Application of IDD gene and method for reinforcing phytoremediation of heavy metal contaminated soil based on IDD transgene

Abstract

The invention relates to the technical field of plant genetic engineering, in particular to application of an IDD gene and a method for reinforcing phytoremediation of heavy metal contaminated soil based on IDD transgene. The application of the IDD gene is to repair heavy metal contaminated soil, and the IDD gene comprises at least one of an IDD14 gene, an IDD15 gene and an IDD16 gene. The method for repairing the heavy metal contaminated soil comprises the step of planting the IDD transgenic strengthening plants on the heavy metal contaminated soil, wherein the IDD transgenic strengthening plants comprise at least one of an IDD14 transgenic plant, an IDD15 transgenic plant and an IDD16 transgenic plant. According to the invention, three gene modification technologies of IDD14, IDD15 and IDD16 are adopted, so that the tolerance and absorption capacity of plants to heavy metals are improved, and the effect of repairing soil by the plants is enhanced.

Description

Technical Field

[0001] The invention relates to the technical field of plant genetic engineering, and in particular to an application of an IDD gene and a method for repairing heavy metal-contaminated soil based on IDD transgenic enhanced plants. Background Art

[0002] Heavy metal pollution is one of the serious problems facing the current soil environment. Heavy metals (such as lead, cadmium, mercury, etc.) come from a variety of human activities, including mining, smelting, electroplating, chemical processing and other processes. These heavy metals are difficult to degrade and easy to accumulate. Their long-term accumulation in the soil has led to serious damage to the soil ecosystem and a reduction in biodiversity. Heavy metal pollution not only has a negative impact on the soil ecosystem, but also poses a serious threat to human health. These heavy metals accumulate step by step through the food chain, and accumulate in plants and animals to excessive levels, causing harm to human health, such as slow growth and development, impaired immune system, and even cancer. Therefore, controlling soil heavy metal pollution is crucial to maintaining ecological security and protecting human health.

[0003] Research on soil heavy metal pollution control technology at home and abroad can be divided into two categories: one is to stabilize heavy metals in the soil by changing their state of occurrence or the way they are combined with the soil, thereby reducing their activity and toxicity; the other is to remove heavy metals from the soil through various physical and chemical means to complete soil repair and purification. Among these technologies, bioremediation technology has attracted much attention, especially phytoremediation technology. Phytoremediation technology has the characteristics of low cost, environmental friendliness, and sustainability. Its principle is to utilize the absorption, transfer, fixation, and transformation of heavy metals by plants to remove heavy metals from the soil or reduce their toxicity. However, traditional phytoremediation technology has problems such as small biomass, shallow root system, and poor ecological adaptability, which limits its effectiveness in practical applications.

[0004] In recent years, genetically modified plants have become a new direction for the treatment of heavy metal pollution in soil. By introducing specific genes, the tolerance and accumulation capacity of plants to heavy metals can be improved, thereby enhancing the remediation efficiency. However, existing genetically modified plants usually only have a certain effect on single heavy metal pollutants (such as lead, cadmium, and mercury), and there is no mature technology for treating complex pollutants. At the same time, the requirements for the degree of soil pollution, uniformity, and permeability are also high, which limits the improvement of the treatment effect. Summary of the invention

[0005] In view of the poor treatment effect of the existing plant restoration technology, the present invention provides an application of IDD gene and a method for restoring heavy metal contaminated soil based on IDD transgenic enhanced plant. IDD14、IDD15 and IDD16Three genetic modification technologies have improved the plants' tolerance and absorption capacity to heavy metals and enhanced the effect of plants in restoring the soil.

[0006] In a first aspect, the present invention provides an application of an IDD gene in remediating heavy metal contaminated soil. The IDD gene comprises IDD14 Gene, IDD15 Genes and IDD16 At least one gene.

[0007] Further, IDD14 Gene, IDD15 Genes and / or IDD16 The genes are introduced into the cells, tissues or organs of the plants and cultured into plants, so that the IDD gene is overexpressed in the plants. IDD14 Transgenic plants, IDD15 Transgenic plants and / or IDD16 Transgenic plants.

