Process and device for producing small-molecular-weight humanized III-type collagen

Abstract

The invention discloses a production process and device of small-molecular-weight humanized III-type collagen, and relates to the technical field of collagen. The small-molecular-weight humanized III-type collagen production device comprises a conical heat preservation barrel, the outer wall of the conical heat preservation barrel is fixedly connected with a fixing support, the top of the conical heat preservation barrel is fixedly connected with a pH detector, and the top of the conical heat preservation barrel is fixedly connected with a feeding port. According to the production process and device of the small-molecular-weight humanized III-type collagen, a gene editing device is adopted, gene cutting enzyme of a specific segment is designed, a human gene is cut to obtain a specific gene segment, 458 amino acids in SEQ ID NO: 1 are cut, the diameter of an expression molecule is 1.4 nm, and the length of the expression molecule is 280 nm; the molecules with the diameter of 1.4 nm are higher in transdermal performance, penetrate through the basal layer through sweat glands to directly reach the corium layer, and can be rapidly distributed on the wound surface and cover the wound surface without dead corners to promote granulation growth and crawling to accelerate healing.

Description

Technical Field

[0001] The invention relates to the technical field of collagen, in particular to a production process and device of low-molecular-weight humanized type III collagen. Background Art

[0002] Type III collagen is the main collagen in human skin, fascia, and tendons, with a ratio of 4 to 1 to type I collagen; the micro-collagen layer (Cushion Network) is mainly composed of type III collagen, which refers to the tissue structure located between the epidermis and the dermis. It is the key to supporting the epidermis and the first step in skin collapse; the micro-collagen layer can be observed with the help of CLSM laser scanning confocal microscope and OCT optical coherence tomography technology, which cannot be seen with ordinary microscope technology; type III collagen is relatively small and exists between the epidermis and the dermis. It is called "baby collagen";

[0003] The invention discloses a marine fish collagen extraction process and production equipment with a Chinese publication number of "CN109705209B", which includes a horizontal grinder, a double shear emulsifier, a duplex filter, a turnover tank, a No. 1 ultrasonic extraction reactor, a No. 2 ultrasonic extraction reactor, a No. 1 multifunctional polymerization reactor, a No. 2 multifunctional polymerization reactor, a vacuum deodorizer, a storage tank, a high-pressure instantaneous sulfur-free device, a No. 1 liquid raw material turnover tank, a No. 2 liquid raw material turnover tank, a No. 3 liquid raw material turnover tank, a two-stage microfiltration protector, an ultramicro membrane filter, a nano-membrane filter, a high-speed centrifugal separator, a cleaning tank, a double-effect concentrator, a PLC operation controller and a centrifugal spray dryer. The horizontal grinder is connected to the double shear emulsifier through a material pipe, the double shear emulsifier is connected to the duplex filter through a material pipe, and the duplex filter is connected to the turnover tank through a material pipe.

[0004] Currently, the mainstream collagen is mostly produced by introducing human type III collagen gene into microorganisms through genetic engineering technology and recombinant expression. Although it has good biocompatibility, its large molecular weight, poor coverage and transdermal absorption performance limit its clinical application; therefore, it is necessary to launch a product with good coverage and transdermal absorption performance; Summary of the invention

[0005] In view of the deficiencies of the prior art, the present invention provides a process and device for producing low molecular weight humanized type III collagen to solve the problems raised in the above background technology.

[0006] To achieve the above objectives, the present invention is implemented by the following technical scheme: A process for producing low molecular weight humanized type III collagen, comprising the following steps:

[0007] S1. 458 amino acids were extracted from the complete sequence of human type III collagen, and the repeated parts in the amino acid sequence were discarded. Through yeast expression, collagen with a molecular diameter of 1.4nm and a length of 280nm and a complete triple helical structure was obtained;

[0008] S2. Purify the expressed collagen using a molecular sieve purification device, and remove foreign protein molecules, single-chain structure molecules or molecules that have not been fully folded by a molecular sieve chromatography method;

[0009] S3, mixing collagen and acryloyl short peptide, maintaining pH 6.0 and temperature 4°C, stirring and reacting for 10 to 12 hours;

[0010] S4. Mix collagen with fatty acids activated by EDC and NHS, maintain pH 6.0 and temperature at 4°C, and stir for 12 to 24 hours.

[0011] A low molecular weight humanized type III collagen production device comprises a conical heat-insulating barrel, a fixed bracket is fixedly connected to the outer wall of the conical heat-insulating barrel, a pH detector is fixedly connected to the top of the conical heat-insulating barrel, a feeding port is fixedly connected to the top of the conical heat-insulating barrel, a temperature equalization mechanism is fixedly connected to the top of the conical heat-insulating barrel, and a liquid adjustment mechanism is fixedly connected to the outer wall of the temperature equalization mechanism;

[0012] The temperature equalization mechanism includes:

[0013] A telescopic rod, the telescopic rod being fixedly connected to the top of the conical insulation barrel;

[0014] The motor is arranged at the top of the conical heat preservation barrel, and the outer wall of the motor is fixedly connected to the top of the telescopic rod;

[0015] A temperature regulating rod is fixedly connected to the bottom of the motor.

[0016] Preferably, the outer wall of the temperature regulating rod is located inside the conical heat-insulating barrel and is fixedly connected to a plug disc, and the top of the plug disc is fixedly connected to a sweep-out plate.

