 3, 4, 9, and 15 pre- and post freeze-thaw. FIG. 91 A) %GFP+ primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 3 (4°C stored), Lipid 4 (4°C stored), Lipid 9 (4°C stored), and Lipid 15 (4°C stored). FIG. 91B) %GFP+ primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 3 (-80°C stored), Lipid 4 (- 80°C stored), Lipid 9 (-80°C stored), and Lipid 15 (-80°C stored). FIG. 91C) GFP MFI in primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2- DMA (-80°C stored), Lipid 3 (4°C stored), Lipid 4 (4°C stored), Lipid 9 (4°C stored), and Lipid 15 (4°C stored). FIG. 91D) GFP MFI in primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2-DMA (-80°C stored), Lipid 3 (-80°C stored), Lipid 4 (-80°C stored), Lipid 9 (-80°C stored), and Lipid 15 (-80°C stored). FIG. 9 IE) %Live primary human T-cells after transfection with aCD3 (SP34) targeted LNPs based on DLn-KC2- DMA (-80°C stored), Lipid 3 (-80°C stored), Lipid 4 (-80°C stored), Lipid 9 (-80°C stored), and Lipid 15 (-80°C stored).
[0412] FIG. 92A to FIG. 92E depicts transfection of human T-cells with CD8-targeted vs non-targeted LNPs based on Lipids 3, 4, 9, and 15. FIG. 92A) %GFP+ primary human T-cells after transfection with aCD8 (Nb8) targeted or non-targeted LNPs based on Lipid 3, Lipid, 4,Lipid 9, and Lipid 15. FIG. 92B) GFP MFI in primary human T-cells after transfection with aCD8 (Nb8) targeted or non-targeted LNPs based on Lipid 3, Lipid, 4, Lipid 9, and Lipid 15. FIG. 92C) %DiI+ primary human T-cells after transfection with aCD8 (Nb8) targeted or nontargeted LNPs based on Lipid 3, Lipid, 4, Lipid 9, and Lipid 15. FIG. 92D) Dil MFI in primary human T-cells after transfection with aCD8 (Nb8) targeted or non-targeted LNPs based on Lipid 3, Lipid, 4, Lipid 9, and Lipid 15. FIG. 92E) %Live primary human T-cells after transfection with aCD8 (Nb8) targeted or non-targeted LNPs based on Lipid 3, Lipid, 4, Lipid 9, and Lipid 15.
[0413] FIG. 93A to FIG. 93E depicts transfection of human T-cells with CD8-targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 pre and post freeze-thaw. FIG. 93 A) %GFP+ primary human T-cells after transfection with aCD8 (Nb8) targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 and comparator lipid ALC-0315 pre and post freeze-thaw. FIG. 93B) GFP MFI in primary human T-cells after transfection with aCD8 (Nb8) targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 and comparator lipid ALC-0315 pre and post freeze-thaw. FIG. 93C) %DiI+ primary human T-cells after transfection with aCD8 (Nb8) targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 and comparator lipid ALC-0315 pre and post freeze-thaw. FIG. 93D) Dil MFI in primary human T-cells after transfection with aCD8 (Nb8) targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 and comparator lipid ALC-0315 pre and post freeze-thaw. FIG. 93E) %Live primary human T-cells after transfection with aCD8 (Nb8) targeted LNPs based on Lipids 10, 15, 16, 24A, and 26 and comparator lipid ALC-0315 pre and post freeze-thaw.
[0414] FIG. 94 A to FIG. 94F depicts aCD3 -targeted LNPs induce cytokine secretion and upregulation of CD69 in human T-cells in vitro. FIG. 94A) The Dil MFI and FIG. 94B) GFP MFI of human T-cells 24 hours after incubation with varying doses of mRNA-encapsulating LNPs inserted with aCD8 (Nb8 or CD8 Fab), aCD3 (CD3 Fab), or non-binding (Fab control) targeting moieties in 3 independent human donors. Data are from technical replicates (n = 3). FIG. 94C) CD69 MFI of human T-cells 24 hours after incubation with varying doses of mRNA- encapsulating LNPs inserted with aCD8 (Nb8 or CD8 Fab), aCD3 (CD3 Fab), or non-binding (Fab control) targeting moieties in 3 independent human donors. Data are from technical replicates (n = 3). FIG. 94D) Histograms of CD69 values in one representative donor (Donor 1) illustrating the differences between cells treated with aCD3-targeted LNPs and aCD8- targeted LNPs. FIG. 94E) The level of Dil-LNP association over time with T-cells evaluatedwith the Incucyte SX5 and illustrated as the Near InfraRed (NIR) Integrated Intensity (NIRCU). Data are from biologically independent replicates (n = 3). FIG. 94F) Levels of TNF- a detected in the supernatants 24 hours after incubation with varying doses of mRNA- encapsulating LNPs in 3 independent human donors. Data are from technical replicates (n = 3). The displayed p-values are from a two-way ANOVA.
[0415] FIG. 95A to FIG. 95E depicts comparison of LNPs inserted with humanized variants of Nb8. FIG. 95A) The fraction of live T-cells 24 hours after incubation with 1, 0.3, and 0.06 pg / mL mRNA encapsulated in targeted LNPs inserted with humanized variants of Nb8 at different densities. Each bar represents the mean of technical duplicates (n = 2). FIG. 95B) The Dil-positive fraction and FIG. 95C) Dil MFI of primary human T-cells 24 hours after incubation with 1, 0.3, and 0.06 pg / mL mRNA encapsulated in targeted LNPs inserted with humanized variants of Nb8 at different densities. Data are mean of values in n = 2 replicates. FIG. 95D) The GFP-positive fraction and FIG. 95E) GFP MFI of primary human T-cells 24 hours after incubation with 1, 0.3, and 0.06 pg / mL mRNA encapsulated in targeted LNPs inserted with humanized variants of Nb8 at different densities. Data are mean of values in n = 2 replicates.
[0416] FIG. 96A to FIG. 96Q depicts aCD8 ISVD-targeted LNPs mediate functional CAR T-cell reprogramming. FIG. 96A) CAR library design (left panel) and screening data from Jurkat activation assay (right panel). Data are from technical replicates (n = 2). FIG. 96B) Cytotoxicity assay comparing 22-V4 containing a CD28 co-stimulatory domain to 22-V4 containing a 4-1BB co-stimulatory domain against Nalm6 cells at various effector-to-target cell ratios (E:Ts). FIG. 96C) Number of CD19 and FIG. 96D) CD22 surface receptors per cell in different cancer cell lines, quantified using Quantibrite PE beads. Data are from technical replicates (n = 3). FIG. 96E) The fraction of CD 19 CAR- and FIG. 96F) CD22 CAR-positive primary human T-cells and FIG. 96G) the MFI values of CD 19 CAR- and FIG. 96H) CD22 CAR-expressing primary human T-cells 24 hours after incubation with humanized aCD8 VHH (Nb8-H3) targeted LNPs encapsulating mRNA encoding a CD22 (22-V4 or m971) or a CD19 (FMC63) chimeric antigen receptor (CAR) or a non-CAR payload (LNP control). Data are from biologically independent replicates (n = 3). FIG. 96LFIG. 96N) CAR T-cells were cocultured with cancer cell lines at increasing E:Ts and the level of CAR-mediated cytotoxicity was evaluated 48 hours later. Data are from biologically independent replicates (n = 3). The displayed p-values are from two-tailed paired t-tests comparing 22-V4 to m971. FIG. 960)Levels of IFN-y, FIG. 96P) Granzyme B, and FIG. 96Q) IL- 10 detected in the supernatants 48 hours after LNP treatment and co-culture. Data are from biologically independent replicates (n = 3).
[0417] FIG. 97 A to FIG. 97L depicts transfection specificity and B-cell aplasia in PBMC assay. FIG. 97A) t-distributed stochastic neighbor embedding (t-SNE) analysis was performed on 22-V-treated (left panel) and PBS-treated (right panel) PBMCs and grouped using FlowSOM in OMIQ to visualize various cell subsets. FIG. 97B) Cell subsets were defined based on the expression of CD3, CD4, CD8, CD14, CD20, and CD159a surface markers. Monocytes were defined as CD14+, B-cells were defined as CD20+, CD8 T-cells were defined as CD3+CD4-CD8+, CD4 T-cells were defined as CD3+CD4+CD8-, DP T-cells were defined as CD3+CD4+CD8+, DN T-cells were defined as CD3+CD4-CD8-CD159a-, NK cells were defined as CD3-CD159a+, NKT cells were defined as CD3+CD159a+CD8-, and CD8+ NKT cells were defined as CD3+CD159a+CD8+. Heatmap overlays showing the relative expression of FIG. 97C) CD20, FIG. 97D) CD3, FIG. 97E) CD4, FIG. 97F) CD8a, FIG. 97G) CD 159a, FIG. 97H) CD14, FIG. 971) CAR, FIG. 97J) CD45RA, FIG. 97K) CCR7, FIG. 97L) and CD69. Data shown are from one representative donor (Donor 3).
[0418] FIG. 98A to FIG. 98F depicts cytotoxicity assessment with relevant cell lines. FIG. 98A-FIG. 98F) CAR T-cells were co-cultured with cancer cell lines at increasing E:Ts and the level of CAR-mediated cytotoxicity was evaluated 48 hours later. Data are from technical replicates (n = 3).
[0419] FIG. 99A to FIG. 99E depicts titrating dsRNA to identify immunogenicity threshold. FIG. 99 A) IFN-a2a, FIG. 99B) IFN-y, FIG. 99C) RANTES, FIG. 99D) IL- 10, and FIG. 99E) IL-6 levels were evaluated in the MIMIC® assay in groups treated with CAR-LNPs containing different levels of dsRNA and compared to CAR-LNPs containing RP-HPLC- purified mRNA. Data are from biologically independent replicates (n = 6). The displayed p- values are from one-way ANOVA.
[0420] FIG. 100A to FIG. 100C depicts Flow Cytometry gating strategy. Flow Cytometry gating strategy for FIG. 100 A) ex vivo whole blood assay, FIG. 100B) in vivo CAR reprogramming, and FIG. 100C) myeloid cell subset identification in the liver.
[0421] FIG. 101 A to FIG. 101C: CryoEM structure of hCD8ap-A044300805_v8-Fab38 complex at 3.27A; (FIG. 101A) CryoEM Map; (FIG. 101B) Model surface representation;(FIG. 101C) Local refinement: C50-C104 (C50-C100 according to Kabat numbering) clips together CDR2 and CDR3. Extended CDR3 amino acids 105-120 (100a-101) are flexible.
[0422] FIG. 102A to FIG. 102D: Interface analysis of human CD8aP in complex with ISVD A044300805_v8 (FIG. 102 A). FIG. 102B shows the interface area; FIG. 102C shows the surface charge distribution; and FIG. 102D shows surface hydrophobicity.
[0423] FIG. 103 A to FIG. 103E: Detailed views of interactions between ISVD A044300805_v8 and CD8alpha. (FIG. 103A) List of interacting residues of epitope on CD8alpha located at < 4.0A distance from ISVD A044300805_v8. (FIG. 103B) List of interacting residues of paratope of ISVD A044300805_v8 located at <4.00A distance from the CD8. (FIG. 103C) Key interacting residues at the ISVD A044300805_v8-CD8alpha interface: salt bridges are indicated as red dash lines and hydrogen bonds are indicated as blue dash lines. (FIG. 103D) ISVD A044300805_v8-CD8alpha interface: salt bridge between the CD8alpha and ISVD A044300805_v8 (dotted line). (FIG. 103E) ISVD A044300805_v8-CD8alpha interface: hydrogen bounds between CD8alpha and ISVD A044300805_v8 (dotted lines).
[0424] FIG. 104A: The binding site of ISVD A044300805_v8 interaction to CD8alpha partially overlaps with the interaction site between Class I MHC-|32-microglobulin and CD8alpha. FIG. 104B: Curved architecture formed by the extended CDR3 recapitulates the contour of MHC molecules that naturally engage CD8 on the top, suggesting a maximization of optimal recognition surface by ISVD A044300805_v8.DETAILED DESCRIPTION - LIPID NANOPARTICLES
[0425] The following description sets forth exemplary methods, parameters and the like. It should be recognized, however, that such description is not intended as a limitation on the scope of the present disclosure but is instead provided as a description of exemplary embodiments.I. Definitions
[0426] To facilitate an understanding of the present invention, a number of terms and phrases are defined below.
[0427] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which thisinvention belongs. The abbreviations used herein have their conventional meaning within the chemical and biological arts. The chemical structures and formulae set forth herein should be construed according to the standard rules of chemical valency known in the chemical arts. In addition, when a chemical group is a diradical, for example, it is understood a that the chemical groups can be bonded to their adjacent atoms in the remainder of the structure in one or both orientations, for example, -OC(O)- is interchangeable with -C(O)O- or -OC(S)- is interchangeable with -C(S)O-.
[0428] The terms “a” and “an” as used herein mean “one or more” and include the plural unless the context is inappropriate. In some embodiments, “one or more” is 1 or 2. In some embodiments, “one or more” is 1, 2, or 3. In some embodiments, “one or more” is 1, 2, 3, or 4. In some embodiments, “one or more” is 1, 2, 3, 4, or 5. In some embodiments, “one or more” is 1, 2, 3, 4, 5, or more.
[0429] The term “alkyl” as used herein refers to a saturated straight or branched hydrocarbon, such as a straight or branched group of 1-12, 1-10, or 1-6 carbon atoms, referred to herein as Ci-Cnalkyl, Ci-Cioalkyl, or Ci-Cealkyl, respectively. In some embodiments, alkyl is optionally substituted. Exemplary alkyl groups include, but are not limited to, methyl, ethyl, propyl, isopropyl, 2-methyl-l -propyl, 2-methyl-2-propyl, 2-methyl-l -butyl, 3 -methyl- 1 -butyl, 2-methyl-3 -butyl, 2,2-dimethyl-l -propyl, 2-methyl-l -pentyl, 3 -methyl- 1 -pentyl, 4-m ethyl- 1- pentyl, 2-methyl-2-pentyl, 3-methyl-2-pentyl, 4-methyl-2-pentyl, 2,2-dimethyl-l -butyl, 3,3- dimethyl-1 -butyl, 2-ethyl-l -butyl, butyl, isobutyl, t-butyl, pentyl, isopentyl, neopentyl, hexyl, heptyl, octyl, etc.
[0430] The term “alkylene” refers to a diradical of an alkyl group. In some embodiments, alkylene is optionally substituted. An exemplary alkylene group is -CH2CH2-.
[0431] The term “haloalkyl” refers to an alkyl group that is substituted with at least one halogen. For example, -CH2F, -CHF2, -CF3, -CH2CF3, -CF2CF3, and the like.
[0432] “Alkenyl” refers to an unsaturated branched or straight-chain alkyl group having the indicated number of carbon atoms (e.g., 2 to 8, or 2 to 6 carbon atoms) and at least one carbon-carbon double bond. The group may be in either the cis or trans configuration (Z or E configuration) about the double bond(s). Alkenyl groups include, but are not limited to, ethenyl, propenyl (e.g., prop-l-en-l-yl, prop-l-en-2-yl, prop-2-en-l-yl (allyl), prop-2-en-2-yl), andbutenyl (e.g., but-l-en-l-yl, but-l-en-2-yl, 2-methyl-prop-l-en-l-yl, but-2-en-l-yl, but-2-en- 1-yl, but-2-en-2-yl, buta-l,3-dien-l-yl, buta-l,3-dien-2-yl).
[0433] “Alkynyl” refers to an unsaturated branched or straight-chain alkyl group having the indicated number of carbon atoms (e.g., 2 to 8 or 2 to 6 carbon atoms) and at least one carbon-carbon triple bond. Alkynyl groups include, but are not limited to, ethynyl, propynyl (e.g., prop-l-yn-l-yl, prop-2-yn-l-yl) and butynyl (e.g., but-l-yn-l-yl, but-l-yn-3-yl, but-3- yn-l-yl).
[0434] The term “oxo” is art-recognized and refers to a “=O” substituent. For example, a cyclopentane substituted with an oxo group is cyclopentanone.
[0435] The term “morpholinyl” refers to a substituent having the structure of:, which is optionally substituted.
[0436] The term “piperidinyl” refers to a substituent having a structure of:, which is optionally substituted.
[0437] In general, the term “substituted”, whether preceded by the term “optionally” or not, means that one or more hydrogens of the designated moiety are replaced with a suitable substituent. Unless otherwise indicated, an “optionally substituted” group may have a suitable substituent at each substitutable position of the group, and when more than one position in any given structure may be substituted with more than one substituent selected from a specified group, the substituent may be either the same or different at each position. Combinations of substituents envisioned under this invention are preferably those that result in the formation of stable or chemically feasible compounds. In some embodiments, “optionally substituted” is equivalent to “unsubstituted or substituted.” In some embodiments, “optionally substituted” indicates that the designated atom or group is optionally substituted with one or more substituents independently selected from optional substituents provided herein. In some embodiments, optional substituent may be selected from the group consisting of: Ci-ealkyl, cyano, halogen, -O-Ci-ealkyl, Ci-ehaloalkyl, C3-7cycloalkyl, 3- to 7-membered heterocyclyl, 5- to 6-membered heteroaryl, and phenyl. In some embodiments, optional substituent is alkyl, cyano, halogen, halo, azide, aralkyl, alkenyl, alkynyl, cycloalkyl, hydroxyl, alkoxyl, amino,nitro, sulfhydryl, imino, amido, carboxylic acid, -C(O)alkyl, -CChalkyl, carbonyl, carboxyl, alkylthio, sulfonyl, sulfonamido, sulfonamide, ketone, aldehyde, ester, heterocyclyl, aryl, or heteroaryl. In some embodiments, optional substituent is -ORsl, -NRs2Rs3, -C(O)Rs4, - C(O)ORs5, C(O)NRS6RS7, -OC(O)RS8, -OC(O)ORS9, -OC(O)NRsl0Rn, -NRsl2C(O)Rs13, or - NRS14C(O)ORS15, wherein Rsl, Rs2, Rs3, Rs4, Rs5, Rs6, Rs7, Rs8, Rs9, Rsl°, Rsl 1, Rsl2, Rsl3, Rsl4, and Rsl5are each independently H, Ci-6 alkyl, C3-10 cycloalkyl, Ce-i4 aryl, 5- to 10-membered heteroaryl, or 3- to 10-membered heterocyclyl, each of which is optionally substituted.