[0008] Furthermore, the plant is selected from one of Arabidopsis thaliana, alfalfa, Solanum nigrum, Suaeda salsa and Kochia scoparia.

[0009] Furthermore, the nucleotide sequence of the IDD gene can be obtained by searching in databases such as NCBI according to the plant used.

[0010] In a second aspect, the present invention provides a method for repairing heavy metal contaminated soil based on IDD transgenic fortified plants, wherein IDD transgenic fortified plants are planted on heavy metal contaminated soil, and the IDD transgenic fortified plants include IDD14 Transgenic plants, IDD15 Transgenic plants, IDD16 At least one of the genetically modified plants; heavy metal contaminated soil contains at least one of cadmium pollution, lead pollution, mercury pollution, chromium pollution, nickel pollution, and copper pollution.

[0011] Furthermore, IDD14 The transgenic plants were able to remove cadmium and chromium pollutants from the soil; IDD15 The genetically modified plants can remove lead and nickel pollutants from the soil; IDD16 The genetically modified plants are able to remove mercury and copper pollutants from the soil.

[0012] Furthermore, according to the types of heavy metals in the heavy metal contaminated soil to be repaired, the IDD transgenic fortified plants for combined use are selected, and according to the content of heavy metals in the heavy metal contaminated soil to be repaired, the use amount of each IDD transgenic fortified plant is determined, for example, according to the content ratio of each heavy metal pollutant, the amount of each IDD transgenic fortified plant is set. 2 The number of IDD transgenic fortified plants planted, etc.

[0013] Several typical heavy metal contaminated soils and targeted phytoremediation solutions are shown in Table 1.

[0014] Table 1 Phytoremediation scheme

[0015] Furthermore, sowing seeds on the heavy metal contaminated soil to be repaired IDD14 Transgenic plants, IDD15 Transgenic plants and / or IDD16 Seeds of transgenic plants; preferably, sowed in the heavy metal contaminated soil to be repaired at a ratio of 5:2.5:2 IDD14 Transgenic plants, IDD15 Transgenic plants and IDD16 Seeds of transgenic plants.

[0016] Further, the method for obtaining seeds of IDD transgenic fortified plants is as follows: IDD14 Gene, IDD15 Gene, IDD16 The gene is inserted into the multiple cloning site of the plant expression vector pCAMBIA1300, the recombinant plasmid is electroporated into Agrobacterium, the plant seedlings are infected with Agrobacterium, the infected plant seedlings are cultured to maturity, the T1 generation seeds are collected, and the seeds are screened and purified with antibiotics to obtain the T2 generation seeds, that is, the seeds of the IDD transgenic fortified plants are obtained.

[0017] Furthermore, the planting density of IDD transgenic fortified plants is 300-500 plants / m 2 ; Preferably, the planting density is 400 plants / m 2 .

[0018] Furthermore, the plant is selected from at least one of Arabidopsis thaliana, alfalfa, Solanum nigrum, Suaeda salsa and Kochia scoparia.

[0019] The beneficial effects of the present invention are: (1) The present invention constructs a novel transcription factor subfamily based on the IDD transcription factor subfamily gene. IDD14 Genetically enhanced plants 、IDD15 Genetically modified plants and IDD16 Genetically modified plants can improve the efficiency of heavy metal remediation in soil.

[0020] (2) The IDD transgenic fortified plants constructed in the present invention have good adaptability to environmental stress, can cope with complex and diverse soil environments, and play a role in polluted soil environments.

[0021] (3) The method for remediating heavy metal contaminated soil based on IDD transgenic enhanced plants provided by the present invention can not only remediate a single heavy metal, but also achieve simultaneous and effective remediation of soil containing multiple heavy metal pollutants through the combined use of IDD transgenic enhanced plants.

