Recombinant collagen with high expression quantity

Abstract

The invention relates to a recombinant collagen with high expression quantity. The amino acid sequence of the recombinant collagen is

Description

Technical Field

[0001] The present invention relates to the field of biomaterials, and in particular to a high-expression recombinant collagen. Background Art

[0002] Collagen is one of the most abundant proteins in the human body. It is needed in various parts of the body, such as around the eyes, mouth, armpits, arms, abdomen, etc. It is responsible for maintaining the stability and strength of body tissues by forming a support network on the cell structure. Due to the advantages of collagen, the market size of recombinant collagen products in food functional health products, skin care products, medical devices, especially medical dressings, is gradually growing.

[0003] Currently, most collagen on the market is extracted from animal sources, but the extraction method has potential risks of viruses and allergies, and the post-processing process is cumbersome. Collagen is difficult to express in prokaryotes and eukaryotes, and the expression yield is low.

[0004] It should be noted that the information disclosed in the above background technology section is only used to enhance the understanding of the background of the present disclosure, and therefore may include information that does not constitute the prior art known to ordinary technicians in the field. Summary of the invention

[0005] In view of the deficiencies of the prior art, the present invention discloses a recombinant collagen with high expression level.

[0006] The technical solution adopted by the present invention is as follows:

[0007] A high expression level recombinant collagen protein, the amino acid sequence of the high expression level recombinant collagen protein is shown as SEQ ID NO 1.

[0008] Furthermore, the expression yield is ≥2.5 g / L.

[0009] The beneficial effects of the present invention are as follows:

[0010] 1. No need to extract from animal sources, avoiding the problem of difficult expression and low expression yield of collagen in prokaryotes and eukaryotes. The recombinant collagen has an amino acid sequence that is easy to express, which greatly increases the yield of recombinant expression.

[0011] 2. Collagen extracted from animals requires tedious processing, separation and methanol-induced expression treatment, which makes it difficult to ensure the single composition of collagen and easily affects the expression of collagen. However, this recombinant collagen ensures a single composition and avoids the problem of expression being affected by processing methods.

[0012] 3. Avoid the hidden dangers of viruses and allergies extracted from animal sources. BRIEF DESCRIPTION OF THE DRAWINGS

[0013] Figure 1 It is the secretory expression effect of high-expression recombinant collagen.

[0014] Figure 2 The figure is a control bar graph for the secretion expression of recombinant collagen. DETAILED DESCRIPTION

[0015] The specific implementation of the present invention will be described below in conjunction with the accompanying drawings.

[0016] Embodiment 1:

[0017] A high expression level recombinant collagen protein, the amino acid sequence of the high expression level recombinant collagen protein is shown as SEQ ID NO 1.

[0018] Specific amino acid sequence:

[0019] gsagalgpqgppgapgvrgfqgqkgsmgdpglpgpqglrgdvgdrgpggaagpkgdqgiagsdglpgdkgelgpsglvgpkgesgsrgelgpkgtqgpngts gergapgnrgfpgsdglpgpkgaqgergpvgssgpkgsqgdpgrpgepglpgargltgnpgvqgpegklgplgapgedgrpgppgsigirgqpgsmglpgpk gppglpglpgfkgdkgvpgkpgregtegkkgeagppglpgppgiagpqgsqgergadgevgqkgdqghpgvpgfmgppgnpgppgadgiagaagppgiqgsp gapgipgqpglpgypgspgapggkgqpgdvgppgpagmkglpglpgrpgahgppglpgipgpfgddglpgppgpkgprglpgfpgfpgergkpgaegcpgak.

[0020] Embodiment 2:

[0021] Expression of high-level recombinant collagen.

[0022] (1) Preparation of chassis cells.

[0023] Platform ID: Bio-52827.

[0024] Specifications: Glycerol / culture.

[0025] Latin genus name: Corynebacterium Glutamicum.

[0026] Strain name: Corynebacterium glutamicum.

[0027] Other numbers: ACCC16522=ATCC13032.

[0028] Medium number: 2.

[0029] Cultivation temperature: 30℃.

[0030] Cultivation time: 24-48 hours.

[0031] Secretory expression effect:

[0032] like Figure 1 As shown in the middle band 3, the secretory expression yield of the sequence reached 2.5 g / L.

[0033] Comparison of collagen expression:

[0034] Control sequence: commercially available animal-derived collagen.

[0035] Experimental group: recombinant collagen was fermented three times.

[0036] The expression results are compared, such as Figure 2 As shown:

[0037] The unit yield of the control sequence is about 1 g / L, and that of the recombinant collagen sequence of the present application is about 2.5 g / L.

[0038] The technical features of the above-described embodiments may be arbitrarily combined. To make the description concise, not all possible combinations of the technical features in the above-described embodiments are described. However, as long as there is no contradiction in the combination of these technical features, they should be considered to be within the scope of this specification.

[0039] The above-mentioned embodiments only express several implementation methods of the present invention, and the descriptions thereof are relatively specific and detailed, but they cannot be understood as limiting the scope of the invention patent. It should be pointed out that, for ordinary technicians in this field, several variations and improvements can be made without departing from the concept of the present invention, and these all belong to the protection scope of the present invention. Therefore, the protection scope of the patent of the present invention shall be subject to the attached claims.

Claims

1. A high expression recombinant collagen, characterized in that: The amino acid sequence of the high expression level recombinant collagen is shown as SEQ ID NO 1.

2. The high expression recombinant collagen according to claim 1, characterized in that: The expression yield was ≥2.5g / L.

Images