[0438] The term “haloalkyl” refers to an alkyl group that is substituted with at least one halogen. For example, -CH2F, -CHF2, -CF3, -CH2CF3, -CF2CF3, and the like.
[0439] The term “cycloalkyl” refers to a monovalent saturated cyclic, bicyclic, bridged cyclic (e.g., adamantyl), or spirocyclic hydrocarbon group of 3-12, 3-10, 3-8, 4-8, or 4-6 carbons, referred to herein, e.g., as “C4-8cycloalkyl,” derived from a cycloalkane. In some embodiments, cycloalkyl is optionally substituted. Exemplary cycloalkyl groups include, but are not limited to, cyclohexanes, cyclopentanes, cyclobutanes and cyclopropanes. Unless specified otherwise, cycloalkyl groups are optionally substituted at one or more ring positions with, for example, alkanoyl, alkoxy, alkyl, haloalkyl, alkenyl, alkynyl, amido, amidino, amino, aryl, arylalkyl, azido, carbamate, carbonate, carboxy, cyano, cycloalkyl, ester, ether, formyl, halogen, haloalkyl, heteroaryl, heterocyclyl, hydroxyl, imino, ketone, nitro, phosphate, phosphonato, phosphinato, sulfate, sulfide, sulfonamido, sulfonyl or thiocarbonyl. In certain embodiments, the cycloalkyl group is not substituted, i.e., it is unsubstituted.
[0440] The terms “heterocyclyl” and “heterocyclic group” are art-recognized and refer to saturated, partially unsaturated, or aromatic 3- to 10-membered ring structures, alternatively 3- to 7-membered rings, whose ring structures include one to four heteroatoms, such as nitrogen, oxygen, and sulfur. In some embodiments, heterocyclyl is optionally substituted. The number of ring atoms in the heterocyclyl group can be specified using Cx-Cxnomenclature where x is an integer specifying the number of ring atoms. For example, a Cs-Cvheterocyclyl group refers to a saturated or partially unsaturated 3- to 7-membered ring structure containing one to four heteroatoms, such as nitrogen, oxygen, and sulfur. The designation “C3-C7” indicates that the heterocyclic ring contains a total of from 3 to 7 ring atoms, inclusive of any heteroatoms that occupy a ring atom position. One example of a Csheterocyclyl is aziridinyl. Heterocycles may be, for example, mono-, bi-, or other multi-cyclic ring systems (e.g., fused, spiro, bridged bicyclic). A heterocycle may be fused to one or more aryl, partially unsaturated, or saturatedrings. Heterocyclyl groups include, for example, biotinyl, chromenyl, dihydrofuryl, dihydroindolyl, dihydropyranyl, dihydrothienyl, dithiazolyl, homopiperidinyl, imidazolidinyl, isoquinolyl, isothiazolidinyl, isooxazolidinyl, morpholinyl, oxolanyl, oxazolidinyl, phenoxanthenyl, piperazinyl, piperidinyl, pyranyl, pyrazolidinyl, pyrazolinyl, pyridyl, pyrimidinyl, pyrrolidinyl, pyrrolidin-2-onyl, pyrrolinyl, tetrahydrofuryl, tetrahydroisoquinolyl, tetrahydropyranyl, tetrahydroquinolyl, thiazolidinyl, thiolanyl, thiomorpholinyl, thiopyranyl, xanthenyl, lactones, lactams such as azetidinones and pyrrolidinones, sultams, sultones, and the like. Unless specified otherwise, the heterocyclic ring is optionally substituted at one or more positions with substituents such as alkanoyl, alkoxy, alkyl, alkenyl, alkynyl, amido, amidino, amino, aryl, arylalkyl, azido, carbamate, carbonate, carboxy, cyano, cycloalkyl, ester, ether, formyl, halogen, haloalkyl, heteroaryl, heterocyclyl, hydroxyl, imino, ketone, nitro, oxo, phosphate, phosphonato, phosphinato, sulfate, sulfide, sulfonamido, sulfonyl and thiocarbonyl. In certain embodiments, the heterocyclyl group is not substituted, i.e., it is unsubstituted.
[0441] The term “aryl” is art-recognized and refers to a carbocyclic aromatic group. In some embodiments, aryl is optionally substituted. Representative aryl groups include phenyl, naphthyl, anthracenyl, and the like. The term “aryl” includes polycyclic ring systems having two or more carbocyclic rings in which two or more carbons are common to two adjoining rings (the rings are “fused rings”) wherein at least one of the rings is aromatic and, e.g., the other ring(s) may be cycloalkyls, cycloalkenyls, cycloalkynyls, and / or aryls. Unless specified otherwise, the aromatic ring may be substituted at one or more ring positions with, for example, halogen, azide, alkyl, aralkyl, alkenyl, alkynyl, cycloalkyl, hydroxyl, alkoxyl, amino, nitro, sulfhydryl, imino, amido, carboxylic acid, -C(O)alkyl, CChalkyl, carbonyl, carboxyl, alkylthio, sulfonyl, sulfonamido, sulfonamide, ketone, aldehyde, ester, heterocyclyl, aryl or heteroaryl moieties, -CF3, -CN, or the like. In certain embodiments, the aromatic ring is substituted at one or more ring positions with halogen, alkyl, hydroxyl, or alkoxyl. In certain other embodiments, the aromatic ring is not substituted, i.e., it is unsubstituted. In certain embodiments, the aryl group is a 6- to 10-membered ring structure. In some embodiments, the aryl group is a Ce-Cu aryl.
[0442] The term “heteroaryl” is art-recognized and refers to aromatic groups that include at least one ring heteroatom. In some embodiments, heteroaryl is optionally substituted. In certain instances, a heteroaryl group contains 1, 2, 3, or 4 ring heteroatoms. Representative examples of heteroaryl groups include pyrrolyl, furanyl, thiophenyl, imidazolyl, oxazolyl,thiazolyl, triazolyl, pyrazolyl, pyridinyl, pyrazinyl, pyridazinyl and pyrimidinyl, and the like. Unless specified otherwise, the heteroaryl ring may be substituted at one or more ring positions with, for example, halogen, azide, alkyl, aralkyl, alkenyl, alkynyl, cycloalkyl, hydroxyl, alkoxyl, amino, nitro, sulfhydryl, imino, amido, carboxylic acid, C(O)alkyl, -CChalkyl, carbonyl, carboxyl, alkylthio, sulfonyl, sulfonamido, sulfonamide, ketone, aldehyde, ester, heterocyclyl, aryl or heteroaryl moieties, -CF3, -CN, or the like. The term “heteroaryl” also includes polycyclic ring systems having two or more rings in which two or more carbons are common to two adjoining rings (the rings are “fused rings”) wherein at least one of the rings is heteroaromatic, e.g., the other cyclic rings may be cycloalkyls, cycloalkenyls, cycloalkynyls, and / or aryls. In certain embodiments, the heteroaryl ring is substituted at one or more ring positions with halogen, alkyl, hydroxyl, or alkoxyl. In certain other embodiments, the heteroaryl ring is not substituted, i.e., it is unsubstituted. In certain embodiments, the heteroaryl group is a 5- to 10-membered ring structure, alternatively a 5- to 6-membered ring structure, whose ring structure includes 1, 2, 3, or 4 heteroatoms, such as nitrogen, oxygen, and sulfur.
[0443] The terms “amine” and “amino” are art-recognized and refer to both unsubstituted and substituted amines, e.g., a moiety represented by the general formula -N(R10)(Rn), wherein R10and R11each independently represent hydrogen, alkyl, cycloalkyl, heterocyclyl, alkenyl, aryl, aralkyl, or (CIUjm-R12; or R10and R11, taken together with the N atom to which they are attached complete a heterocycle having from 4 to 8 atoms in the ring structure; R12represents an aryl, a cycloalkyl, a cycloalkenyl, a heterocycle or a polycycle; and m is zero or an integer in the range of 1 to 8. In certain embodiments, R10and R11each independently represent hydrogen, alkyl, alkenyl, or -(CIUjm-R12.
[0444] The terms “alkoxyl” or “alkoxy” are art-recognized and refer to an alkyl group, as defined above, having an oxygen radical attached thereto. In some embodiments, alkoxyl is optionally substituted. Representative alkoxyl groups include methoxy, ethoxy, propyloxy, tert-butoxy and the like. An “ether” is two hydrocarbons covalently linked by an oxygen. Accordingly, the substituent of an alkyl that renders that alkyl an ether is or resembles an alkoxyl, such as may be represented by one of -O-alkyl, -O-alkenyl, O-alkynyl, -O-(CH2)m- R12, where m and R12are described above. The term “haloalkoxyl” refers to an alkoxyl group that is substituted with at least one halogen. For example, -O-CH2F, -O-CHF2, -O-CF3, and the like. In certain embodiments, the haloalkoxyl is an alkoxyl group that is substituted with atleast one fluoro group. In certain embodiments, the haloalkoxyl is an alkoxyl group that is substituted with from 1-6, 1-5, 1-4, 2-4, or 3 fluoro groups.
[0445] The symbol “ — ” indicates a point of attachment.
[0446] The compounds of the disclosure may contain one or more chiral centers and / or double bonds and, therefore, exist as stereoisomers, such as geometric isomers, enantiomers or diastereomers. The term “stereoisomers” when used herein consist of all geometric isomers, enantiomers or diastereomers. These compounds may be designated by the symbols “R” or “S,” depending on the configuration of substituents around the stereogenic carbon atom. The present invention encompasses various stereoisomers of these compounds and mixtures thereof. Stereoisomers include enantiomers and diastereomers. Mixtures of enantiomers or diastereomers may be designated “(±)” in nomenclature, but the skilled artisan will recognize that a structure may denote a chiral center implicitly. It is understood that graphical depictions of chemical structures, e.g., generic chemical structures, encompass all stereoisomeric forms of the specified compounds, unless indicated otherwise.
[0447] Individual stereoisomers of compounds of the present invention can be prepared synthetically from commercially available starting materials that contain asymmetric or stereogenic centers, or by preparation of racemic mixtures followed by resolution methods well known to those of ordinary skill in the art. These methods of resolution are exemplified by (1) attachment of a mixture of enantiomers to a chiral auxiliary, separation of the resulting mixture of diastereomers by recrystallization or chromatography and liberation of the optically pure product from the auxiliary, (2) salt formation employing an optically active resolving agent, or (3) direct separation of the mixture of optical enantiomers on chiral chromatographic columns. Stereoisomeric mixtures can also be resolved into their component stereoisomers by well- known methods, such as chiral-phase gas chromatography, chiral-phase high performance liquid chromatography, crystallizing the compound as a chiral salt complex, or crystallizing the compound in a chiral solvent. Further, enantiomers can be separated using supercritical fluid chromatographic (SFC) techniques described in the literature. Still further, stereoisomers can be obtained from stereomerically-pure intermediates, reagents, and catalysts by well- known asymmetric synthetic methods.
[0448] Geometric isomers can also exist in the compounds of the present invention. The symbol “ ” denotes a bond that may be a single, double or triple bond as described herein.The present invention encompasses the various geometric isomers and mixtures thereof resulting from the arrangement of substituents around a carbon-carbon double bond or arrangement of substituents around a carbocyclic ring. Substituents around a carbon-carbon double bond are designated as being in the “Z” or “E” configuration wherein the terms “Z” and “E’ are used in accordance with IUPAC standards. Unless otherwise specified, structures depicting double bonds encompass both the “E” and “Z” isomers.
[0449] Substituents around a carbon-carbon double bond alternatively can be referred to as “cis” or “trans,” where “cis” represents substituents on the same side of the double bond and “trans” represents substituents on opposite sides of the double bond. The arrangement of substituents around a carbocyclic ring are designated as “cis” or “trans.” The term “cis” represents substituents on the same side of the plane of the ring and the term “trans” represents substituents on opposite sides of the plane of the ring. Mixtures of compounds wherein the substituents are disposed on both the same and opposite sides of plane of the ring are designated “cis / trans.”
[0450] The present disclosure also embraces isotopically labeled compounds of the present disclosure which are identical to those recited herein, except that one or more atoms are replaced by an atom having an atomic mass or mass number different from the atomic mass or mass number usually found in nature. Examples of isotopes that can be incorporated into compounds of the present disclosure include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorus, fluorine and chlorine, such as2H,3H,13C,14C,15N,18O,170,31P,32P,35S,18F, and36C1, respectively.
[0451] Certain isotopically-labeled disclosed compounds (e.g., those labeled with3H and14C) are useful in compound and / or substrate tissue distribution assays. Tritiated (i.e.,3H) and carbon-14 (i.e.,14C) isotopes are particularly preferred for their ease of preparation and detectability. Further, substitution with heavier isotopes such as deuterium (i.e.,2H) may afford certain therapeutic advantages resulting from greater metabolic stability (e.g., increased in vivo half-life or reduced dosage requirements) and hence may be preferred in some circumstances. Isotopically labeled compounds of the present disclosure can generally be prepared by following procedures analogous to those disclosed in, e.g., the Examples herein by substituting an isotopically labeled reagent for a non-isotopically labeled reagent.
[0452] As used herein, the terms “peptide,” “polypeptide,” and “protein” are used interchangeably, and refer to a compound comprised of amino acid residues covalently linked by peptide bonds. A protein or peptide must contain at least two amino acids, and no limitation is placed on the maximum number of amino acids that can comprise a protein’s or peptide’s sequence. Polypeptides include any peptide or protein comprising two or more amino acids joined to each other by peptide bonds. As used herein, the term refers to both short chains, which also commonly are referred to in the art as peptides, oligopeptides and oligomers, for example, and to longer chains, which generally are referred to in the art as proteins, of which there are many types. “Polypeptides” include, for example, biologically active fragments, substantially homologous polypeptides, oligopeptides, homodimers, heterodimers, variants of polypeptides, modified polypeptides, derivatives, analogs, fusion proteins, among others. The polypeptides include natural peptides, recombinant peptides, synthetic peptides, or a combination thereof.
[0453] By the term “specifically binds,” as used herein with respect to an affinity ligand, in particular, an antibody, is meant an antibody which recognizes a specific antigen, but does not substantially recognize or bind other molecules in a sample. For example, an antibody that specifically binds to an antigen from one species may also bind to that antigen from one or more other species. But, such cross-species reactivity does not itself alter the classification of an antibody as specific. In another example, an antibody that specifically binds to an antigen may also bind to different allelic forms of the antigen. However, such cross reactivity does not itself alter the classification of an antibody as specific. In some instances, the terms “specific binding” or “specifically binding,” can be used in reference to the interaction of an antibody, a protein, or a peptide with a second chemical species, to mean that the interaction is dependent upon the presence of a particular structure (e.g., an antigenic determinant or epitope) on the chemical species; for example, an antibody recognizes and binds to a specific protein structure rather than to proteins generally. If an antibody is specific for epitope “A”, the presence of a molecule containing epitope A (or free, unlabeled A), in a reaction containing labeled “A” and the antibody, will reduce the amount of labeled A bound to the antibody.
[0454] As used herein, the terms “subject” and “patient” refer to organisms to be treated by the methods of the present invention. Such organisms are preferably mammals e.g., murines, simians, equines, bovines, porcines, canines, felines, and the like), and more preferably humans.
[0455] As used herein, the term “pharmaceutical composition” refers to the combination of an active agent with a carrier, inert or active, making the composition especially suitable for diagnostic or therapeutic use in vivo or ex vivo.
[0456] As used herein, the term “pharmaceutically acceptable excipient” refers to any of the standard pharmaceutical carriers, such as a phosphate buffered saline solution, water, emulsions (e.g., such as an oil / water or water / oil emulsions), and various types of wetting agents. The compositions also can include stabilizers and preservatives. For examples of carriers, stabilizers and adjuvants, see Remington's The Science and Practice of Pharmacy, 21st Edition, A. R. Gennaro; Lippincott, Williams & Wilkins, Baltimore, MD, 2006.
[0457] As is known to those of skill in the art, “salts” of the compounds of the present invention may be derived from inorganic or organic acids and bases. Examples of acids include, but are not limited to, hydrochloric, hydrobromic, sulfuric, nitric, perchloric, fumaric, maleic, phosphoric, glycolic, lactic, salicylic, succinic, toluene-p-sulfonic, tartaric, acetic, citric, methanesulfonic, ethanesulfonic, formic, benzoic, malonic, naphthalene-2-sulfonic, benzenesulfonic acid, and the like. Other acids, such as oxalic, while not in themselves pharmaceutically acceptable, may be employed in the preparation of salts useful as intermediates in obtaining the compounds of the present disclosure and their pharmaceutically acceptable acid addition salts.
[0458] Examples of bases include, but are not limited to, alkali metal (e.g., sodium) hydroxides, alkaline earth metal (e.g., magnesium) hydroxides, ammonia, and compounds of formula NW , wherein W is Ci-4 alkyl, and the like.