[0022] (4) The method of the present invention can also ensure the biomass of the repaired plants, maintain a good growth state, enhance plant resistance, and achieve green reconstruction of the contaminated site while effectively repairing heavy metals.

[0023] (5) The method of the present invention avoids the use of chemical agents in the process of repairing heavy metal contaminated soil, is low-cost, and has strong operability, and achieves the greatest degree of repair effect without causing secondary damage to the environment. BRIEF DESCRIPTION OF THE DRAWINGS

[0024] In order to more clearly illustrate the embodiments of the present invention or the technical solutions in the prior art, the drawings required for use in the embodiments or the description of the prior art will be briefly introduced below. Obviously, for ordinary technicians in this field, other drawings can be obtained based on these drawings without paying any creative work.

[0025] Figure 1 This is a photograph of the IDD transgenic fortified plants in Example 2 grown in a heavy metal-free culture medium for 14 days.

[0026] Figure 2 These are photos of the IDD transgenic fortified plants in Example 2 grown in a heavy metal-containing culture medium for 14 days. DETAILED DESCRIPTION

[0027] In order to enable those skilled in the art to better understand the technical solutions in the present invention, the technical solutions in the embodiments of the present invention will be clearly and completely described below in conjunction with the drawings in the embodiments of the present invention. Obviously, the described embodiments are only part of the embodiments of the present invention, not all of the embodiments. Based on the embodiments of the present invention, all other embodiments obtained by ordinary technicians in this field without creative work should fall within the scope of protection of the present invention.

[0028] The specific embodiment of the present invention adopts Arabidopsis thaliana ( Arabidopsis thaliana) was used as a restoration plant for the experiment. Arabidopsis thaliana is a typical self-propagating plant. Arabidopsis thaliana grows in a wide geographical range, has a variety of species, grows fast, and has a short development cycle. It is not only conducive to the rapid realization of green restoration, but also very conducive to studying the ability of plants to cope with environmental stress. By studying the physiological and biochemical characteristics of different genotypes of IDD Arabidopsis thaliana, the growth and development characteristics of IDD14, IDD15 and IDD16 and their heavy metal enrichment characteristics were discovered. In other embodiments, alfalfa, Solanum nigrum, Suaeda salsa, Kochia scoparia, etc. can also be used as restoration plants.

[0029] The specific embodiments of the present invention are used IDD14、IDD15、IDD16 The nucleotide sequences of the genes are shown in Sequence 1, Sequence 2, and Sequence 3, respectively, and their corresponding protein coding sequences are shown in Sequence 4, Sequence 5, and Sequence 6, respectively.

