Monomeric and dimeric fluorescent protein variants and methods for making same
a fluorescent protein and monomer technology, applied in the field of anthozoan fluorescent proteins, can solve the problems of dsred tetramerization being difficult in some cases to confirm whether, affecting the development of the protein, etc., and achieve the effect of improving fluoresence intensity or fluorescence maturation
Patent Information
- Authority / Receiving Office
- US · United States
- Patent Type
- Applications(United States)
- Current Assignee / Owner
- Publication Date
- 2006-01-05
- Estimated Expiration
- Not applicable · inactive patent
Smart Images

Figure 1 
Figure 2 
Figure 3
Abstract
Description
[0001] This application is a continuation-in-part application claiming priority under 35 U.S.C. § 120 to copending U.S. patent application Ser. No. 09 / 866,538, filed May 24, 2001, which is a continuation-in-part application claiming priority under 35 U.S.C. § 120 to copending U.S. patent application Ser. No. 09 / 794,308, filed Feb. 26, 2001, each of which are hereby incorporated by reference in their entirety.
[0002] This invention was made in part with Government support under Grant No. NS27177, awarded by the National Institute of Neurological Disorders and Stroke, and under Grant No. GM62114-01, awarded by the National Institute of General Medical Sciences. The Government may have certain rights in this invention.BACKGROUND OF THE INVENTION
[0003] 1. Field of the Invention
[0004] The present invention relates generally to variant fluorescent proteins, and more specifically to Anthozoan fluorescent proteins that have a reduced propensity to oligomerize, where such proteins form mono...
Examples
example 1
[0160] Construction of Dimeric and Monomeric Red Flourescent Proteins
Materials and Methods
DsRed Mutagenesis and Screening
[0161] The DsRed gene was amplified from vector pDsRed-N1 (CLONTECH, Palo Alto, Calif.) or the T1 variant (provided by B. S. Glick, University of Chicago) and subcloned into PRSETB (Invitrogen™; see Baird et al., Proc. Natl. Acad. Sci. USA 97:11984-11989 [2000]) (4). The PRSETB vector produces 6×His tagged fusion proteins, where an N-terminal polyhistidine tag having the following sequence is coupled to the suitably subcloned sequence.
MRGSHHHHHGMASMTGGQQMGRDLYDDDDKDP(SEQ ID NO: 22)
[0162] This resulting construct was used as the template for introduction of the I125R mutant using the QuikChange™ Site Directed Mutagenesis Kit (Stratagene®), according to the manufacturer's instructions. The complete DsRed wild-type cDNA and polypeptide sequences are provided in GenBank Accession Number AF168419. This nucleotide sequence is also provided in FIG. 16 and SEQ ID N...
example 2
[0215] Preparation And Characterization Of Fluorescent Protein Variants
[0216] This example demonstrates that mutations can be introduced into GFP spectral variants that reduce or eliminate the ability of the proteins to oligomerize.
[0217] ECFP (SEQ ID NO: 14) and EYFP-V68L / Q69K (SEQ ID NO: 12) at the dimer interface were subcloned into the bacterial expression vector PRSETB (Invitrogen Corp., La Jolla Calif.), creating an N-terminal His6 tag on the of ECFP (SEQ ID NO: 14) and EYFP-V68L / Q69K (SEQ ID NO: 12), which allowed purification of the bacterially expressed proteins on a nickel-agarose (Qiagen) affinity column. All dimer-related mutations in the cDNAs were created by site-directed mutagenesis using the QuickChange mutagenesis kit (Stratagene), then expressed and purified in the same manner. All cDNAs were sequenced to ensure that only the desired mutations existed.
[0218] EYFP-V68L / Q69K (SEQ ID NO: 12) was mutagenized using the QuickChange kit (Stratagene). The overlapping mu...
example 3
[0229] Characterization of the Coral Red Fluorescent Protein, DsRed, and Mutants Thereof
[0230] This example describes the initial biochemical and biological characterization of DsRed and DsRed mutants.
[0231] The coding sequence for DsRed was amplified from pDsRed-N1 (Clontech Laboratories) with PCR primers that added an N terminal BamHI recognition site upstream of the initiator Met codon and a C terminal Eco RI site downstream of the STOP codon. After restriction digestion, the PCR product was cloned between the Bam HI and Eco RI sites of PRSETB (Invitrogen), and the resulting vector was amplified in DH5α bacteria. The resulting plasmid was used as a template for error-prone PCR (Heim and Tsien, Curr. Biol. 6:178-182, 1996, which is incorporated herein by reference) using primers that were immediately upstream and downstream of the DsRed coding sequence, theoretically allowing mutation of every coding base, including the initiator Met. The mutagenized PCR fragment was digested wi...