[0459] Examples of salts include, but are not limited to: acetate, adipate, alginate, aspartate, benzoate, benzenesulfonate, bisulfate, butyrate, citrate, camphorate, camphorsulfonate, cyclopentanepropionate, digluconate, dodecyl sulfate, ethanesulfonate, fumarate, flucoheptanoate, glycerophosphate, hemisulfate, heptanoate, hexanoate, hydrochloride, hydrobromide, hydroiodide, 2-hydroxyethanesulfonate, lactate, maleate, methanesulfonate, 2- naphthalenesulfonate, nicotinate, oxalate, palmoate, pectinate, persulfate, phenylpropionate, picrate, pivalate, propionate, succinate, tartrate, thiocyanate, tosylate, undecanoate, and the like. Other examples of salts include anions of the compounds of the present invention compounded with a suitable cation such as Na+, NH , and NW (wherein W is a Ci-4 alkyl group), and the like.
[0460] Abbreviations as used herein include diisopropylethylamine (DIPEA); 4- dimethylaminopyridine (DMAP); tetrabutylammonium iodide (TBAI); 1 -ethyl -3-(3- dimethylaminopropyl)carbodiimide (EDC); benzotriazol- 1 -yl-oxytripyrrolidinophosphonium hexafluorophosphate (PyBOP), 9-Fluorenylmethoxycarbonyl (Fmoc), tetrabutyldimethylsilyl chloride (TBDMSC1), hydrogen fluoride (HF), phenyl (Ph), bis(trimethylsilyl)amine (HMDS), dimethylformamide (DMF); methylene chloride (DCM); tetrahydrofuran (THF); high- performance liquid chromatography (HPLC); mass spectrometry (MS), evaporative light scattering detector (ELSD), electrospray (ES)); nuclear magnetic resonance spectroscopy (NMR).
[0461] As used herein, the term “effective amount” refers to the amount of a compound e.g., a nucleic acid, e.g., an mRNA) sufficient to effect beneficial or desired results. An effective amount can be administered in one or more administrations, applications or dosages and is not intended to be limited to a particular formulation or administration route. The term effective amount can be considered to include therapeutically and / or prophylactically effective amounts of a compound.
[0462] The phrase “therapeutically effective amount” as used herein means that amount of a compound (e.g., a nucleic acid, e.g., an mRNA), material, or composition comprising a compound (e.g., a nucleic acid, e.g., an mRNA) which is effective for producing some desired therapeutic effect in at least a sub-population of cells in a mammal, for example, a human, or a subject e.g., a human subject) at a reasonable benefit / risk ratio applicable to any medical treatment.
[0463] The phrase “prophylactically effective amount” as used herein means that amount of a compound (e.g., a nucleic acid, e.g., an mRNA), material, or composition comprising a compound (e.g., a nucleic acid, e.g., an mRNA) which is effective for producing some desired prophylactic effect in at least a sub-population of cells in a mammal, for example, a human, or a subject (e.g., a human subject) by reducing, minimizing or eliminating the risk of developing a condition or the reducing or minimizing severity of a condition at a reasonable benefit / risk ratio applicable to any medical treatment.
[0464] As used herein, the terms “treat,” “treating,” and “treatment” include any effect, e.g., lessening, reducing, modulating, ameliorating or eliminating, that results in theimprovement of the condition, disease, disorder, and the like, or ameliorating a symptom thereof.
[0465] The phrase “pharmaceutically acceptable” is employed herein to refer to those compounds, materials, compositions, and / or dosage forms which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of human beings and animals without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit / risk ratio.
[0466] In the application, where an element or component is said to be included in and / or selected from a list of recited elements or components, it should be understood that the element or component can be any one of the recited elements or components, or the element or component can be selected from a group consisting of two or more of the recited elements or components.
[0467] Further, it should be understood that elements and / or features of a composition or a method described herein can be combined in a variety of ways without departing from the spirit and scope of the present invention, whether explicit or implicit herein. For example, where reference is made to a particular compound, that compound can be used in various embodiments of compositions of the present invention and / or in methods of the present invention, unless otherwise understood from the context. In other words, within this application, embodiments have been described and depicted in a way that enables a clear and concise application to be written and drawn, but it is intended and will be appreciated that embodiments may be variously combined or separated without parting from the present teachings and invention(s). For example, it will be appreciated that all features described and depicted herein can be applicable to all aspects of the invention(s) described and depicted herein.
[0468] It should be understood that the expression “at least one of’ includes individually each of the recited objects after the expression and the various combinations of two or more of the recited objects unless otherwise understood from the context and use. The expression “and / or” in connection with three or more recited objects should be understood to have the same meaning unless otherwise understood from the context.
[0469] The use of the term “include,” “includes,” “including,” “have,” “has,” “having,” “contain,” “contains,” or “containing,” including grammatical equivalents thereof, should beunderstood generally as open-ended and non-limiting, for example, not excluding additional unrecited elements or steps, unless otherwise specifically stated or understood from the context.
[0470] Where the use of the term “about” is before a quantitative value, the present invention also includes the specific quantitative value itself, unless specifically stated otherwise. As used herein, the term “about” refers to a ±10% variation from the nominal value unless otherwise indicated or inferred.
[0471] As used herein, unless otherwise indicated, the term “antibody” means any antigenbinding molecule or molecular complex comprising at least one complementarity determining region (CDR) that specifically binds to or interacts with a particular antigen. It is understood the term encompasses an intact antibody (e.g., an intact monoclonal antibody), or a fragment thereof, such as an Fc fragment of an antibody (e.g., an Fc fragment of a monoclonal antibody), or an antigen-binding fragment of an antibody (e.g., an antigen-binding fragment of a monoclonal antibody), including an intact antibody, antigen-binding fragment, or Fc fragment that has been modified or engineered. Examples of antigen-binding fragments include Fab, Fab’, (Fab’)2, Fv, single chain antibodies (e.g., scFv), minibodies, and diabodies. Examples of antibodies that have been modified or engineered include chimeric antibodies, humanized antibodies, and multispecific antibodies (e.g., bispecific antibodies). The term also encompasses an immunoglobulin single variable domain, such as a VHH (including a humanized VHH), a VH (including a camelized VH, a human VH, a camelized human VH, and a dAb) or a VL.
[0472] As used here, an “antibody that binds to X” (i.e., X being a particular antigen), or “an anti-X antibody”, is an antibody that specifically recognizes the antigen X.
[0473] As used herein, a “buried interchain disulfide bond” or an “interchain buried disulfide bond” refers to a disulfide bond on a polypeptide which is not readily accessible to water soluble reducing agents, or is effectively “buried” in the hydrophobic regions of the polypeptide, such that it is unavailable to both reducing agents and for conjugation to other hydrophilic PEGs. Buried interchain disulfide bonds are further described in WO2017096361A1, which is incorporated by reference in its entirety.
[0474] As used herein, specificity of the targeted delivery by an LNP is defined by the ratio between % of a desired immune cell type that receives the delivered nucleic acid (e.g., on- target delivery), and % of an undesired immune cell type that is not meant to be the destinationof the delivery, but receives the delivered nucleic acid (e.g., off-target delivery). For example, the specificity is higher when more desired immune cells receive the delivered nucleic acid, while less undesired immune cells receive the delivered nucleic acid. Specificity of the targeted delivery by an LNP can also be defined by the ratio of amount of nucleic acid being delivered to the desired immune cells (e.g., on-target delivery) and amount of nucleic acid being delivered to the undesired immune cells (e.g., off-target delivery). Specificity of the delivery can be determined using any suitable method. As a non-limiting example, expression level of the nucleic acid in the desired immune cell type can be measured and compared to that of a different immune cell type that is not meant to be the destination of the delivery.
[0475] As used herein, in some embodiments, a reference LNP is an LNP that does not have the immune cell targeting group but is otherwise the same as the tested LNP. In some other embodiments, a reference LNP is an LNP that has a different ionizable cationic lipid but is otherwise the same as the tested LNP. In some embodiments, a reference LNP comprises D- Lin-MC3-DMA as the ionizable cationic lipid which is different from the ionizable cationic lipid in a tested LNP, but is otherwise the same as the tested LNP.
[0476] As used herein, a humanized antibody is an antibody which is wholly or partially of non-human origin and whose protein sequence has been modified to replace certain amino acids, for instance that occur at the corresponding position(s) in the framework regions of the VH and VL domains in a sequence of antibody from a human being, to increase its similarity to antibodies produced naturally in humans, in order to avoid or minimize an immune response in humans. For example, using techniques of genetic engineering, the variable domains of a non-human antibodies of interest may be combined with the constant domains of human antibodies. The constant domains of a humanized antibody are most of the time human CH and CL domains.
[0477] As used herein, the term “structural lipid” refers to sterols and also to lipids containing sterol moieties.
[0478] It should be understood that the order of steps or order for performing certain actions is immaterial so long as the present invention remain operable. Moreover, two or more steps or actions may be conducted simultaneously.
[0479] At various places in the present specification, substituents are disclosed in groups or in ranges. It is specifically intended that the description include each and every individualsubcombination of the members of such groups and ranges. For example, the term “Ci-6 alkyl” is specifically intended to individually disclose Ci, C2, C3, C4, C5, Ce, Ci-Ce, C1-C5, C1-C4, Ci- C3, C1-C2, C2-C6, C2-C5, C2-C4, C2-C3, C3-C6, C3-C5, C3-C4, C4-C6, C4-C5, and C5-C6alkyl. By way of other examples, an integer in the range of 0 to 40 is specifically intended to individually disclose 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, and 40, and an integer in the range of 1 to 20 is specifically intended to individually disclose 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, and 20.
[0480] The use of any and all examples, or exemplary language herein, for example, “such as” or “including,” is intended merely to illustrate better the present invention and does not pose a limitation on the scope of the present disclosure unless claimed. No language in the specification should be construed as indicating any non-claimed element as essential to the practice of the present invention.
[0481] As used herein, the term “pseudouridine” refers to the natural product which is a C- glycosyl pyrimidine that consists of uracil having a beta-D-ribofuranosyl residue attached at position 5 (i.e., 5-(beta-D-Ribofuranosyl)uracil). In some embodiments, the term refers to m'acphi / (1- methyl-3 -(3 -amino-3 -carboxypropyl) pseudouridine. In another embodiment, the term refers to mlvP (1-methylpseudouridine). In another embodiment, the term refers to *| / m (2'-O- methylpseudouridine. In another embodiment, the term refers to m5D (5- methyldihydrouridine). In another embodiment, the term refers to m3\| / (3- methylpseudouridine). In another embodiment, the term refers to a pseudouridine moiety that is not further modified. In another embodiment, the term refers to a monophosphate, diphosphate, or triphosphate of any of the above pseudouridines. In another embodiment, the term refers to any other pseudouridine known in the art. Each possibility represents a separate embodiment of the present invention.
[0482] As used herein, the terms “lipid-PEG” and “PEG-lipid” are interchangeable, referring to PEG derivatives in which PEG is attached with a lipid moiety. PEG-lipid can be used to improve circulation times for liposome encapsulated (LNP) drugs and reduce nonspecific uptakes. If the lipid is a phospholipid, the molecule can be referred as “phospholipid- PEG” or “PEG-phospholipid”. Any suitable chemistry may be used to conjugate a polypeptide to the PEG of the PEG-lipid, see Parhiz et al., Journal of Controlled Release 291 : 106-115, 2018; Kolb et al., Angewandte Chemie International Edition 40(11):2004-2021, 2001; andEvans, Australian Journal of Chemistry 60(6):384-395, 2007. For example, lipid-PEG- maleimide, lipid-PEG-cysteine, lipid-PEG-alkyne, PEG-dibenzocyclooctyne (DBCO), lipid- PEG-bromo maleimide, lipid-PEG-alkylnoic amide, PEG-alkynoic imide, and lipid-PEG-azide can be used to produce a Lipd-PEG-polypeptide conjugate.
[0483] Throughout the description, where compositions and kits are described as having, including, or comprising specific components, or where processes and methods are described as having, including, or comprising specific steps, it is contemplated that, additionally, there are compositions and kits of the present invention that consist essentially of, or consist of, the recited components, and that there are processes and methods according to the present invention that consist essentially of, or consist of, the recited processing steps.
[0484] In some embodiments, when a domain, antibody, or sequence is derived from another domain, antibody, or sequence, then the domain, antibody, or sequence is the same as the other domain, antibody, or sequence. In some embodiments, when a domain, antibody, or sequence is derived from another domain, antibody, or sequence, the domain, antibody, or sequence has at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% identity with the other domain, antibody, or sequence. In some embodiments, when a domain, antibody, or sequence is derived from another domain, antibody, or sequence, the domain, antibody, or sequence has 3, 2, or 1 amino acid difference.
[0485] The terms “epitope” and “antigenic determinant”, which can be used interchangeably, refer to the part of a macromolecule, such as a polypeptide or protein that is recognized by antigen-binding molecules, such as immunoglobulins, conventional antibodies, or immunoglobulin single variable domains, and more particularly by the antigen-binding site of said molecules. Epitopes define the minimum binding site for an immunoglobulin, and thus represent the target of specificity of an immunoglobulin. The part of an antigen-binding molecule (such as an immunoglobulin, a conventional antibody, an immunoglobulin single variable domain) that recognizes the epitope is called a “paratope”.
[0486] Protein-protein interactions (PPIs) are highly specific physical contacts, stable or transient in time, between two or more proteins. PPIs between polypeptides can be determined experimentally i.e., affinity chromatography, tandem affinity purification (TAP), coimmunoprecipitation, Yeast two-hybrid screening X-ray crystallography, Cryogenic electronmicroscopy (cryo-EM), nuclear magnetic resonance, spectroscopy, Hydrogen / Deuterium exchange Mass Spectrometry (HDX-MS), and protein arrays etc. or via in silico technique.
[0487] The term “interact with” as used herein in the context of at least two polypeptides forming a complex (e.g. anti-CD8 ISVD and CD8) means that at least one (amino acid) residue of one polypeptide is in close proximity to at least one (amino acid) residue of the other polypeptide. The distance between two (amino acid) residues which are located within distinct polypeptides may be determined using methods known is the art. For example, the skilled person knows that structural information allowing to determine the distance between two (amino acids) residues may be obtained using standard methods such as X-ray crystallography, Cryogenic electron microscopy (cryo-EM), nuclear magnetic resonance, and subsequent molecular modelling. The skilled person is also aware that two (amino acid) residues are in close proximity and therefore interact with each other if the (shortest) distance between the two (amino acid) residues is less than 10 A, less than 8 A, less than 6 A, less than 5 A, less than 4 A, less than 3 A, less than 2 A, preferably less than 4 A, more preferably less than 4 A and more than 2 A.
[0488] The term “interaction site” as used herein refers to the area within a complex comprising at least two polypeptides which is formed by the (amino acid) residue(s) within each of the respective polypeptides that interact with each other as defined herein. For example, an ISVD specifically binding to CD8alpha comprises at least one amino acid residue that interacts with at least one (amino acid) residue on CD8alpha. In this respect, the at least one amino acid residue of the anti-CD8 ISVD and the at least one (amino acid) residue on CD8alpha interacting with each other also form an interaction site. The skilled person is aware that interaction sites may for example be defined by reference to a specific amino acid residue of the polypeptide (e.g. N76 of CD8alpha).
[0489] Molecular interactions can have a different strength, bond length (A), interaction area (A2), depending on the type of amino acid residues that make up the interaction. Strong molecular interactions include hydrogen bonds (or H-bonds), that are electrostatic forces of attraction between a hydrogen (H) atom which is covalently bonded to a more electronegative donor atom or group, and another electronegative atom bearing a lone pair of electrons, the hydrogen bond acceptor. Such an interacting system is generally denoted “donor-H - acceptor”, where the solid line denotes a polar covalent bond, and the dotted or dashed line indicates the hydrogen bond. The most frequent donor and acceptor atoms are theperiod 2 elements: nitrogen (N), oxygen (O), and fluorine (F). The hydrogen bonds have a length around 1.5-2.5 A and an interaction area around 10-50 A2. Typical amino acid residues that form a H-bond are Lys, Arg, Asn, Gin, Ser and Thr (donors), and Asp, Glu, Asn, Gin, Ser and Thr (acceptors).
[0490] Other strong molecular interactions include salt bridges, that are defined as electrostatic interactions between two oppositely charged groups: the anionic carboxylate of either glutamate (E) or aspartate (D), and, the cationic ammonium from either arginine (R) or lysine (K). The salt bridges have a length around 2.8-4.0 A and an interaction area around 10- 100 A2. Typical amino acid residues that form a salt bridge are Lys, Arg and His (positive), and Asp and Glu (negative).
[0491] Weaker interactions include hydrophobic interactions, that are the non-covalent force where nonpolar species tend to cluster in water in order to decrease the overall interfacial area between the hydrophobic species and water. Hydrophobic interactions have a length around 3.5-4.5 A and an interaction area around 100-300 A2. Typical amino acid residues that form hydrophobic interactions are Ala, Vai, Leu, He, Met, Phe, Trp.
[0492] Hydrogen bonds and salt bridges indicate specificity and stability, while hydrophobic contacts support affinity.
[0493] Van der Waals forces include attraction and repulsions between atoms, molecules, as well as other (weaker) intermolecular forces. They differ from covalent and ionic bonding in that they are caused by correlations in the fluctuating polarizations of nearby particles. The force results from a transient shift in electron density. Specifically, the electron density may temporarily shift to be greater on one side of the nucleus. This shift generates a transient charge which a nearby atom can be attracted to or repelled by. Van der Waals forces have a length around 3.5-4.5 A and an interaction area around 50-200 A2.