[0030] Among them, sequence 1 is: Sequence 2 is: Sequence 3 is: Sequence 4 is as follows: MIDYERSNTTKNINTHHHNPPPSSSSSDLLPDGNGTAVTQKRKRRPAGTPDPEAEVVSLSPRTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRETNEEVRKRVYVCPEPTCLHHNPCHALGDLVGIKKHFRRKHSNHKQWICERCSKGYAVQSDYKAHLKTCGTRGHSCDCGRVFSRVESFIEHQDTCTVRRSQPSNHRLHEQQQHTTNATQTASTAENNENGDLSIGPILPGHPLQRRQSPPSEQQPSTLLYPFVTNGSIELQLLPSRNCADETSLSLSIGTMDQKTMSEVEKKSYEKGETSLEREEARRETKRQIEIAELEFAEAKRIRQHARAELHKAHLFREEASRRISATMMQITCHNCKQHFQAPAALVPPPPQTHCTDESTSLAVSYMSSATTEGEKASDRASS-; Sequence 5 is as follows: MRTDQVMLSNKNTNTCCVVSSSSSDPFLSSSENGVTTTNTSTQKRKRRPAGTPDPDAEVVSLSPRTLLESDRYICEICNQGFQRDQNLQMHRRRHKVPWKLLKRDNNIEVKKRVYVCPEPTCLHHNPCHALGDLVGIKKHFRRKHSNHKQWVCERCSKGYAVQSDYKAHLKTCGTRGHSCDCGFFSSFRVESFIEHQDNCSARRVHREPPRPPQTAVTVPACSSRTASTVSTPSSETNYGGTVAVTTPQPLEGRPIHQRISSSILTNSSNNLNLELQLLPLSSNQNPNQENQQQKVKEPSHHHNHNHDTTNLNLSIAPSSSYQHYNNFDRIKEIMASEQIMKIAMKEKAYAEEAKREAKRQREIAENEFANAKKIRQKAQAELERAKFLKEQSMKKISSTIMQVTCQTCKGQFQAVAVPAATADETSLVVSYMSSANTDGELENGF-; Sequence 6 is as follows: MIHYEQNNNLQNLPSSSSNDLLLGINGADATHKRKRRPAGTPDPDAEVVSLSPRTLLESDRYVCEICNQGFQRDQNLQMHRRRHKVPWKLLKRDKKDEEVRKRVYVCPEPTCLHHDPCHALGDLVGIKKHFRRKHSVHKQWVCERCSKGYAVQSDYKAHLKTCGSRGHSCDCGRVFSRVESFIEHQDTCTIRQ PQPTNHRHLQQHTMGLDAPSRTTSTASFGPLLHGLPLLRPPRPSNQHSPAFAYPFNASSAPFESLELQLSIGMARTSAQARHNEKRETSLTKERANEEARKAEETRQEAKRQIEMAEKDFEKAKRIREEAKTELEKAHVVREEAIKRINATMMEITCHSCKQLFQLPVTADESTSSLVMSYVSSATTEGECE-.

[0031] Example 1 Obtaining IDD transgenic fortified plants 1. Gene cloning and sequence verification: Arabidopsis thaliana IDD14、IDD15、IDD16 Gene protein coding sequence, design gene specific primers, use Arabidopsis Col wild-type plant cDNA as template for PCR amplification, and construct expression vector. The amplified PCR product is detected by agarose gel electrophoresis and is consistent with the target band size, indicating that the amplified product is obtained. And its accuracy and integrity are verified by sequencing, and the subsequent ligation reaction can be carried out.

[0032] 2. Plasmid construction: pCAMBIA1300 was selected as the expression vector, and the vector plasmid was double-digested with restriction endonucleases and cloned using HieffClone ® One-step rapid cloning technology homologous recombination IDD14 , IDD15 and IDD16 The gene sequences were inserted into the multiple cloning site of the pCAMBIA1301 vector to ensure the correct orientation and stable integration of the gene.

[0033] 3. Transformation into competent E. coli: The above-mentioned ligated recombinant product was added to the competent DH5α E. coli for transformation. Positive colonies were obtained through resistance screening (anti-kanamycin). The grown colonies were further verified by colony PCR, and the amplified products were detected by agarose gel electrophoresis. Colonies that met the target band size were screened for subsequent plasmid extraction and sent for sequencing.

[0034] 4. Agrobacterium-mediated genetic transformation: (1) Transformation of Agrobacterium by electroporation Transfer the correctly sequenced plasmid (about 2 μL) into 50 μL Agrobacterium competent cells in an ice bath, tap the tube wall to mix; pipette the solution into an electric shock cup, put it into an electroporator, and shock it once at 2500 V; take out the electric shock cup, aspirate the bacterial solution in an ultra-clean workbench and transfer it to a 1.5 mL centrifuge tube; add 800 μL YEP liquid culture medium, and culture the bacteria at 200 r / min in a 28°C shaker for 1.5 h; centrifuge at 5000 g for 3 min, discard the supernatant and resuspend the bacteria, spread it on a solid culture medium containing kanamycin and rifampicin resistance YEP, put it in a 28°C constant temperature incubator, and culture it upside down for two days.