[0494] Molecular modelling of the interaction site can be performed by tools known in the art, such as e.g., PDBe-PISA. PDBe-PISA is an interactive tool for the exploration of macromolecular interfaces based on cryo-EM or Xray structures (https: / / www.ebi.ac.uk / pdbe / pisa / ). PDBe-PISA represents a systematic approach to automatic identification of probable quaternary structures, based on physical-chemical models of macromolecular interactions and chemical thermodynamics. Amongst others, PDBe-PISA calculates buried surface area (BSA) according to cryoEM / Xray structures, which is the portionof molecular surfaces no longer exposed to solvent upon complex formation. Core interacting residues are deeply buried, have a high buried surface area (BSA) and low solvent exposure (ASA, Accessible Surface Area). Interface stability can be assessed using solvation free energy gain upon binding (AiG), as calculated by PISA. Negative AiG values are indicative of hydrophobic interfaces and favorable complex formation. (E. Krissinel and K. Henrick (2005). Detection of Protein Assemblies in Crystals. In: M.R. Berthold et.al. (Eds.): CompLife 2005, LNBI 3695, pp. 163 — 174. Springer-Verlag Berlin Heidelberg).
[0495] The affinity is a measure for the binding strength between a moiety and a binding site on the target molecule: the lower the value of the KD, the stronger the binding strength between a target molecule and a targeting moiety. Typically, binding units used in the present technology, such as ISVDs, will bind to their targets with a dissociation constant (KD) of 10'5to 1 O'12moles / liter or less, 10'7to 10'12moles / liter or less, or 10'8to 10'12moles / liter (i.e. with an association constant (KA) of 105to 1012liter / moles or more, 107to 1012liter / moles or more, or 108to 1012liter / moles). Any KD value greater than 10'4mol / liter (or any KA value lower than 104liters / mol) is generally considered to indicate non-specific binding. The KD for biological interactions, such as the binding of immunoglobulin sequences to an antigen, which are considered specific are typically in the range of 10'5moles / liter (10000 nM or lOpM) to 10'12moles / liter (0.001 nM or 1 pM) or less.
[0496] Specific binding of a binding unit to its designated target can be determined in any suitable manner known per se, including, for example, Scatchard analysis and / or competitive binding assays, such as radioimmunoassays (RIA), enzyme immunoassays (EIA) and sandwich competition assays, and the different variants thereof known per se in the art; as well as the other techniques mentioned further herein.
[0497] The affinity of a molecular interaction between two molecules can be measured via different techniques known per se, such as the well-known surface plasmon resonance (SPR) biosensor technique (see for example Ober et al. 2001, Intern. Immunology 13: 1551-1559). The term "surface plasmon resonance", as used herein, refers to an optical phenomenon that allows for the analysis of real-time biospecific interactions by detection of alterations in protein concentrations within a biosensor matrix, where one molecule is immobilized on the biosensor chip and the other molecule is passed over the immobilized molecule under flow conditions yielding kon, koff measurements and hence KD (or KA) values. This can for example be performed using the well-known BIAcore® system (BIAcore International AB, a GEHealthcare company, Uppsala, Sweden and Piscataway, NJ) or the ProteOn™ XPR36 Protein Interaction Array System (Bio-rad Laboratories, Inc). For further descriptions, see Jonsson et al. 1993 (Ann. Biol. Clin. 51 : 19-26), Jonsson et al. 1991 (Biotechniques 11 : 620-627), Johnsson et al. 1995 (J. Mol. Recognit. 8: 125-131), and Johnnson et al. 1991 (Anal. Biochem. 198: 268-277).
[0498] Another well-known biosensor technique to determine affinities of biomolecular interactions is bio-layer interferometry (BLI) (see for example Abdiche et al. 2008, Anal. Biochem. 377: 209-217). The term “bio-layer Interferometry” or “BLI”, as used herein, refers to a label-free optical technique that analyzes the interference pattern of light reflected from two surfaces: an internal reference layer (reference beam) and a layer of immobilized protein on the biosensor tip (signal beam). A change in the number of molecules bound to the tip of the biosensor causes a shift in the interference pattern, reported as a wavelength shift (nm), the magnitude of which is a direct measure of the number of molecules bound to the biosensor tip surface. Since the interactions can be measured in real-time, association and dissociation rates and affinities can be determined. BLI can for example be performed using the well-known Octet® Systems (ForteBio, a division of Pall Life Sciences, Menlo Park, USA).
[0499] Alternatively, affinities can be measured in Kinetic Exclusion Assay (KinExA) (see for example Drake et al. 2004, Anal. Biochem., 328: 35-43), using the KinExA® platform (Sapidyne Instruments Inc, Boise, USA). The term "KinExA", as used herein, refers to a solution-based method to measure true equilibrium binding affinity and kinetics of unmodified molecules. Equilibrated solutions of an antibody / antigen complex are passed over a column with beads precoated with antigen (or antibody), allowing the free antibody (or antigen) to bind to the coated molecule. Detection of the antibody (or antigen) thus captured is accomplished with a fluorescently labeled protein binding the antibody (or antigen).
[0500] The GYROLAB® immunoassay system provides a platform for automated bioanalysis and rapid sample turnaround (Fraley et al. 2013, Bioanalysis 5: 1765-74).
[0501] The dissociation constant may be the actual or apparent dissociation constant, as will be clear to the skilled person. Methods for determining the dissociation constant will be clear to the skilled person, and for example include the techniques mentioned herein. In this respect, it will also be clear that it may not be possible to measure dissociation constants of more than 10'4moles / liter or 10'3moles / liter (e.g. of 10'2moles / liter). Optionally, as will alsobe clear to the skilled person, the (actual or apparent) dissociation constant may be calculated on the basis of the (actual or apparent) association constant (KA), by means of the relationship [KD= 1 / KA].
[0502] The terms “block”, “antagonize”, “compete”, “competing” and “-competition” are used interchangeably herein to mean the ability of an immunoglobulin, antibody, immunoglobulin single variable domain, polypeptide or other binding agent to interfere with the binding of another protein, polypeptides, ligand or binding agent to a given target. The extent to which an immunoglobulin, antibody, immunoglobulin single variable domain, polypeptide or other binding agent is able to interfere with the binding of another ligand to the target, and therefore whether it can be said to “block”, can be determined using competition binding assays. Particularly suitable quantitative competitive blocking assays are described in the Examples and include e.g. a fluorescence-activated cell sorting (FACS) binding assay with CD8 expressed on cells. The extent of blocking can be measured by the (reduced) channel fluorescence.
[0503] Other methods for determining whether an immunoglobulin, antibody, immunoglobulin single variable domain, polypeptide or other binding agent directed against a target blocks, is capable of blocking, competitively binds or is competitive as defined herein are described e.g. in Xiao-Chi Jia et al. (Journal of Immunological Methods 288: 91-98, 2004), Miller et al. (Journal of Immunological Methods 365: 118-125, 2011).
[0504] As used herein, the term "potency" is a measure of the biological activity of an agent, such as an ISVD or polypeptide. Potency of an agent can be determined by any suitable method known in the art, such as for instance as described in the experimental section. Cell culture-based potency assays are often the preferred format for determining biological activity since they measure the physiological response elicited by the agent and can generate results within a relatively short period of time. Various types of cell-based assays, can be used to determine potency, such as e.g. binding of the ISVD to CD8+T cells (as further described in the Example section).II. Immunoglobulin single variable domain
[0505] The present disclosure provides immune cell targeting LNPs comprising an immune cell targeting group. In some embodiments, the immune cell targeting group of the LNPs as described herein comprise an immunoglobulin single variable domain, such as a VHH(including a humanized VHH), a VH (including a camelized VH, a human VH, a camelized human VH, and a dAb) or a VL.
[0506] The term “immunoglobulin single variable domain” (ISVD), interchangeably used with “single variable domain,” defines immunoglobulin molecules wherein the antigen binding site is present on, and formed by, a single immunoglobulin domain. This sets immunoglobulin single variable domains apart from “conventional” immunoglobulins (e.g., monoclonal antibodies) or their fragments (such as Fab, Fab’, F(ab’)2, scFv, di-scFv), wherein two immunoglobulin domains, in particular two variable domains, interact to form an antigen binding site. Typically, in conventional immunoglobulins, a heavy chain variable domain (VH) and a light chain variable domain (VL) interact to form an antigen binding site. In this case, the complementarity determining regions (CDRs) of both VH and VL will contribute to the antigen binding site, i.e., a total of 6 CDRs will be involved in antigen binding site formation. In view of the above definition, the antigen-binding domain of a conventional 4-chain antibody (such as an IgG, IgM, IgA, IgD or IgE molecule; known in the art) or of a Fab, a F(ab')2 fragment, an Fv fragment such as a disulfide linked Fv or a scFv fragment, or a diabody (all known in the art) derived from such conventional 4-chain antibody, would normally not be regarded as an immunoglobulin single variable domain, as, in these cases, binding to the respective epitope of an antigen would normally not occur by one (single) immunoglobulin domain but by a pair of (associating) immunoglobulin domains such as light and heavy chain variable domains, i.e., by a VH-VL pair of immunoglobulin domains, which jointly bind to an epitope of the respective antigen.
[0507] In contrast, immunoglobulin single variable domains are capable of specifically binding to an epitope of the antigen without pairing with an additional immunoglobulin variable domain. The binding site of an immunoglobulin single variable domain is formed by a single VH, a single VHH or single VL domain. Hence, the antigen binding site of an immunoglobulin single variable domain is formed by no more than three CDRs.
[0508] As such, the single variable domain may be a light chain variable domain sequence (e.g., a VL-sequence) or a suitable fragment thereof; or a heavy chain variable domain sequence (e.g., a Vu-sequence or VHH sequence) or a suitable fragment thereof; as long as it is capable of forming a single antigen binding unit (i.e., a functional antigen binding unit that essentially consists of the single variable domain, such that the single antigen binding domain does not need to interact with another variable domain to form a functional antigen binding unit).
[0509] An immunoglobulin single variable domain (ISVD) can for example be a heavy chain ISVD, such as a VH, VHH, including a camelized VH or humanized VHH. In one embodiment, it is a VHH, including a camelized VH or humanized VHH. Heavy chain ISVDs can be derived from a conventional four-chain antibody or from a heavy chain antibody.
[0510] For example, the immunoglobulin single variable domain may be a (single) domain antibody (or an amino acid sequence that is suitable for use as a single domain antibody), a “dAb” or dAb (or an amino acid sequence that is suitable for use as a dAb) or a Nanobody® ISVD (as defined herein and including but not limited to a VHH); other single variable domains, or any suitable fragment of any one thereof.
[0511] In particular, the immunoglobulin single variable domain may be a Nanobody® ISVD (such as a VHH, including a humanized VHH or camelized VH) or a suitable fragment thereof. [Note: Nanobody® and Nanobodies® is a registered trademark of Ablynx N.V.].
[0512] “VHH domains”, also known as VHHS, VHH antibody fragments, and VHH antibodies, have originally been described as the antigen binding immunoglobulin variable domain of “heavy chain antibodies” (i.e., of “antibodies devoid of light chains”; Hamers-Casterman et al. 1993 (Nature 363: 446-448). The term “VHH domain” has been chosen in order to distinguish these variable domains from the heavy chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VH domains”) and from the light chain variable domains that are present in conventional 4-chain antibodies (which are referred to herein as “VL domains”). For a further description of VHH’ S, reference is made to the review article by Muyldermans 2001 (Reviews in Molecular Biotechnology 74: 277-302).
[0513] For the term “dAb’s” and “domain antibody”, reference is for example made to Ward et al. 1989 (Nature 341 : 544), to Holt et al. 2003 (Trends Biotechnol. 21 : 484); as well as to for example WO 2004 / 068820, WO 2006 / 030220, WO 2006 / 003388 and other published patent applications of Domantis Ltd. It should also be noted that, although less preferred in the context of the present invention because they are not of mammalian origin, single variable domains can be derived from certain species of shark (for example, the so-called “IgNAR domains”, see for example WO 2005 / 18629).
[0514] Typically, the generation of immunoglobulins involves the immunization of experimental animals, fusion of immunoglobulin producing cells to create hybridomas andscreening for the desired specificities. Alternatively, immunoglobulins can be generated by screening of naive, immune or synthetic libraries, e.g., by phage display.
[0515] The generation of immunoglobulin sequences, such as VHHs, has been described extensively in various publications, among which WO 1994 / 04678, Hamers-Casterman et al. 1993 (Nature 363: 446-448) and Muyldermans et al. 2001 (Reviews in Molecular Biotechnology 74: 277-302, 2001). In these methods, camelids are immunized with the target antigen in order to induce an immune response against said target antigen. The repertoire of VHHs obtained from said immunization is further screened for VHHs that bind the target antigen.
[0516] In these instances, the generation of antibodies requires purified antigen for immunization and / or screening. Antigens can be purified from natural sources, or in the course of recombinant production. Immunization and / or screening for immunoglobulin sequences can be performed using peptide fragments of such antigens.
[0517] Immunoglobulin sequences of different origin, comprising mouse, rat, rabbit, donkey, human and camelid immunoglobulin sequences can be used herein. Also, fully human, humanized or chimeric sequences can be used in the method described herein. For example, camelid immunoglobulin sequences and humanized camelid immunoglobulin sequences, or camelized domain antibodies, e.g., camelized dAb as described by Ward et al. 1989 (Nature 341 : 544), WO 1994 / 04678, and Davis and Riechmann (1994, Febs Lett., 339:285-290; and 1996, Prot. Eng., 9:531-537) can be used herein. Moreover, the ISVDs are fused forming a multivalent and / or multispecific construct (for multivalent and multispecific polypeptides containing one or more VHH domains and their preparation, reference is also made to Conrath et al. 2001 (J. Biol. Chem., Vol. 276, 10. 7346-7350) as well as to for example WO 1996 / 34103 and WO 1999 / 23221).
[0518] A “humanized VHH” comprises an amino acid sequence that corresponds to the amino acid sequence of a naturally occurring VHH domain, but that has been “humanized”, i.e. by replacing one or more amino acid residues in the amino acid sequence of said naturally occurring VHH sequence (and in particular in the framework sequences) by one or more of the amino acid residues that occur at the corresponding position(s) in a VH domain from a conventional 4-chain antibody from a human being (e.g., indicated above). This can be performed in a manner known per se, which will be clear to the skilled person, for example onthe basis of the prior art (e.g., WO 2008 / 020079). Again, it should be noted that such humanized VHHS can be obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VHH domain as a starting material.
[0519] A “camelized VH” comprises an amino acid sequence that corresponds to the amino acid sequence of a naturally occurring VH domain, but that has been “camelized”, i.e. by replacing one or more amino acid residues in the amino acid sequence of a naturally occurring VH domain from a conventional 4-chain antibody by one or more of the amino acid residues that occur at the corresponding position(s) in a VHH domain of a (camelid) heavy chain antibody. This can be performed in a manner known per se, which will be clear to the skilled person, for example on the basis of the description in the prior art (e.g., Davies and Riechman 1994, FEBS 339: 285; 1995, Biotechnol. 13: 475; 1996, Prot. Eng. 9: 531; and Riechman 1999, J. Immunol. Methods 231 : 25). Such “camelizing” substitutions are inserted at amino acid positions that form and / or are present at the VH-VL interface, and / or at the so-called Camelidae hallmark residues, as defined herein (see for example WO 1994 / 04678 and Davies and Riechmann (1994 and 1996, supra). In one embodiment, the VH sequence that is used as a starting material or starting point for generating or designing the camelized VH is a VH sequence from a mammal, such as the VH sequence of a human being, such as a VH3 sequence. However, it should be noted that such camelized VH can be obtained in any suitable manner known per se and thus are not strictly limited to polypeptides that have been obtained using a polypeptide that comprises a naturally occurring VH domain as a starting material.
[0520] The structure of an immunoglobulin single variable domain sequence can be considered to be comprised of four framework regions (“FRs”), which are referred to in the art and herein as “Framework region 1” (“FR1”); as “Framework region 2” (“FR2”); as “Framework region 3” (“FR3”); and as “Framework region 4” (“FR4”), respectively; which framework regions are interrupted by three complementary determining regions (“CDRs”), which are referred to in the art and herein as “Complementarity Determining Region 1” (“CDR1”); as “Complementarity Determining Region 2” (“CDR2”); and as “Complementarity Determining Region 3” (“CDR3”), respectively.
[0521] The amino acid residues of an ISVD can be numbered according to the general numbering for VH domains given by Kabat et al. (“Sequence of proteins of immunological interest”, US Public Health Services, NTH Bethesda, MD, Publication No. 91), as applied toVHH domains from Camelids in the article of Riechmann and Muyldermans, 2000 (J. Immunol. Methods 240 (1-2): 185-195; see for example Figure 2 of this publication). It should be noted that - as is well known in the art for VH domains and for VHH domains - the total number of amino acid residues in each of the CDRs may vary and may not correspond to the total number of amino acid residues indicated by the Kabat numbering. That is, one or more positions according to the Kabat numbering may not be occupied in the actual sequence, or the actual sequence may contain more amino acid residues than the number allowed for by the Kabat numbering. This means that, generally, the numbering according to Kabat may or may not correspond to the actual numbering of the amino acid residues in the actual sequence. The total number of amino acid residues in a VH domain and a VHH domain will usually be in the range of from 110 to 120, often between 112 and 115. It should however be noted that smaller and longer sequences may also be suitable for the purposes described herein. Also see The Kabat Numbering Scheme by Prof. Andrew C.R. Martine’s Group in bioinforg.uk, and Protein Sequence and structure Analysis of Antibody Variable domains by Prof. Andrew C.R. Martin in Antibody Engineering Vol. 2, Chapter 3, DOI 10.1007 / 978-3-642-01147-4_3.