[0035] (2) Infection of wild-type Arabidopsis plants Prepare 2-3 week-old wild-type Arabidopsis seedlings as transformation materials, cut off the fruit pods and opened flowers; pipette the Agrobacterium cultured on a 28°C shaker into a 50 mL sterile centrifuge tube in a clean bench; centrifuge at 5000 g and 28°C for 5 min; remove the supernatant, add 20 mL of infection solution, and suspend the precipitate by shaking; pour the mixed infection solution into a culture dish and infect the flowers; place the sample seedlings to be infected separately, soak them in nutrient solution, and cover them with bags and shade them for 24 h; repeat the infection after one week.

[0036] 5. Screening and isolation of transgenic plants: The transformed Arabidopsis thaliana is cultured in the culture room until it matures, and after collecting the T1 generation seeds, they are spread on a screening medium containing antibiotics to screen out transgenic plants with exogenous genes. The selected transgenic plants are transferred to a culture medium containing appropriate nutrients to promote their growth and development.

[0037] 6. Identification and verification of transgenic plants: After collecting T2 seeds, spread them on 1 / 2 MS solid culture medium. After vernalization, place them horizontally in a light incubator for about 5 days, and then move them to nutrient soil for further cultivation. DNA and RNA were extracted from leaves of Arabidopsis thaliana at about two weeks old. IDD14、IDD15 and IDD16 Gene-specific primers were used to identify homozygous transgenic lines and verify gene expression. IDD14 Genetically modified plants ( IDD14-OE ) seeds, IDD15 Genetically modified plants ( IDD15-OE ) seeds and IDD16 Genetically modified plants ( IDD16-OE ) seeds.

[0038] Example 2 IDD14-OE、IDD15-OE、IDD16-OE Laboratory experiments on the repair effect First, 1L of culture medium and 1L of 10mg / L cadmium chloride solution were mixed to prepare a heavy metal-containing culture medium, which was a mixture of nutrient soil and vermiculite in a ratio of 2:1. The prepared heavy metal-containing culture medium was filled into 12 Arabidopsis seedling pots, and the pots were evenly divided into 4 groups, and Arabidopsis wild-type plant seeds, the seeds obtained in Example 1, and the heavy metal-containing culture medium were sown respectively. IDD14- YOU Seeds, obtained in Example 1 IDD15-OE Seeds and Example 1 IDD16-OE The seeding density was 4 plants / pot; a heavy metal-free culture medium (i.e., a mixture of nutrient soil and vermiculite in a ratio of 2:1) was used as a control, and 12 Arabidopsis seedling pots were filled respectively. The pots were divided into 4 groups, and Arabidopsis wild-type plant (WT) seeds, the seeds obtained in Example 1, and the IDD14- YOU Seeds, obtained in Example 1 IDD15-OE Seeds and Example 1 IDD16-OE Seeds, sowing density is 4 plants / pot.

[0039] After 14 days, the growth of Arabidopsis in 24 Arabidopsis seedling pots was observed and photographed. Figure 1 , Figure 2 It can be seen that the IDD transgenic fortified plants can grow normally in the heavy metal-containing culture matrix, and the growth state of the plants is significantly better than that of the wild-type Arabidopsis grown in the heavy metal-containing culture matrix. The aboveground biomass is significantly increased compared with the wild-type Arabidopsis, and can basically reach a level close to that of Arabidopsis grown in the heavy metal-free culture matrix.

[0040] Example 3 IDD14-OE、IDD15-OE、IDD16-OE Repair of soil contaminated by cadmium, lead and mercury in agricultural areas The soil to be repaired is a soil restoration test field in a sewage irrigation area with cadmium pollution as the main pollution. The soil pH is about 6.2, which is slightly acidic. The effective cadmium content in the soil is 6.8 mg / kg, the effective mercury content is 5.2 mg / kg, and the effective lead content is 553 mg / kg. Referring to the risk control value standard stipulated in GB 15618-2018 "Soil Environmental Quality Agricultural Land Soil Pollution Risk Control Standard (Trial)", according to the Nemerow pollution index evaluation method, cadmium exceeds the standard by 3.4 times (severe pollution), mercury exceeds the standard by 2.1 times (moderate pollution), and lead exceeds the standard by 1.1 times (mild pollution).