[0522] In the present application, unless indicated otherwise, CDR sequences were determined according to the AbM definition as described in Kontermann and Diibel (Eds. 2010, Antibody Engineering, vol 2, Springer Verlag Heidelberg Berlin, Martin, Chapter 3, pp. 33- 51). According to this method, FR1 of an ISVD comprises the amino acid residues at positions 1-25, CDR1 of an ISVD comprises the amino acid residues at positions 26-35, FR2 of an ISVD comprises the amino acids at positions 36-49, CDR2 of an ISVD comprises the amino acid residues at positions 50-58, FR3 of an ISVD comprises the amino acid residues at positions 59-94, CDR3 of an ISVD comprises the amino acid residues at positions 95-102, and FR4 of an ISVD comprises the amino acid residues at positions 103-113.
[0523] Determination of CDR regions may also be done according to different methods. In the CDR definition according to Kabat, FR1 of an ISVD comprises the amino acid residues at positions 1-30, CDR1 of an ISVD comprises the amino acid residues at positions 31-35, FR2 of an ISVD comprises the amino acids at positions 36-49, CDR2 of an ISVD comprises the amino acid residues at positions 50-65, FR3 of an ISVD comprises the amino acid residues at positions 66-94, CDR3 of an ISVD comprises the amino acid residues at positions 95-102, and FR4 of an ISVD comprises the amino acid residues at positions 103-113.
[0524] In such an immunoglobulin sequence, the framework sequences may be any suitable framework sequences, and examples of suitable framework sequences will be clear to the skilled person, for example on the basis the standard handbooks and the further disclosure and prior art mentioned herein.
[0525] The framework sequences are (a suitable combination of) immunoglobulin framework sequences or framework sequences that have been derived from immunoglobulin framework sequences (for example, by humanization or camelization). For example, the framework sequences may be framework sequences derived from a light chain variable domain (e.g., a Vr-sequence) and / or from a heavy chain variable domain (e.g., a Vu-sequence or VHH sequence). In one particular aspect, the framework sequences are either framework sequences that have been derived from a Vun-sequence (in which said framework sequences may optionally have been partially or fully humanized) or are conventional VH sequences that have been camelized (as defined herein).
[0526] In particular, the framework sequences present in the ISVD sequence described herein may contain one or more of hallmark residues (as defined herein), such that the ISVD sequence is a Nanobody® ISVD, such as, e.g., a VHH, including a humanized VHH or camelized VH. Non-limiting examples of (suitable combinations of) such framework sequences will become clear from the further disclosure herein.
[0527] The total number of amino acid residues in a VH domain and a VHH domain will usually be in the range of from 110 to 120, often between 112 and 115. It should however be noted that smaller and longer sequences may also be suitable for the purposes described herein.
[0528] However, it should be noted that the ISVDs described herein is not limited as to the origin of the ISVD sequence (or of the nucleotide sequence used to express it), nor as to the way that the ISVD sequence or nucleotide sequence is (or has been) generated or obtained. Thus, the ISVD sequences may be naturally occurring sequences (from any suitable species) or synthetic or semi -synthetic sequences. In a specific but non-limiting aspect, the ISVD sequence is a naturally occurring sequence (from any suitable species) or a synthetic or semisynthetic sequence, including but not limited to “humanized” (as defined herein) immunoglobulin sequences (such as partially or fully humanized mouse or rabbit immunoglobulin sequences, and in particular partially or fully humanized VHH sequences), “camelized” (as defined herein) immunoglobulin sequences (and in particular camelized VHsequences), as well as ISVDs that have been obtained by techniques such as affinity maturation (for example, starting from synthetic, random or naturally occurring immunoglobulin sequences), CDR grafting, veneering, combining fragments derived from different immunoglobulin sequences, PCR assembly using overlapping primers, and similar techniques for engineering immunoglobulin sequences well known to the skilled person; or any suitable combination of any of the foregoing.
[0529] Similarly, nucleotide sequences may be naturally occurring nucleotide sequences or synthetic or semi-synthetic sequences, and may for example be sequences that are isolated by PCR from a suitable naturally occurring template (e.g., DNA or RNA isolated from a cell), nucleotide sequences that have been isolated from a library (and in particular, an expression library), nucleotide sequences that have been prepared by introducing mutations into a naturally occurring nucleotide sequence (using any suitable technique known per se, such as mismatch PCR), nucleotide sequence that have been prepared by PCR using overlapping primers, or nucleotide sequences that have been prepared using techniques for DNA synthesis known per se.
[0530] Generally, Nanobody® ISVDs (in particular VHH sequences, including (partially) humanized VHH sequences and camelized VH sequences) can be characterized by the presence of one or more “Hallmark residues” (as described herein) in one or more of the framework sequences (again as further described herein). Thus, generally, a Nanobody® ISVD can be defined as an immunoglobulin sequence with the (general) structure FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and in which one or more of the Hallmark residues are as further defined herein.
[0531] In particular, a Nanobody® ISVD can be an immunoglobulin sequence with the (general) structure FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to the complementarity determining regions 1 to 3, respectively, and in which the framework sequences are as further defined herein.
[0532] More in particular, a Nanobody® ISVD can be an immunoglobulin sequence with the (general) structure FR1 - CDR1 - FR2 - CDR2 - FR3 - CDR3 - FR4, in which FR1 to FR4 refer to framework regions 1 to 4, respectively, and in which CDR1 to CDR3 refer to thecomplementarity determining regions 1 to 3, respectively, and in which: one or more of the amino acid residues at positions 11, 37, 44, 45, 47, 83, 84, 103, 104 and 108 according to the Kabat numbering are chosen from the Hallmark residues mentioned in Table A below.Table A: Hallmark Residues in Nanobody® ISVDs
[0533] In one embodiment, the immunoglobulin single variable domain has certain amino acid substitutions in the framework regions effective in preventing or reducing binding by so- called “pre-existing antibodies” to the polypeptides. To this end, in one embodiment, the polypeptide comprises a valine (V) at amino acid position 11 and a leucine (L) at amino acid position 89 (according to Kabat numbering) in at least one ISVD. In one embodiment, the polypeptide comprises a valine (V) at amino acid position 11 and a leucine (L) at amino acid position 89 (according to Kabat numbering) in each ISVD. Accordingly, part of the present disclosure are also ISVDs and polypeptides as described above that have been sequence optimized with a valine (V) at amino acid position 11 and a leucine (L) at amino acid position 89 (according to Kabat numbering) in at least one ISVD, such as in all ISVDs. Examples of ISVDs and polypeptides that comprises a valine (V) at amino acid position 11 and a leucine (L) at amino acid position 89 (according to Kabat numbering) in at least one ISVD are depicted in Table C-2 (SEQ ID NOs: 161-169, 171-179 and 28-36 and 44).
[0534] In one embodiment, the ISVD or polypeptide has a C-terminal end of the sequence VTVSS(X)n (SEQ ID NO: 353), in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5, and in which each X is an amino acid residue that is independently chosen. In one embodiment, the polypeptide comprises such an ISVD at its C-terminal end. In one embodiment, n is 1 or 2, such as 1. In one embodiment, X is a naturally occurring amino acid. In one embodiment, X is chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I).
[0535] In another embodiment the polypeptide comprises a lysine (K) or glutamine (Q) at position 110 (according to Kabat numbering) in at least one ISVD. In another embodiment, the ISVD comprises a lysine (K) or glutamine (Q) at position 112 (according to Kabat numbering) in at least one ISVD. In these embodiments, the C-terminus of the ISVD is VKVSS (SEQ ID NO: 354), VQVSS (SEQ ID NO: 355), VTVKS (SEQ ID NO: 356), VTVQS (SEQ ID NO: 357), VKVKS (SEQ ID NO: 358), VKVQS (SEQ ID NO: 359), VQVKS (SEQ ID NO: 360), or VQVQS (SEQ ID NO: 361) such that after addition of a single alanine the C-terminus of the polypeptide for example comprises the sequence VTVSSA (SEQ ID NO: 362), VKVSSA (SEQ ID NO: 363), VQVSSA (SEQ ID NO: 364), VTVKSA (SEQ ID NO: 365), VTVQSA (SEQ ID NO: 366), VKVKSA (SEQ ID NO: 367), VKVQSA (SEQ ID NO: 368), VQVKSA (SEQ ID NO: 369), or VQVQSA (SEQ ID NO: 370). In one embodiment, the polypeptide comprises a valine (V) at amino acid position 11 and a leucine (L) at amino acid position 89 (according to Kabat numbering) in each ISVD, optionally a lysine (K) or glutamine (Q) at position 110 (according to Kabat numbering) in at least one ISVD, and comprises an extension of 1 to 5 (naturally occurring) amino acids (as defined above), such as a single alanine (A) extension, at the C-terminus of the C-terminal ISVD, such that the C-terminus of the polypeptide for example comprises the sequence VTVSSA (SEQ ID NO: 362), VKVSSA (SEQ ID NO: 363) or VQVSSA (SEQ ID NO: 364). See e.g. WO2012 / 175741 and WO2015 / 173325 for further information in this regard.
[0536] The immunoglobulin single variable domains may form part of a protein or polypeptide, which may comprise or essentially consist of one or more (at least one) immunoglobulin single variable domains and which may optionally further comprise one or more further amino acid sequences (all optionally linked via one or more suitable linkers). The term “immunoglobulin single variable domain” may also encompass such polypeptides. The one or more immunoglobulin single variable domains may be used as a binding unit in such a protein or polypeptide, which may optionally contain one or more further amino acids that can serve as a binding unit, so as to provide a monovalent, multivalent or multispecific polypeptide of the present disclosure, respectively (for multivalent and multispecific polypeptides containing one or more VHH domains and their preparation, reference is also made to Conrath et al. 2001 (J. Biol. Chem. 276: 7346), as well as to for example WO 1996 / 34103, WO 1999 / 23221 and WO 2010 / 115998).
[0537] The polypeptides may comprise or essentially consist of one immunoglobulin single variable domain, as outlined above. Such polypeptides are also referred to herein as monovalent polypeptides.
[0538] The term “multivalent” indicates the presence of multiple ISVDs in a polypeptide. In one embodiment, the polypeptide is “bivalent”, i.e., comprises or consists of two ISVDs. In one embodiment, the polypeptide is “trivalent”, i.e., comprises or consists of three ISVDs. In another embodiment, the polypeptide is “tetravalent”, i.e. comprises or consists of four ISVDs. The polypeptide can thus be “bivalent”, “trivalent”, “tetravalent”, “pentavalent”, “hexavalent”, “heptavalent”, “octavalent”, “nonavalent”, etc., i.e., the polypeptide comprises or consists of two, three, four, five, six, seven, eight, nine, etc., ISVDs, respectively. In one embodiment the multivalent ISVD polypeptide is trivalent. In another embodiment the multivalent ISVD polypeptide is tetravalent. In still another embodiment, the multivalent ISVD polypeptide is pentavalent.
[0539] In one embodiment, the multivalent ISVD polypeptide can also be multi specific. The term “multi specific” refers to binding to multiple different target molecules (also referred to as antigens). The multivalent ISVD polypeptide can thus be “bispecific”, “trispecific”, “tetraspecific”, etc., i.e., can bind to two, three, four, etc., different target molecules, respectively.
[0540] For example, the polypeptide may be bispecific-trivalent, such as a polypeptide comprising or consisting of three ISVDs, wherein two ISVDs bind to a first target and one ISVD binds to a second target different from the first target. In another example, the polypeptide may be trispecific-tetravalent, such as a polypeptide comprising or consisting of four ISVDs, wherein one ISVD binds to a first target, two ISVDs bind to a second target different from the first target and one ISVD binds to a third target different from the first and the second target. In still another example, the polypeptide may be trispecific-pentavalent, such as a polypeptide comprising or consisting of five ISVDs, wherein two ISVDs bind to a first target, two ISVDs bind to a second target different from the first target and one ISVD binds to a third target different from the first and the second target.
[0541] In one embodiment, the multivalent ISVD polypeptide can also be multiparatopic. The term “multiparatopic” refers to binding to multiple different epitopes on the same target molecules (also referred to as antigens). The multivalent ISVD polypeptide can thus be“biparatopic”, “triparatopic”, etc., i.e., can bind to two, three, etc., different epitopes on the same target molecules, respectively.
[0542] In another aspect, the polypeptide of the present disclosure that comprises or essentially consists of one or more immunoglobulin single variable domains (or suitable fragments thereof), may further comprise one or more other groups, residues, moieties or binding units. Such further groups, residues, moieties, binding units or amino acid sequences may or may not provide further functionality to the immunoglobulin single variable domain (and / or to the polypeptide in which it is present) and may or may not modify the properties of the immunoglobulin single variable domain.
[0543] For example, such further groups, residues, moieties or binding units may be one or more additional amino acids, such that the compound, construct or polypeptide is a (fusion) protein or (fusion) polypeptide. In a preferred but non-limiting aspect, said one or more other groups, residues, moieties or binding units are immunoglobulins. Even more preferably, said one or more other groups, residues, moieties or binding units are chosen from the group consisting of domain antibodies, amino acids that are suitable for use as a domain antibody, single domain antibodies, amino acids that are suitable for use as a single domain antibody, “dAb”s, amino acids that are suitable for use as a dAb, VHHs (including humanized VHHs), VHs (including human VHs, camelized VHs and camelized human VHs), and VLs.
[0544] Alternatively, such groups, residues, moieties or binding units may for example be chemical groups, residues, moieties, which may or may not by themselves be biologically and / or pharmacologically active. For example, and without limitation, such groups may be linked to the one or more immunoglobulin single variable domain so as to provide a “derivative” of the immunoglobulin single variable domain.
[0545] In another embodiment, said further residues may be effective in preventing or reducing binding by so-called “pre-existing antibodies” to the polypeptides. For this purpose, the polypeptides and constructs may contain a C-terminal extension (X)n (in which n is 1 to 10, preferably 1 to 5, such as 1, 2, 3, 4 or 5 (and preferably 1 or 2, such as 1); and each X is an (preferably naturally occurring) amino acid residue that is independently chosen, and preferably independently chosen from the group consisting of alanine (A), glycine (G), valine (V), leucine (L) or isoleucine (I), for which reference is made to WO 2012 / 175741. Accordingly, the polypeptide may further comprise a C-terminal extension (X)n, in which n is1 to 5, such as 1, 2, 3, 4 or 5, and in which X is a naturally occurring amino acid, preferably no cysteine.
[0546] In one embodiment, the polypeptide may further comprise one or more other groups, residues, moieties or binding units, optionally linked via one or more peptidic linkers, in which said one or more other groups, residues, moieties or binding units provide the polypeptide with increased (in vivo) half-life, compared to the corresponding polypeptide without said one or more other groups, residues, moieties or binding units. In vivo half-life extension means, for example, that the polypeptide has an increased half-life in a mammal, such as a human subject, after administration. Half-life can be expressed for example as tl / 2beta.
[0547] The type of groups, residues, moieties or binding units is not generally restricted and may for example be chosen from the group consisting of a polyethylene glycol molecule, serum proteins or fragments thereof, binding units that can bind to serum proteins, an Fc portion, and small proteins or peptides that can bind to serum proteins.
[0548] More specifically, said one or more other groups, residues, moieties or binding units that provide the polypeptide with increased half-life can be chosen from the group consisting of binding units that can bind to serum albumin, such as human serum albumin, or a serum immunoglobulin, such as IgG. In one embodiment, said one or more other groups, residues, moieties or binding units that provide the polypeptide with increased half-life is a binding unit that can bind to human serum albumin. In one embodiment, the binding unit is an ISVD.
[0549] For example, WO 2004 / 041865 and WO 2006 / 122787 describes ISVDs binding to serum albumin (and in particular against human serum albumin) that can be linked to other proteins (such as one or more other ISVDs binding to a desired target) in order to increase the half-life of said protein. These ISVDs include the ISVDs called Alb-1 (SEQ ID NO: 52 in WO 2006 / 122787) and humanized variants thereof, such as Alb-8 (SEQ ID NO: 62 in WO 2006 / 122787). Again, these can be used to extend the half-life of therapeutic proteins and polypeptide and other therapeutic entities or moieties. Moreover, WO 2012 / 175400 describes a further improved version of Alb-1, called Alb-23.
[0550] In one embodiment, the polypeptide comprises a serum albumin binding moiety selected from Alb-1, Alb-3, Alb-4, Alb-5, Alb-6, Alb-7, Alb-8, Alb-9, Alb-10 (WO 2006 / 122787) and Alb-23. In one embodiment, the serum albumin binding moiety is Alb-8 orAlb-23 or its variants, as shown on pages 7-9 of WO 2012 / 175400. In one embodiment, the serum albumin binding moiety is selected from the albumin binders described in WO 2012 / 175741, WO2015 / 173325, W02017 / 080850, WO2017 / 085172, WO2018 / 104444, WO2018 / 134235, and WO2018 / 134234. Some serum albumin binders are also shown in Table B. In one embodiment, the serum albumin binder is AlbXOOOOl (SEQ ID NO: 334). In one embodiment the serum albumin binder is Alb23002 (SEQ ID NO: 335).
[0551] In the polypeptides described above, the one or more immunoglobulin single variable domains and the one or more groups, residues, moi eties or binding units may be linked directly to each other and / or via one or more suitable linkers or spacers. For example, when the one or more groups, residues, moieties or binding units are amino acids, the linkers may also be an amino acid, so that the resulting polypeptide is a fusion protein or fusion polypeptide.
[0552] As used herein, the term “linker” denotes a peptide that fuses together two or more ISVDs into a single molecule. The use of linkers to connect two or more (poly)peptides is well known in the art.
[0553] In some embodiments, the further exemplary peptidic linkers are shown in Table B. One often used class of peptidic linker are known as the “Gly-Ser” or “GS” linkers. These are linkers that essentially consist of glycine (G) and serine (S) residues, and usually comprise one or more repeats of a peptide motif such as the GGGGS (SEQ ID NO: 337) motif (for example, having the formula (Gly-Gly-Gly-Gly-Ser)n in which n may be 1, 2, 3, 4, 5, 6, 7 or more). Some often-used examples of such GS linkers are 9GS linkers (GGGGSGGGS, SEQ ID NO: 340), 15GS linkers (n=3) and 35GS linkers (n=7). Reference is for example made to Chen et al. 2013 (Adv. Drug Deliv. Rev. 65(10): 1357-1369) and Klein et al. 2014 (Protein Eng. Des. Sei. 27 (10): 325-330).Table B: Serum albumin binding ISVD sequences, Linker sequences and some proposed ISVD C-terminal ends (amino acids 109-112 or 109-113, according to Kabat numbering) (“ID” refers to the SEQ ID NO as used herein)
[0554] Specific examples of ISVDs specifically binding to CD8aP are ISVDs that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), that interacts with at least one amino acid of the CD8a proteinMALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWL FQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYF CSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVH TRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCNHRNRRRVCKCPRPVVKSGDKPSL SARYV (SEQ ID NO: 570) selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570.
[0555] In another embodiment, the ISVD interacts with a discontinuous epitope on the CD8a protein.
[0556] In another embodiment, the ISVD interacts with at least two amino acids amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least three amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least four amino acids amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least five amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least six amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least seven amino acids of the CD8a protein selectedfrom R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least eight amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least nine amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least ten amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least eleven amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least twelve amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least thirteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least fourteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least fifteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least sixteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least seventeenI l lamino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least eighteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least nineteen amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570. In another embodiment, the ISVD interacts with at least twenty amino acids of the CD8a protein selected from R25, K42, Q44, V45, L46, L47, S48, N49, P50, T51, S52, G53, C54, L71, Y72, L73, S74, Q75, N76, K77, R93, L94, G95, D96, T97, and D98, when numbered in accordance with SEQ ID NO.: 570.
[0557] In another embodiment, the ISVD interacts with an amino acid of the CD8a protein having a buried surface area (BSA) as described herein (e.g. calculated by PDBe-PISA) of more than 10 (R25, K42, Q44, L46, L47, S48, P50, T51, S52, Q75, N76, R93, L94, G95, D96, T97, when numbered in accordance with SEQ ID NO.: 570), more than 25 (R25, Q44, L46, L47, S48, P50, S52, Q75, N76, R93, L94, G95, D96, when numbered in accordance with SEQ ID NO.: 570), preferably more than 50 (R25, L46, P50, Q75, G95, D96, when numbered in accordance with SEQ ID NO.: 570).
[0558] In another embodiment, the ISVD interacts with one or more regions of the CD8a protein, when numbered in accordance with SEQ ID NO.: 570, selected from: region Q44-L46: Q44, V45, and L46;- region L47-C54: L47, S48, N49, P50, T51, S52, G53, and C54;- region L74-K77: S74, Q75, N76, and K77;- region L71-K77: L71, Y72, L73, S74, Q75, N76, and K77; and- region G95-D98: R93, L94, G95, D96, T97, and D98.
[0559] In some embodiments, the ISVD interacts with one or more amino acid residues in CD8a, when numbered in accordance with SEQ ID NO.: 570, selected from:R25, K42, and R93;R25, V45, L47, S48, Q75, N76, D96, and T97;R25, K42, L47, S48, Q75, N76, R93, and D96;R25, K42,V45, L47, S48, Q75, N76, R93, D96, and T97; andL46 and P50.
[0560] In some embodiments, the ISVD interacts with one or more amino acid residues in CD8alpha in region L74-K77 of the CD8a protein, such as N76.
[0561] In another embodiment, the ISVD specifically binds to the same amino acid residues and / or the same epitope on the CD8a protein as the ISVD having SEQ ID NO: 169. In this respect, the immunoglobulin single variable domain of the present technology comprises amino acid residues corresponding to the amino acid residues in the ISVD having SEQ ID NO: 169 that interact with the CD8a protein.
[0562] Based on the structural data provided herein, the skilled person understands that amino acid residues of an ISVD involved in the interaction with the CD8a protein can be determined and that this interaction site is important for the binding of an ISVD to the epitope on the CD8a protein.
[0563] Specifically, the interaction site between an ISVD having SEQ ID NO: 169 and the CD8a protein having SEQ ID NO.: 570 has been determined and provides clear technical guidance for the generation of further ISVDs having the binding specificity of the ISVD having SEQ ID NO: 169, e.g. binding to the same epitope on the CD8a protein.
[0564] In this respect, the skilled person understands that an ISVD of the present technology having the binding specificity of the ISVD having SEQ ID NO: 169, e.g. specifically binding to the same epitope on the CD8a protein or blocking the binding to the CD8a protein by an ISVD having SEQ ID NO: 169 is not limited to the specific amino acid sequence of the CDR region and / or the FR region of the ISVD having SEQ ID NO: 169, as long as the ISVD contains at least one or more amino acid residue(s) corresponding to the at least one or more amino acid residue(s) of the ISVD having SEQ ID NO: 169 that interact with the CD8a protein as described herein.
[0565] In other words, an ISVD of the present technology having the binding specificity of the ISVD having SEQ ID NO: 169, e.g. specifically binding to the same epitope on the CD8a protein or blocking the binding to the CD8a protein by an ISVD having SEQ ID NO:169 may contain, as compared to an ISVD having SEQ ID NO: 169, mutations and / or substitutions within the CDR region and / or within the FR region (such as conservative amino acid substitutions) whilst maintaining the amino acids of the ISVD that form the interaction site (i.e., the paratope on the ISVD) with the CD8a protein.
[0566] In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering) in CDR1. In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering) in the CDR2. In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VI 00m, DIOOn, LlOOo, and D101 (Kabat numbering) in the CDR3.
[0567] In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from F27, T28, F29, E30, D31, and Y32 (Kabat numbering) in CDR1. In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from 151, R52, T52a, Y53, D54, E55, Q56, and T57 (Kabat numbering) in the CDR2. In some embodiments, the amino acids in the ISVD that form part of the interaction site (i.e., the paratope on the ISVD) are selected from G95, S96, Y97, Y98, A99, Cl 00, AlOOa, (Kabat numbering) in the CDR3.
[0568] The interacting amino acids preferably have a distance of less than 4 A (<4 A), wherein the distance between the amino acids is measured e.g., in Cryogenic-electron microscopy (cryo-EM).
[0569] In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form part of the interaction site of <4 A are selected from E30, D31, Y32 and A33 (Kabat numbering) in CDR1. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form part of the interaction site of <4 A are selected from R52, Y53, D54, Q56, and Y58 (Kabat numbering) in the CDR2. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form part of the interaction site of <4 A are selected from G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering) in the CDR3.
[0570] In some embodiments the interactions site is a salt bridge that is formed between the amino acids in the ISVD (i.e., the paratope on the ISVD) and the amino acids of the CD8a protein. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form a salt bridge with the amino acids of the CD8a protein are selected from E30 and D101 (Kabat numbering). In some embodiments, the amino acids in the CD8a protein that form a salt bridge with the amino acids of the ISVD (i.e., the paratope on the ISVD) are selected from R25, K42, R93. In some embodiments, following salt bridges are formed:OD1]: one of the two carboxylate oxygen atoms in the acidic side chain of aspartate (D); [OD2]: the second carboxylate oxygen atom in the side chain of aspartate (D); [NH2] : the other terminal nitrogen in the guanidinium group of arginine (R); [NZ]: terminal amino group nitrogen in the basic side chain of lysine (K).
[0571] In some embodiments, the immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha comprises D31 and D101, wherein upon binding CD8alpha, following interaction sites of <4A are formed: o D31 (Kabat numbering) interacts with R25 of CD8alpha; o D31 (Kabat numbering) interacts with K42 of CD8alpha; o D101 (Kabat numbering) interacts with R93 of CD8alpha.
[0572] In some embodiments the interactions site is a hydrogen bond that is formed between the amino acids in the ISVD (i.e., the paratope on the ISVD) and the amino acids of the CD8a protein. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form a hydrogen bond with the amino acids of the CD8a protein are selected from E30 and D31 (Kabat numbering) in CDR1. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form a hydrogen bond with the amino acids of the CD8a protein are selected from R52 and Q56 (Kabat numbering) in the CDR2. In some embodiments, the amino acids in the ISVD (i.e., the paratope on the ISVD) that form a hydrogen bond with the amino acids of the CD8a protein are selected from S96, Y97, ElOOjand DIOOn (Kabat numbering) in the CDR3. In some embodiments, the amino acids in the CD8a protein that form a hydrogen bond with the amino acids of the ISVD (i.e., the paratope on the ISVD) are selected from R25, V45, L47, S48, Q75, N76, D96 and T97. In some embodiments, following hydrogen bonds are formed:0D2]: the second carboxylate oxygen atom in the side chain of aspartate (D); [OE1]: one of the two carboxylate oxygen atoms in the side chain of glutamate (E); [OE2]: the second carboxylate oxygen atom in the side chain of glutamate (E); [NH1]: one of the terminal nitrogen atoms in the guanidinium group of arginine (R); [NH2]: the other terminal nitrogen in the guanidinium group of arginine (R); [NE2]: terminal nitrogen in amide of glutamine (Q) or imidazole ring of histidine (H); [ND2]: terminal nitrogen in the side-chain amide group of asparagine (N); [OG]: hydroxyl oxygen atom in the polar side chain of serine (S); [OG1]: hydroxyl oxygen atom in the threonine side chain of threonine (T); [O] : backbone carbonyl oxygen (C=O); [N] : backbone amide nitrogen (-NH).
[0573] In some embodiments, the immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha comprises E30, D31, R52, Q56, S96, Y97, ElOOj, and DIOOn, wherein upon binding CD8alpha, following interaction sites of <4A are formed: o R52 (Kabat numbering) interacts with V45 of CD8alpha; o R52 (Kabat numbering) interacts with L47 of CD8alpha; o Q56 (Kabat numbering) interacts with S48 of CD8alpha; o S96 (Kabat numbering) interacts with Q75 of CD8alpha; o Y97 (Kabat numbering) interacts with D96 of CD8alpha;o E30 (Kabat numbering) interacts with R25 of CD8alpha; o DIOOn (Kabat numbering) interacts with Q75 of CD8alpha; o ElOOj (Kabat numbering) interacts with N76 of CD8alpha. o D31 (Kabat numbering) interacts with R96 of CD8alpha; and o D31 (Kabat numbering) interacts with T97 of CD8alpha.
[0574] In some embodiments the interactions site is a hydrophobic interaction between the amino acids in the ISVD (i.e., the paratope on the ISVD) and the amino acids of the CD8a protein. In some embodiments, the amino acid in the ISVD (i.e., the paratope on the ISVD) that forms a hydrophobic interaction with the amino acids of the CD8a protein is Y98 (Kabat numbering). In some embodiments, the amino acids in the CD8a protein that form a hydrophobic interaction with the amino acids of the ISVD (i.e., the paratope on the ISVD) are selected from L46 and P50.
[0575] In some embodiments, the ISVD comprises D31, R52, Q56, S96, Y97, ElOOj, and D101 (Kabat numbering), wherein D31, R52, Q56, S96, Y97, ElOOj, and D101 form an interaction site of <4A with at least one amino acid selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least two amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least three amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least four amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least five amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least six amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with at least seven amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the interaction site is formed with the amino acids selected from the group consisting of R25, K42, L47, S48, Q75, N76, R93 and D96 of the CD8a protein. In some embodiments, the ISVD comprises ElOOj (Kabat numbering) and the interaction site is formed with N76 of the CD8a protein.
[0576] In some embodiments, the CDR3 is stabilized by a non-canonical disulfide bond between C50 (Kabat numbering) in CDR2 and Cl 00 (Kabat numbering) in CDR3 stabilizing the paratope conformation and creating a rigid binding scaffold that enhances specificity. This covalent linkage constrains CDR3 in a conformation optimal for CD8 recognition. In some embodiments, the ISVD comprises cysteine at position 50 (C50) and cysteine at position 100 (Cl 00) and amino acid residues C50 in CDR2 and Cl 00 in CDR3 are covalently linked via a disulfide bond. The extended CDR3 amino acids 100a-101 (Kabat numbering) are flexible. In some embodiments, the CDR3 (according to Abm definition) has a length of 20 or more, of 21 or more, of 22 or more, of 23 or more, such as of 23 amino acids and comprises ElOOj (Kabat numbering).
[0577] Energetically, P50 and L46 from the CD8a protein contribute most favorably to binding (1.34 and 1.05 kcal / mol), while D31 from ISVD A044300805_v8 provides significant stabilization (1.69 kcal / mol total). This defined epitope-paratope interface underlies ISVD A044300805_v8's selective recognition of CD8 alpha. In some embodiments the ISVD comprises D31. In some embodiment, the ISVD interacts with L46 and P50 on the CD8a protein.
[0578] Specific examples of immunoglobulin single variable domains (ISVDs) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), are ISVDs in which:CDR1 (according to Abm definition) has an amino acid sequence selected from the group consisting of a) the amino acid sequence of SEQ ID NO: 244; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 244; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 244; andCDR2 (according to Abm definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 246;e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 246; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 246; andCDR3 (according to Abm definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 248; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 248; and i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 248.
[0579] In some embodiments, the immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to Abm definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 244; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 244; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 244; wherein CDR1 comprises at least three amino acid residues selected from the group consisting of F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering), wherein CDR1 comprises at least four amino acid residues selected from the group consisting of F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises at least five amino acid residues selected from the group consisting of F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises at least six amino acid residues selected from the group consisting of F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises F27, T28, F29, E30, D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises at least D31 (Kabat numbering);wherein CDR1 comprises at least E30 and D31 (Kabat numbering); wherein CDR1 comprises at least E30, D31 and Y32 (Kabat numbering); and / or wherein CDR1 comprises at least E30, D31, Y32 and A33 (Kabat numbering); andCDR2 (according to Abm definition) has an amino acid sequence selected from the group consisting of d) the amino acid sequence of SEQ ID NO: 246; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 246; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 246; wherein CDR2 comprises at least five amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least six amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least seven amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least eight amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least R52 and Y53 (Kabat numbering); wherein CDR2 comprises at least R52 and Q56 (Kabat numbering); and / or wherein CDR2 comprises at least R52, Y53, D54, Q56 and Y58 (Kabat numbering); andCDR3 (according to Abm definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 248; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 248; and i) amino acid sequences that have 7, 6, 5, 4, 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 248;wherein CDR3 comprises at least 7 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering), wherein CDR3 comprises at least 8 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 9 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 10 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 11 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 12 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 13 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises G95, S96, Y97, Y98, A99, Cl 00, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and DlOl (Kabat numbering); wherein CDR3 comprises at least D101 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, DIOOn, and ElOOj (Kabat numbering); wherein CDR3 comprises at least Y98 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, ElOOj and D101 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, DIOOn, ElOOj and D101 (Kabat numbering); wherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, and AlOOa (Kabat numbering); wherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, AlOOa, and YlOOb (Kabat numbering); and / orwherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, A100a,Y100b, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and DlOl (Kabat numbering).
[0580] In some embodiments, the flexible loop of CDR3 lOOd-lOOi can be truncated, while El 14 is essential to maintain CDR3 conformation. In some embodiments, the immunoglobulin single variable domain (ISVD) comprises a CDR3 (according to Abm definition) comprising at least 20 amino acids, at least 21 amino acids, at least 22 amino acids, at least 23 amino acids, and / or the CDR3 (according to Abm definition) consists of 23 amino acids and position lOOj (Kabat numbering) in CDR3 is E.
[0581] Examples of ISVDs specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), are ISVDs in which:CDR1 (according to Abm definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of GFTFXiDYAIG (SEQ ID NO: 571); b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of GFTFXiDYAIG (SEQ ID NO: 571); and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of GFTFXiDYAIG (SEQ ID NO: 571); wherein Xi is selected from D and E; andCDR2 (according to Abm definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of CIRTYDX2X3TY (SEQ ID NO: 572); e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of CIRTYDX2X3TY (SEQ ID NO: 572); and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of CIRTYDX2X3TY (SEQ ID NO: 572) wherein X2 is selected from G and E; wherein X3 is selected from N and Q; andCDR3 (according to Abm definition) has an amino acid sequence selected from the group consisting of:g) the amino acid sequence of GSYYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of GSYYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); and i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of GSYYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); wherein X4is selected from K, E and Y; wherein X5 is selected from N and G; and / or wherein Xe is selected from M and L.
[0582] The SEQ ID NOs for the CDR sequences referred to above are based on the CDR definition according to the AbM definition (see Table C-l). It is noted that the SEQ ID NOs for the CDR sequences defined according to the Kabat definition can likewise be used (see Table C-l). Accordingly, the ISVDs provided by the present technology, specifically binding to CD8alpha as described above by its CDRs using the AbM definition, can be also described by its CDRs using the Kabat definition.
[0583] Examples of ISVDs specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), are ISVDs in which:CDR1 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 314; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 314; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 314; andCDR2 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 316; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 316; andf) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 316; andCDR3 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 318; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 318; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 318.