[0041] The test field was divided into five areas. In the first area, the three transgenic Arabidopsis seeds obtained in Example 1 were mixed and sown. IDD14-OE : IDD15-OE : IDD16-OE =5:3:2; The seeds obtained in Example 1 were sown in the second region. IDD14-OE seed; The third area was sown with the seeds obtained in Example 1. IDD15-OE seed; The seeds obtained in Example 1 were sown in the fourth region. IDD16-OE seed; Sowing Arabidopsis wild-type plant seeds in the fifth area; The planting density in the five areas is controlled at 400 plants / m 2 .

[0042] After 30 days of in situ remediation, the aboveground biomass (fresh weight) and underground biomass (root length) of the plants in the target treatment area were measured to analyze the growth status of the remediated plants. The BCR continuous extraction method and ICP-MS were used to detect and analyze the effective metal content in the remediated soil to determine the removal rate of heavy metals in the soil.

[0043] The results are shown in Table 2 below. IDD14-OE , IDD15-OE , IDD16-OE The removal effects of heavy metals in soil were better than those of wild-type Arabidopsis. IDD14-OE The treatment effect of cadmium pollution in soil is better. IDD15-OE The treatment effect of mercury pollution in soil is better. IDD16-OE The treatment effect of lead pollution in soil is better. IDD14-OE , IDD15-OE , IDD16-OE When used together to treat soil contaminated by cadmium, lead and mercury, the three genetically modified enhanced plants synergized and achieved a comprehensive removal efficiency of more than 43%. The removal effect of each heavy metal pollutant broke through the simple superposition and constructed a complex plant joint restoration system. IDD14-OE , IDD15-OE , IDD16-OE It also exhibits an optimal restoration plant growth effect, indicating that the method of the present invention has good ecological sustainability.

[0044] Table 2 Heavy metal removal rate and plant growth status in each target treatment area in Example 3

[0045] Example 4 IDD14-OE、IDD15-OE、IDD16-OE Remediation of soil contaminated by chromium, nickel and copper in industrial areas The soil to be repaired is an industrial waste site mainly polluted by chromium. The soil pH is about 6.2, which is weakly alkaline. The effective chromium content in the soil is 85 mg / kg, the effective nickel content is 226 mg / kg, and the effective copper content is 1143 mg / kg. Referring to the first-class land screening value standard stipulated in GB 36600-2018 "Soil Environmental Quality Construction Land Soil Pollution Risk Control Standard (Trial)", according to the Nemerow Pollution Index Evaluation Method, chromium exceeds the standard by 2.8 times (moderate pollution), nickel exceeds the standard by 1.5 times (mild pollution), and copper does not exceed the standard but exceeds the warning line by 0.5.

[0046] The test field was divided into five areas. In the first area, the three transgenic Arabidopsis seeds obtained in Example 1 were mixed and sown. IDD14-OE : IDD15-OE : IDD16-OE =5:2.5:2; The seeds obtained in Example 1 were sown in the second area. IDD14-OE seed; The third area was sown with the seeds obtained in Example 1. IDD15-OE seed; The seeds obtained in Example 1 were sown in the fourth region. IDD16-OE seed; Sowing Arabidopsis wild-type plant seeds in the fifth area; The planting density in the five areas is controlled at 400 plants / m 2 .

[0047] After 30 days of in situ remediation, the aboveground biomass (fresh weight) and underground biomass (root length) of the plants in the target treatment area were measured to analyze the growth status of the remediated plants. The BCR continuous extraction method and ICP-MS were used to detect and analyze the effective metal content in the remediated soil to determine the removal rate of heavy metals in the soil.

[0048] The results are shown in Table 3 below. IDD14-OE , IDD15-OE , IDD16-OE The removal effects of heavy metals in soil were better than those of wild-type Arabidopsis. IDD14-OE The treatment effect of chromium pollution in soil is better. IDD15-OE The treatment effect of nickel pollution in soil is better. IDD16-OE The treatment effect of copper pollution in soil is better. IDD14-OE , IDD15-OE , IDD16-OE When used together to treat soil contaminated by chromium, nickel and copper, the three genetically modified enhanced plants synergized and achieved a comprehensive removal efficiency of more than 44%. The removal effect of each heavy metal pollutant broke through the simple superposition and constructed a complex plant joint restoration system. IDD14-OE , IDD15-OE , IDD16-OEIt also exhibits an optimal restoration plant growth effect, indicating that the method of the present invention has good ecological sustainability.

[0049] Table 3 Heavy metal removal rate and plant growth status in each target treatment area in Example 4

[0050] In summary, IDD transgenic fortified plants have good adaptability to environmental stress and can cope with complex and diverse soil environments. They can not only effectively repair heavy metal contaminated soils, but also ensure the biomass of the repaired plants and maintain a good growth state, which is conducive to the green reconstruction of contaminated sites.

[0051] Although the present invention has been described in detail with reference to the accompanying drawings and in combination with the preferred embodiments, the present invention is not limited thereto. Without departing from the spirit and essence of the present invention, a person of ordinary skill in the art may make various equivalent modifications or substitutions to the embodiments of the present invention, and these modifications or substitutions shall be within the scope of the present invention. Any person of ordinary skill in the art may easily think of changes or substitutions within the technical scope disclosed by the present invention, and these shall be within the scope of protection of the present invention.

Claims

1. An application of IDD gene in remediation of heavy metal contaminated soil, characterized in that: IDD genes include IDD14 Gene, IDD15 Genes and IDD16 At least one gene.

2. The use according to claim 1, characterized in that Will IDD14 Gene, IDD15 Genes and / or IDD16 The genes are introduced into the cells, tissues or organs of the plants and cultured into plants, so that the IDD gene is overexpressed in the plants. IDD14 Transgenic plants, IDD15 Transgenic plants and / or IDD16 Transgenic plants.

3. The use according to claim 1, characterized in that The plant is selected from one of Arabidopsis thaliana, alfalfa, Solanum nigrum, Suaeda salsa and Kochia scoparia.

4. A method for remediating heavy metal contaminated soil based on IDD transgenic enhanced plants, characterized in that: Planting IDD transgenic fortified plants on heavy metal contaminated soil. IDD transgenic fortified plants include IDD14 Transgenic plants, IDD15 Transgenic plants, IDD16 At least one of the genetically modified plants; heavy metal contaminated soil contains at least one of cadmium pollution, lead pollution, mercury pollution, chromium pollution, nickel pollution, and copper pollution.

5. The method according to claim 4, characterized in that Planting seeds on heavy metal contaminated soil to be remediated IDD14 Transgenic plants, IDD15 Transgenic plants and / or IDD16 Seeds of transgenic plants.

6. The method according to claim 4, characterized in that Sow seeds in the heavy metal contaminated soil to be repaired at a ratio of 5:2.5:2 IDD14 Transgenic plants, IDD15 Transgenic plants and IDD16 Seeds of transgenic plants.

7. The method according to claim 5 or 6, characterized in that Method for obtaining seeds of IDD transgenic fortified plants: Will IDD14 Gene, IDD15 Gene or IDD16 The genes were respectively inserted into the multiple cloning sites of the plant expression vector pCAMBIA1300, and the obtained recombinant plasmids were electroporated into Agrobacterium, which was used to infect plant seedlings. The infected plant seedlings were cultured to maturity, and T1 generation seeds were obtained. The seeds were screened and purified using antibiotics to obtain T2 generation seeds, namely, seeds of IDD transgenic fortified plants.

8. The method according to claim 4, characterized in that The planting density of IDD transgenic fortified plants is 300-500 plants / m 2 .

9. The method according to claim 4, characterized in that The plant is selected from one of Arabidopsis thaliana, alfalfa, Solanum nigrum, Suaeda salsa and Kochia scoparia.

Images