[0584] In some embodiments, the immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 314; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 314; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 314; wherein CDR1 comprises at least one amino acid residues selected from the group consisting of D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises at least two amino acid residues selected from the group consisting of D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises D31, Y32 and A33 (Kabat numbering); wherein CDR1 comprises at least D31 (Kabat numbering); wherein CDR1 comprises at least D31 and Y32 (Kabat numbering); and / or wherein CDR1 comprises at least D31, Y32 and A33 (Kabat numbering); andCDR2 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 316;e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 316; and f) amino acid sequences that have 5, 4, 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 316; wherein CDR2 comprises at least three amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least four amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least five amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least six amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least seven amino acid residues selected from the group consisting of 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises 151, R52, T52a, Y53, D54, E55, Q56, T57 and Y58 (Kabat numbering); wherein CDR2 comprises at least R52 and Y53 (Kabat numbering); wherein CDR2 comprises at least R52 and Q56 (Kabat numbering); wherein CDR2 comprises at least R52, Y53, D54, Q56 and Y58 (Kabat numbering); andCDR3 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 318; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 318; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 318; wherein CDR3 comprises at least 7 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 8 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering);wherein CDR3 comprises at least 9 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 10 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 11 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 12 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises at least 13 amino acid residues selected from the group consisting of G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and D101 (Kabat numbering); wherein CDR3 comprises G95, S96, Y97, Y98, A99, Cl 00, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and DlOl (Kabat numbering); wherein CDR3 comprises at least D101 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, DIOOn, and ElOOj (Kabat numbering); wherein CDR3 comprises at least Y98 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, ElOOj and D101 (Kabat numbering); wherein CDR3 comprises at least S96, Y97, DIOOn, ElOOj and D101 (Kabat numbering); wherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, and AlOOa (Kabat numbering); wherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, AlOOa, and YlOOb (Kabat numbering); and / or wherein CDR3 comprises at least G95, S96, Y97, Y98, A99, C100, AlOOa, YlOOb, ElOOj, GlOOk, VlOOm, DIOOn, LlOOo, and DlOl (Kabat numbering).
[0585] Examples of ISVDs specifically binding human CD8alpha that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), are ISVDs in which:CDR1 (according to Kabat definition) has an amino acid sequence selected from the group consisting of a) the amino acid sequence of SEQ ID NO: 314; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 314; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 314; andCDR2 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of CIRTYDX1X2TYYX3DSVKG (SEQ ID NO: 574); e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of CIRTYDX1X2TYYX3DSVKG (SEQ ID NO: 574); and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of CIRTYDX1X2TYYX3DSVKG (SEQ ID NO: 574); wherein Xi is selected from G and E; wherein X2 is selected from N and Q; wherein X3 is selected from I and A; andCDR3 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of GSYYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of GSYYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); and i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of GS YYACAX4YSRPDPSEX5HVDX6DY (SEQ ID NO: 573); wherein X4is selected from K, E and Y; wherein X5 is selected from N and G; and / or wherein Xe is selected from M and L.
[0586] In one aspect, the disclosure also relates to such ISVDs that can bind to and / or are directed against CD8a (CD8alpha) and that comprise CDR sequences that are generally asfurther defined herein, to suitable fragments thereof, as well as to polypeptides that comprise or essentially consist of one or more of such ISVDs and / or suitable fragments. In some aspect, the disclosure relates to an ISVDs comprising a sequence selected from the group consisting of SEQ ID NOs: 160 to 179. In particular, the disclosure in some specific aspects provides:I) ISVDs that are directed against CD8a and that have at least 80%, preferably at least 85%, such as 90% or 95% or more sequence identity with an ISVD comprising a sequence selected from the group consisting of SEQ ID NOs: 160 to 179;II) ISVDs that cross-block the binding of the amino acid sequence selected from the group consisting of SEQ ID NOs: 160 to 179 to CD8a and / or that compete with at least the ISVD selected from the group consisting of SEQ ID NOs: 160 to 179 for binding to CD8a;
[0587] Such ISVDs may be as further described herein (and may for example be VHHs, including humanized VHHs, VHs, including human VHs, camelized VHs and camelized human VHs); as well as polypeptides of the disclosure that comprise one or more of such amino acid sequences (which may be as further described herein), and particularly bispecific (or multispecific) polypeptides as described herein, and nucleic acid sequences that encode ISVDs and polypeptides. Such ISVDs and polypeptides do not include any naturally occurring ligands.
[0588] In some embodiments, the CD8a is derived from a mammalian animal, such as a human being. In one specific, but non-limiting aspect, the disclosure relates to an ISVD directed against CD8a, that comprises: a) the amino acid sequence selected from the group consisting of SEQ ID NOs: 160 to 179; b) amino acid sequences that have at least 80% amino acid identity with a sequence selected from the group consisting of SEQ ID NOs: 160 to 179, or c) amino acid sequences that have 3, 2, or 1 amino acid difference with a sequence selected from the group consisting of SEQ ID NOs: 160 to 179; or any suitable combination thereof.
[0589] In some embodiments, disclosed is an ISVD against CD8a, which consist of 4 framework regions (FR1 to FR4 respectively) and 3 complementarity determining regions (CDR1 to CDR3 respectively). In some embodiments, in such an ISVD:(I) CDR1 comprises or essentially consists of an amino acid sequence selected from the group consisting of SEQ ID NOs: 181, 188, 195, 202, 209, 216, 223, 230, 237, and 244 according to Abm definition, and SEQ ID NOs: 251, 258, 265, 272, 279, 286, 293, 300, 307, and 314 according to Kabat definition; or amino acid sequences that have at least 80%, at least 90%, at least 95%, at least 99% or more sequence identity with a sequence selected from the group consisting of SEQ ID NO: 181, 188, 195, 202, 209, 216, 223, 230, 237, and 244 according to Abm definition, and SEQ ID NOs: 251, 258, 265, 272, 279, 286, 293, 300, 307, and 314 according to Kabat definition, in which(I) any amino acid substitution is a conservative amino acid substitution; and / or (2) said amino acid sequence only contains amino acids substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 181, 188, 195, 202, 209, 216, 223, 230, 237, and 244 according to Abm definition, and SEQ ID NOs: 251, 258, 265, 272, 279, 286, 293, 300, 307, and 314 according to Kabat definition; and / or amino acids sequences that have 2 or only 1 amino acid difference(s) with a sequence selected from the group consisting of SEQ ID NO: 181, 188, 195, 202, 209, 216, 223, 230, 237, and 244 according to Abm definition, and SEQ ID NOs: 251, 258, 265, 272, 279, 286, 293, 300, 307, and 314 according to Kabat definition, in which any amino acid substitution is a conservative amino acid substitution; and / or said amino acid sequence only contains amino acid substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 181, 188, 195, 202, 209, 216, 223, 230, 237, and 244 according to Abm definition, and SEQ ID NOs: 251, 258, 265, 272, 279, 286, 293, 300, 307, and 314 according to Kabat definition.(II) CDR2 comprises or essentially consists of an amino acid sequence comprising a sequence selected from the group consisting of SEQ ID NO: 183, 190, 197, 204, 211, 218, 225, 232, 239 and 246 according to Abm definition, and SEQ ID NOs: 253, 260, 267, 274, 281, 288, 295, 302, 309 and 316 according to Kabat definition, or amino acid sequences that have at least 80%, at least 90%, at least 95%, at least 99% or more sequence identity with a sequence selected from the group consisting of SEQ ID NO: 183, 190, 197, 204, 211, 218, 225, 232, 239 and 246 according to Abm definition, and SEQ ID NOs: 253, 260, 267, 274, 281, 288, 295, 302, 309 and 316 according to Kabat definition in which (1) anyamino acid substitution is a conservative amino acid substitution; and / or (2) said amino acid sequence only contains amino acids substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 183, 190, 197, 204, 211, 218, 225, 232, 239 and 246 according to Abm definition, and SEQ ID NOs: 253, 260, 267, 274, 281, 288, 295, 302, 309 and 316 according to Kabat definition; and / or amino acids sequences that have 2 or only 1 amino acid difference(s) with a sequence selected from the group consisting of SEQ ID NO: 183, 190, 197, 204, 211, 218, 225, 232, 239 and 246 according to Abm definition, and SEQ ID NOs: 253, 260, 267, 274, 281, 288, 295, 302, 309 and 316 according to Kabat definition in which any amino acid substitution is a conservative amino acid substitution; and / or said amino acid sequence only contains amino acid substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 183, 190, 197, 204, 211, 218, 225, 232, 239 and 246 according to Abm definition and SEQ ID NOs: 253, 260, 267, 274, 281, 288, 295, 302, 309 and 316 according to Kabat definition.(Ill) CDR3 comprises or essentially consists of an amino acid sequence comprising a sequence selected from the group consisting of SEQ ID NO: 185, 192, 199, 206, 213, 220, 227, 234, 241 and 248 according to Abm definition, and SEQ ID NOs: 255, 262, 269, 276, 283, 290, 297, 304, 311 and 318 according to Kabat definition, or amino acid sequences that have at least 80%, at least 90%, at least 95%, at least 99% or more sequence identity with a sequence selected from the group consisting of SEQ ID NO: 185, 192, 199, 206, 213, 220, 227, 234, 241 and 248 according to Abm definition and SEQ ID NOs: 255, 262, 269, 276, 283, 290, 297, 304, 311 and 318 according to Kabat definition, in which (1) any amino acid substitution is a conservative amino acid substitution; and / or (2) said amino acid sequence only contains amino acids substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 185, 192, 199, 206, 213, 220, 227, 234, 241 and 248 according to Abm definition and SEQ ID NOs: 255, 262, 269, 276, 283, 290, 297, 304, 311 and 318 according to Kabat definition; and / or from the group consisting of amino acids sequences that have 2 or only 1 amino acid difference(s) with a sequence selected from the group consisting of SEQ ID NO: 185, 192, 199,206, 213, 220, 227, 234, 241 and 248 according to Abm definition and SEQ ID NOs: 255, 262,269, 276, 283, 290, 297, 304, 311 and 318 according to Kabat definition, in which any amino acid substitution is a conservative amino acid substitution; and / or said amino acid sequence only contains amino acid substitutions, and no amino acid deletions or insertions, compared to a sequence selected from the group consisting of SEQ ID NO: 185, 192, 199, 206, 213, 220, 227, 234, 241 and 248 according to Abm definition and SEQ ID NOs: 4 255, 262, 269, 276, 283, 290, 297, 304, 311 and 318 according to Kabat definition.
[0590] In one embodiment, the ISVD comprises a CDR1 that is the amino acid sequence of SEQ ID NO: 244, a CDR2 that is the amino acid sequence of SEQ ID NO: 246 and a CDR3 that is the amino acid sequence of SEQ ID NO: 248 (according to Abm definition) or that comprises a CDR1 that is the amino acid sequence of SEQ ID NO: 314, a CDR2 that is the amino acid sequence of SEQ ID NO: 316 and a CDR3 that is the amino acid sequence of SEQ ID NO: 318 (according to Kabat definition).
[0591] CD8 binding ISVDs as disclosed herein may comprise one, two or all three of the CDRs explicitly listed above. In some embodiments, the anti-CD8a ISVD is selected from the ISVDs described in the tables below. In some embodiments, the anti-CD8aISVD is selected from the ISVDs that have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the ISVDs described Table C-l, Table C-2, and Table C-3. In some embodiments, the anti-CD8 ISVD is selected from the ISVDs that have at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% sequence identity with the ISVDs described in Table C-4.Table C-l. Anti-CD8a ISVDsTable C-2. Anti-CD8a ISVD full sequencesTable C-3. anti-CD8a ISVD CDRs
[0592] In one embodiment, the ISVD comprises a CDR1 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 181, a CDR2 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 183, and a CDR3 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 185.
[0593] In one embodiment, the ISVD comprises a CDR1 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 188, a CDR2 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 190, and a CDR3 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 192.
[0594] In one embodiment, the ISVD comprises a CDR1 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 195, a CDR2 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 197, and a CDR3 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 199.
[0595] In one embodiment, the ISVD comprises a CDR1 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 202, a CDR2 (according to AbM definition) that is the amino acid sequence of SEQ ID NO: 204, and a CDR3 (according to AbM definition) that is the amino acid seque...
Claims
1. CLAIMSWhat is claimed is:
1. A lipid nanoparticle (LNP) comprising:(a) a lipid-immune cell targeting group conjugate comprising the compound of Formula (II): [Lipid] - [optional linker] - [antibody],(b) an ionizable cationic lipid, and(c) a nucleic acid, wherein the nucleic acid is encapsulated in the LNP; wherein(i) the antibody is an immunoglobulin single variable domain (ISVD) that specifically binds to human CD8alpha, comprising complementaritydetermining regions 1 (CDR1), 2 (CDR2), and 3 (CDR3) of an ISVD having the sequence selected from the group consisting of SEQ ID NOs: 160 to 179, or(ii) the antibody is an ISVD that specifically binds to human CD8alpha, and the nucleic acid encodes a polypeptide comprising CD22-chimeric antigen receptor (CAR), or both (i) and (ii).
2. The LNP of claim 1, wherein the ISVD specifically binding to CD8alpha comprises CDR1, CDR2, and CDR3 according to the Abm CDR definition,(a) wherein CDR1 is selected from the group consisting of:(i) SEQ ID NO: 244; and(ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 244;(b) wherein CDR2 is selected from the group consisting of:(i) SEQ ID NO: 246; and(ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 246; and(c) wherein CDR3 is selected from the group consisting of:(i) SEQ ID NO: 248; and(ii) amino acid sequences that have 3, 2, or 1 amino acid difference with at least one of the amino acid sequences of SEQ ID NO: 248.
3. The LNP of claim 1 or claim 2, wherein the antibody specifically binding to humanCD8alpha is covalently coupled to the Lipid in Formula (II) via a linker comprising polyethylene glycol (PEG); and wherein the Lipid in Formula (II) covalently coupled to the antibody is di stearoylglycerol (DSG), distearoyl-phosphatidylethanolamine (DSPE), dimyrstoyl-phosphatidylethanolamine (DMPE), di stearoyl -glycero-phosphoglycerol(DSPG), dimyristoyl-glycerol (DMG), dipalmitoyl-phosphatidylethanolamine (DPPE), dipalmitoyl-glycerol (DPG), or ceramide.
4. The LNP of claim 3, wherein the Lipid in Formula (II) covalently coupled to the antibody is DSPE; and wherein the PEG is PEG 3400 (PEG 3.4K).
5. The LNP of any one of claims 1 to 4, wherein the immunoglobulin single variable domain comprises SEQ ID NO: 9, SEQ ID NO: 169, or SEQ ID NO: 44.
6. The LNP of any one of claims 1 to 5, wherein the LNP further comprises a structural lipid, a neutral phospholipid, or a free PEG-lipid, or any combination thereof, wherein: (1) the structural lipid comprises or is sterol; (2) the neutral phospholipid is selected from the group consisting of phosphatidylcholine, phosphatidylethanolamine, di stearoyl -sn-glycero-3- phosphoethanolamine (DSPE), l,2-distearoyl-sn-glycero-3-phosphocholine (DSPC), 1,2- dioleoyl-sn-glycero-3-phosphoethanolamine (DOPE), l,2-dioleoyl-sn-glycero-3- phosphocholine (DOPC), and sphingomyelin; and (3) the free PEG lipid is PEG- dioleoylgylcerol (PEG-DOG), PEG-dimyristoyl-glycerol (PEG-DMG), PEG-dipalmitoyl- glycerol (PEG-DPG), PEG-dilinoleoyl-glycero-phosphatidyl ethanolamine (PEG-DLPE), PEG-dimyrstoyl-phosphatidylethanolamine (PEG-DMPE), PEG-dipalmitoyl- phosphatidylethanolamine (PEG-DPPE), PEG-di stearoylglycerol (PEG-DSG), PEG- diacylglycerol (PEG-DAG), PEG-ceramide, PEG-distearoyl-glycero-phosphoglycerol (PEG-DSPG), PEG-dioleoyl-glycero-phosphoethanolamine (PEG-DOPE), 2- [(polyethylene glycol)-2000]-N,N-ditetradecylacetamide, diacylphosphatidylethanolamine comprising Dipalmitoyl (Cl 6) chain or Distearoyl (Cl 8) chain, or a PEG-distearoyl- phosphatidylethanolamine (PEG-DSPE) lipid.
7. The LNP of claim 6, wherein (1) the structural lipid comprises cholesterol; (2) the neutral phospholipid comprises DSPC; and (3) the free PEG lipid comprises PEG 2000-DPG (DPG-PEG 2000).
8. The LNP of any one of claims 1 to 7, wherein the nucleic acid comprises mRNA, wherein the mRNA encodes a synthetic T cell receptor (synTCR) or a Chimeric Antigen Receptor (CAR).
9. The LNP of claim 8, wherein the mRNA comprises a 5’ Cap, a 5’ untranslated region (UTR), a sequence encoding a polypeptide, a 3’ UTR, and optionally a polyA tail, wherein the polypeptide encoded by the nucleic acid comprises an antibody specifically binding to B-cell, a Hinge domain and a Transmembrane domain (Hinge and Transmembrane domains), a Co-stimulatory domain, and a Signaling domain in the following formula, arranged from N-terminus to C-terminus: [Lead peptide sequence (optional)] - [antibody specifically binding to B-cell] - [Linker B (optional)] - [Hinge domain] - [Transmembrane domain] - [Co-stimulatory domain] - [Signaling domain],10. The LNP of claim 9, wherein the optional Lead peptide sequence comprises a signal peptide, wherein (1) the signal peptide is derived from CD8 (SEQ ID NO: 565); or (2) the signal peptide comprises SEQ ID NO: 515 or SEQ ID NO: 520, or a sequence having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or higher identity to SEQ ID NO: 515 or SEQ ID NO: 520.
11. The LNP of claim 9 or 10, wherein the antibody specifically binding to B-cell comprises the following formula: [antibody specifically binding to B-cell, heavy chain variable region (VH)] - [Linker A (optional)] - [antibody specifically binding to B-cell, light chain variable region (VL)], wherein the antibody specifically binding to B-cell is an antibody that specifically binds to human CD22.
12. The LNP of claim 9 or 10, wherein the antibody specifically binding to B-cell comprises an anti-CD22 ScFv, wherein the anti-CD22 ScFV comprises a heavy chain variable (VH) domain and an antibody light chain variable (VL) domain, wherein the VH and VL domains comprise:(1) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 433 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 434;(2) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 447and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 448;(3) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 457 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 458;(4) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 481 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 482;(5) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 495 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 496;(6) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 509 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 510;(7) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 523 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 524;(8) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 525 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 526;(9) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 527 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 528;(10) a complementarity determining region- 1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 529 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 530; or(11) a complementarity determining region-1 (CDR1), a CDR2, and a CDR3 of a heavy chain variable region (VH) comprising the amino acid sequence of SEQ ID NO: 531 and a CDR1, CDR2, and a CDR3 of a light chain variable region (VL) comprising the amino acid sequence of SEQ ID NO: 532.
13. The LNP of claim 12, wherein:(1) the VH domain of the anti-CD22 ScFV comprises a CDR-H1 sequence comprising the amino acid sequence of SYGMH (SEQ ID NO: 427), a CDR-H2 sequence comprising the amino acid sequence of IIYYDGSKKYYADSVKG (SEQ ID NO: 428), and a CDR-H3 sequence comprising the amino acid sequence of ELTGDAFDI (SEQ ID NO: 429); and wherein the VL domain of the anti-CD22 ScFV comprises a CDR-L1 sequence comprising the amino acid sequence of RASQSIGSSLH (SEQ ID NO: 430), a CDR-L2 sequence comprising the amino acid sequence of YASQSFS (SEQ ID NO:431), and a CDR-L3 sequence comprising the amino acid sequence of HQSSTLPYT (SEQ ID NO: 432); or(2) the anti-CD22 ScFV comprises a VH domain comprising SEQ ID NO: 523, and a VL domain comprising SEQ ID NO: 524;and the VH domain and the VL domain is connected through Linker A, wherein the Linker A is selected from the group consisting of SEQ ID Nos 337-348; or both (1) and (2).
14. The LNP of any one of claims 9 to 13, wherein the Linker A is (GGGGS)4 (SEQ ID NO: 344); and the Linker B is AS or AAA.
15. The LNP of any one of claims 9 to 14, wherein the hinge and transmembrane domains are derived from CD8 or CD28 hinge and transmembrane domains; the Co-stimulatory domain is a CD28 Co-stimulatory domain; and the Signaling domain is derived from a CD3z signaling domain.
16. The LNP of claim 15, wherein (1) the hinge and transmembrane domains comprise SEQ ID NO: 538, SEQ ID NO: 539, or SEQ ID NO: 540, or the hinge and transmembrane domains are derived from CD28 hinge and transmembrane domains wherein the CD28 hinge and transmembrane domains have the amino acid sequence selected from the group consisting of (i) SEQ ID NO: 522; (ii) sequences having at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% or higher identity with SEQ ID NO: 522; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 522; (2) the CD28 Co-stimulatory domain comprises SEQ ID NO: 543; and (3) the Signaling domain has the amino acid sequence selected from the group consisting of (i) sequence of SEQ ID NO: 544; (ii) sequences that have at least 80% sequence identity with SEQ ID NO: 544; and (iii) sequences that have 3, 2, or 1 amino acid difference with SEQ ID NO: 544.
17. The LNP of any one of claims 1 to 16, wherein (1) the polypeptide encoded by the nucleic acid comprises or consists of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127; (2) the nucleic acid sequence encoding a polypeptide comprises a sequence encoding the polypeptide of SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127; (3) the nucleic acid sequence comprises SEQ ID NO: 108, SEQ ID NO: 124, or SEQ ID NO: 125; or (4) the nucleic acid sequence comprises SEQ ID NO: 139 or SEQ ID NO: 147; or any combination of (1) to (4).
18. The LNP of any one of claims 1 to 17, wherein the nucleic acid comprises pseudouridine, wherein the pseudouridine is N1 -methyl -pseudouridine.
19. The LNP of any one of claims 1 to 18, wherein the ionizable cationic lipid comprises a compound of Formula (I):or a salt thereof, or both, wherein:R1, R2, and R3are each independently a bond or C1-3 alkylene;R1A, R2A, and R3Aare each independently a bond or C1-10 alkylene;R1A1, R1A2, R1A3, R2A1, R2A2, R2A3, R3A1, R3A2, and R3A3are each independently H, Ci- 20 alkyl, C1-20 alkenyl, -(CH2)o-ioC(0)ORal, or -(CH2)o-ioOC(0)Ra2;Raland Ra2are each independently C1-20 alkyl or C1-20 alkenyl;R3B1is C1-6 alkylene; andR3B2and R3B3are each independently H, unsubstituted C1-6 alkyl, or C1-6 alkyl substituted with 1 or 2 -OH.
20. The LNP of any one of claims 1 to 18, wherein:R1, R2, and R3are each independently a bond or methylene; R1Aand R2Aare each Cnio alkylene;R3Ais C1-5 alkylene;R1A1, R1A2, R2A1, R2A2, R3A1, and R3A2are each H;R1A3and R2A3are each C1-20 alkenyl;R3A3is -C(0)0(Ci-2o alkyl);R3B1is C2-4 alkylene; and R3B2and R3B3are each methyl.
21. The LNP of any one of claims 1 to 18, wherein the ionizable cationic lipid comprisessalt thereof, or both.
22. A lipid nanoparticle (LNP) comprising:(a) a cationic lipid that is Lipid 15,salt thereof;(b) cholesterol;(c) l,2-distearoyl-sn-glycero-3-phosphocholine (DSPC);(d) PEG 2000-dipalmitoyl -glycerol (DPG-PEG2K);(e) an mRNA comprising a nucleic acid sequence encoding a polypeptide comprising SEQ ID NO: 116, SEQ ID NO: 126, or SEQ ID NO: 127; and(f) a DSPE-PEG3.4K-antibody conjugate, wherein the antibody comprises amino acid sequence of SEQ ID NO: 9, SEQ ID NO: 169, or SEQ ID NO: 44.
23. The LNP of any one of claims 7 to 22, wherein the LNP comprises cationic lipid at a concentration between about 10 mol% and about 60 mol% of the LNP; cholesterol at a concentration between about 25 mol% and about 45 mol% of the LNP; DSPC at a concentration between about 5 mol% and about 25% mol% of the LNP; and DPG-PEG2K at a concentration between about 0.5 mol% and about 2.5 mol% of the LNP.
24. The LNP of any one of claims 7 to 22, wherein the LNP comprises cationic lipid at a concentration between about 49 mol% and about 50 mol% of the LNP; cholesterol at a concentration between about 25 mol% and about 30 mol% of the LNP; DSPC at a concentration between about 9 mol% and about 21 mol% of the LNP; and DPG-PEG2K at a concentration between about 1.4 mol% and about 1.6 mol% of the LNP.
25. The LNP of any one of claims 7 to 22, wherein the LNP comprises cationic lipid at a concentration between about 10 and about 20 g per gram of mRNA in the LNP; cholesterol at a concentration between about 3.0 and about 5.0 g per gram of mRNA in the LNP; DSPC at a concentration between about 2.0 and about 5.0 g per gram of mRNA in the LNP; DPG-PEG2K at a concentration between about 1.0 and about 1.5 g per gram of mRNA in the LNP; and DSPE-PEG3.4K-antibody conjugate at a concentration between about 0.05 to 0.1 g per gram of mRNA in the LNP.
26. The LNP of any one of claims 7 to 22, wherein (1) the cationic lipid has a concentration about 49.2 mol% of the LNP; the cholesterol has a concentration about 39.4 mol% of the LNP; the DSPC has a concentration about 9.8 mol% of the LNP; and the DPG-PEG2K has a concentration about 1.5 mol% of the LNP; or (2) the cationic lipid has a concentration about 14.2 g / g mRNA in the LNP; the cholesterol has a concentration about 4.64 g / g mRNA in the LNP; the DSPC has a concentration about 2.37 g / g mRNA in the LNP; the DPG- PEG2K has a concentration about 1.15 g / g mRNA in the LNP; and the DSPE-PEG3.4K- anti-CD8 antibody conjugate has a concentration about 0.084 g / g to 0.15 g / g mRNA in the LNP; or both (1) and (2).
27. The LNP of any one of claims 7 to 22, wherein (1) the cationic lipid has a concentration about 49.2 mol% of the LNP; the cholesterol has a concentration about 29.3 mol% of the LNP; the DSPC has a concentration about 20.0 mol% of the LNP; and the DPG-PEG2K has a concentration about 1.5 mol% of the LNP; or (2) the cationic lipid has a concentration about 14.2 g / g mRNA in the LNP; the cholesterol has a concentration about 3.45 g / g mRNA in the LNP; the DSPC has a concentration about 4.84 g / g mRNA in the LNP; the DPG- PEG2K has a concentration about 1.15 g / g mRNA in the LNP; and the DSPE-PEG3.4K- anti-CD8 antibody conjugate has a concentration about 0.084 g / g to 0.15 g / g mRNA in the LNP; or both (1) and (2).
28. An isolated polynucleotide that has the following formula, arranged from 5’ to 3’:5 ’Cap (optional) - 5’ UTR (optional) - nucleotides encoding a Lead peptide sequence (optional) - nucleotides encoding an antibody heavy chain variable region (VH) - nucleotides encoding a Linker A (optional) - nucleotides encoding an antibody light chain variable region (VL) - nucleotides encoding Linker B (optional) - nucleotides encoding a Hinge - nucleotides encoding a Transmembrane domain - nucleotides encoding Costimulatory domain - nucleotides encoding Signaling domain - 3’ UTR (optional) - poly A tail (optional), wherein the VH and VL form a binding domain that specifically binds to human B-cell.
29. An expression construct comprising a polynucleotide of claim 28.
30. A vector, comprising the expression construction of claim 29.
31. A host cell comprising the expression construct of claim 29.
32. An in vitro transcribed mRNA derived from the isolated polynucleotide of claim 28.
33. An immune cell comprising the in vitro transcribed mRNA of claim 32.
34. A recombinant polypeptide encoded by the isolated polynucleotide of claim 28.
35. An immune cell expressing the recombinant polypeptide of claim 34.
36. A method of producing a polypeptide of interest in a cell, tissue or bodily fluid of a subject, the method comprising using the isolated polynucleotide of claim 28.
37. A method of preparing a LNP, comprising combining the isolated polynucleotide of claim 28 with mixture of lipids.
38. A pharmaceutical composition, comprising a LNP of any one of claims 1 to 27, the isolated polynucleotide of any one of claim 28, the expression construct of claim 29, the vector of claim 30, the host cell of claim 31, and / or the recombinant polypeptide of claim 34.
39. A method of delivering a nucleic acid sequence into a human cell, comprising using the LNP of any one of claims 1 to 27, wherein the LNP comprises the nucleic acid sequence to be delivered.
40. A method of modulating immune response in a human subject, comprising administering the LNP of any one of claims 1 to 27, the isolated polynucleotide of claim 28, the expression construct of claim 29, the vector of claim 30, and / or the host cell of claim 31 to the human subject, and / or expressing the recombinant polypeptide of claim 34 in the human subject.
41. A method of treating B-cell malignancy in a human subject comprising administering the LNP of any one of claims 1 to 27, the isolated polynucleotide of claim 28, the expression construct of claim 29, the vector of claim 30, and / or the host cell of claim 31 to the human subject, and / or expressing the recombinant polypeptide of claim 34 in the human subject.
42. Use of the LNP of any one of claims 1 to 27, the isolated polynucleotide of claim 28, the expression construct of claim 29, the vector of claim 30, the host cell of claim 31, and / or the pharmaceutical composition of claim 38 for the manufacture of a medicament for the treatment of a B-cell malignancy.
43. Use of the LNP of any one of claims 1 to 27 for the manufacture of a medicament for delivering a nucleic acid to a target cell.
44. An immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO: 244; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 244; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 244; andCDR2 (according to AbM definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 246; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 246; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 246; andCDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 248; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 248; and i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 248.
45. An immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to Kabat definition) has an amino acid sequence selected from the group consisting of a) the amino acid sequence of SEQ ID NO: 314; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 314; and c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 314; andCDR2 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 316; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 316; and f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 316; andCDR3 (according to Kabat definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 318; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 318; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 318.
46. A polypeptide or construct that comprises or essentially consists of one or more ISVDs according to any one of claims 44 to 45, and optionally further comprises one or more other groups, residues, moieties or binding units, optionally linked via one or more linkers.
47. A nucleic acid that encodes an ISVD according to claim 44 or claim 45, or a polypeptide according to claim 46.
48. A non-human host or host cell that expresses, or that under suitable circumstances is capable of expressing, an ISVD according to claim 44 or claim 45, or a polypeptide according to claim 46; and / or that comprises the nucleic acid according to claim 47.
49. A method for producing an ISVD according to claim 44 or claim 45, or a polypeptide according to claim 46, the method comprising: a) expressing, in a suitable non-human host cell or host organism or in another suitable expression system, a nucleic acid according to claim 47; optionally followed by: b) isolating and / or purifying the ISVD according to claim 44 or claim 45, or the polypeptide according to claim 46.
50. A method for producing an ISVD according to claim 44 or claim 45, or a polypeptide according to claim 46, said method comprising: a) cultivating and / or maintaining a non-human host or host cell according to claim 48 under conditions that are such that said non-human host or host cell expresses and / or produces at least one ISVD according to claim 44 or claim 45, or at least one polypeptide according to claim 46; optionally followed by: b) isolating and / or purifying the ISVD according to claim 44 or claim 45, or polypeptide according to claim 46.
51. A composition comprising at least one ISVD according to claim 44 or claim 45, at least one polypeptide or construct according to claim 46, or at least one nucleic acid according to claim 47, or any combination thereof.
52. A method for the diagnosis, prevention and / or treatment of at least one disease and / or disorder, comprising the administration, to a subject, of an ISVD according to claim 44 or claim 45, a polypeptide or construct according to claim 46, or a composition according to claim 51.
53. An immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to AbM definition) has an amino acid sequence selected from the group consisting of: a) the amino acid sequence of SEQ ID NO. 181 or 188; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 181 or 188; andc) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 181 or 188; andCDR2 (according to AbM definitiong) has an amino acid sequence selected from the group consisting of: d) the amino acid sequence of SEQ ID NO: 183 or 190; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 183 or 190; f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 183 or 190; andCDR3 (according to AbM definition) has an amino acid sequence selected from the group consisting of: g) the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 185, 192, 199 or 206.
54. An immunoglobulin single variable domain (ISVD) specifically binding human CD8alpha, that essentially consists of 4 framework regions (FR1 to FR4, respectively) and 3 complementarity determining regions (CDR1 to CDR3, respectively), in which:CDR1 (according to Kabat definition) has an amino acid sequence selected from: a) the amino acid sequence of SEQ ID NO: 251 ; b) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 251; c) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequences of SEQ ID NO: 251; andCDR2 (according to Kabat definition) has an amino acid sequence selected from: d) the amino acid sequence of SEQ ID NO: 253 or 260; e) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 253 or 260;f) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 253 or 260; andCDR3 (according to Kabat definition) has an amino acid sequence selected from: g) the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276; h) amino acid sequences that have at least 80% amino acid identity with the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276; i) amino acid sequences that have 3, 2, or 1 amino acid difference with the amino acid sequence of SEQ ID NO: 255, 262, 269, or 276.
55. A conjugate comprising an ISVD according to any one of claims 44, 45, 53, and 54 linked to a phospholipid-PEG-maleimide derivative.
56. A method for the preparation of a composition comprising monomers of an ISVD with a cysteine containing linker at its C-terminal end, the method comprising the following sequential steps:(a) reducing a composition comprising ISVD dimers to ISVD monomers with a first reducing agent, wherein the ISVD dimers are formed through the cysteine containing linker at the C-terminal end of the ISVD;(b) purifying the ISVD monomers obtained in step (a) to get a purified composition comprising the ISVD monomers;(c) reducing the purified composition obtained in step (b) with a second reducing agent; and(d) purifying the reduced composition obtained in step (c) to obtain a composition comprising monomers of the ISVD.
57. A method for the preparation of a phospholipid-PEG-ISVD conjugate comprising the following sequential steps:(a) mixing a first composition comprising monomers of an ISVD comprising a cysteine containing linker, with a second composition comprising phospholipid-PEG molecules comprising a bioconjugation linker under conditions that the phospholipid-PEG molecules and the ISVD monomers can form a conjugate through clicking chemistry; and(b) adding cysteine to the conjugate obtained in step (a) under conditions that the conjugation reaction is quenched,wherein a composition comprising the phospholipid-PEG ISVD conjugate is obtained.
58. A phospholipid-PEG-ISVD conjugate produced by the method of claim 57.
59. A composition comprising a phospholipid-PEG-ISVD conjugate produced by the method of claim 57.
60. A method of producing a composition comprising lipid nanoparticles (LNPs), wherein the LNPs comprising:(a) a lipid-immune cell targeting group conjugate comprising the compound of Formula (II): [Lipid] - [optional linker] - [antibody],(b) an ionizable cationic lipid,(c) a nucleic acid, wherein the nucleic acid is encapsulated in the LNP,(d) a structural lipid (e.g., a sterol),(e) a neutral phospholipid, and(f) a free PEG-lipid, wherein the method comprises:(i) producing a first composition comprising the lipid-immune cell targeting group conjugate in (a);(ii) producing a second composition comprising (b) to (f);(iii) incubating the first composition obtained from step (i) and the second composition obtained from step (ii), to produce the final composition comprising the LNPs.
61. A composition produced by a method of claim 60.
Citation Information
Patent Citations
Delivery of exogenous DNA sequences in a mammal
US5580859A
Solid golf ball
US5589546A
Immunoglobulins devoid of light chains
WO1994004678A1
Plasmids suitable for gene therapy
WO1994029469A2
Variable fragments of immunoglobulins - use for therapeutic or veterinary purposes
WO1996034103A1