[0017] Preferably, the top of the plug disc is fixedly connected to a sweep-out plate, the bottom of the plug disc is fixedly connected to a spiral cone, the outer wall of the temperature regulating rod is located at the top of the sweep-out plate and is movably connected to the spiral plate, the outer wall of the temperature regulating rod is located at a corresponding position of the spiral plate and is fixedly connected to a limiting strip, a notch matching the limiting strip is provided in the spiral plate, and the outer wall of the temperature regulating rod is located at the top of the limiting strip and is fixedly connected to a dispersion plate.

[0018] Preferably, the liquid regulating mechanism comprises a thick fixed tube, the thick fixed tube is fixedly connected to the outer wall of the temperature regulating rod, and two thick fixed tubes are provided, and a thin fixed tube is fixedly connected to the bottom of the two thick fixed tubes.

[0019] Preferably, the thick fixed tube is movably connected to a first inner magnet, the thin fixed tube outer wall is movably connected to a first outer magnet at a position corresponding to the first inner magnet, the thin fixed tube is movably connected to a second inner magnet, and the thin fixed tube outer wall is movably connected to a second outer magnet at a position corresponding to the second inner magnet.

[0020] Preferably, a push rod is fixedly connected to the top of the first external magnet, and a push frame is fixedly connected to the top of the conical insulation barrel at a position corresponding to the push rod.

[0021] Preferably, a fixing rod is fixedly connected to a side of the second outer magnet away from the first inner magnet, an end of the fixing rod away from the second inner magnet is movably connected to a pushing plate, and limiting plates are fixedly connected to the top and bottom of the fixing rod at positions corresponding to the pushing plate.

[0022] The present invention provides a production process and device for low molecular weight humanized type III collagen, which has the following beneficial effects:

[0023] 1. The production process and device of the low molecular weight humanized type III collagen protein, through the gene editing device, designs a gene shearing enzyme of a specific fragment, shears the human gene to obtain a specific gene fragment, intercepts 458 amino acids in SEQ ID NO: 1, and expresses a molecule with a diameter of 1.4nm and a length of 280nm; the molecule with a diameter of 1.4nm has stronger transdermal performance, penetrates the basal layer through the sweat glands and directly reaches the dermis, and this molecule can achieve rapid distribution on the wound surface and cover the wound surface without dead angles to promote granulation growth and crawling to accelerate healing, and the healing speed is increased by more than 200% compared with hyaluronic acid or growth factors to promote healing, and the healing speed is increased by 130% compared with unpurified type III collagen; the 280-nanometer molecular length can form the most stable triple helix structure, which can more firmly support and protect the wound surface and prevent scar formation;

[0024] 2. The production process and device of small molecular weight humanized type III collagen purifies the expressed collagen through a molecular sieve purification device, further selects protein molecules with better functional structures, and ensures that the purified molecules have a complete triple helix structure.

[0025] 3. The production process and equipment of small molecular weight humanized type III collagen improve the stability and permeability of protein molecules by using molecular encapsulation technology. The encapsulation of cross-linked short peptides can effectively protect against radiation and prevent the loss of collagen activity during product sterilization. The encapsulation structure is sensitive to changes in pH value. The finished product maintains a pH value of 6.0. After contacting the human body, the pH value changes and the encapsulation layer quickly disintegrates to form a protective barrier.

[0026] 4. The production process and device of small molecular weight humanized type III collagen, the temperature regulating rod is slowly rotated by the motor, and the spiral plate is driven to push the mixture near the edge of the conical insulation barrel to the bottom. Since the conical insulation barrel is conical, the bottom middle of the mixture will be pushed. The dispersion plate is driven to rotate, which will push the mixture near the temperature regulating rod upward and to the surroundings, so that the temperature regulating rod can control the flow temperature of the mixture, better balance the temperature inside the conical insulation barrel, and allow the substances to be better mixed at a balanced temperature, which can improve the quality of mixing and improve the quality of production.

[0027] 5. The production process and device of small molecular weight humanized type III collagen can rotate the thick fixed tube through the motor, and the push rod can move on the surface of the thick fixed tube under the restriction of the push frame, so that the first outer magnet and the first inner magnet can move in coordination, and then the second inner magnet and the second outer magnet can move in coordination, so as to discharge part of the mixture inside the conical insulation barrel from one place to another, so as to better integrate the inside of the conical insulation barrel, improve the mixing effect, and improve the quality of production.

[0028] 6. The production process and device of small molecular weight humanized type III collagen, when the fixed rod moves up and down, the push plate will keep moving in an inclined state, which will play a role in pushing the mixture outward. The temperature regulating rod will rotate with the dispersion plate to push the mixture close to the temperature regulating rod outward, and then it will be pushed downward by the spiral plate, further promoting the circulation of the mixture inside the conical insulation barrel, promoting the uniform temperature transfer and mixing of the substances inside the conical insulation barrel, and improving the quality of production.

[0029] 7. The production process and device of small molecular weight humanized type III collagen slightly lifts the motor upward by extending the telescopic rod, which will create a gap between the plug disc and the inner wall of the conical insulation barrel, and allow the spiral plate to push the material on the inner wall of the conical insulation barrel downward to prevent residue on the inner wall of the conical insulation barrel. Then the telescopic rod contracts to allow the spiral cone to fit the inner wall of the conical insulation barrel at the bottom of the plug disc, and rely on the external spiral to scrape the inner wall of the conical insulation barrel to discharge the material on the inner wall of the conical insulation barrel, so as to avoid excessive excess material sticking to the inner wall of the conical insulation barrel, thereby increasing the output of collagen. BRIEF DESCRIPTION OF THE DRAWINGS

[0030] Figure 1 It is a schematic diagram of the main stereoscopic structure of the present invention;

[0031] Figure 2 It is a top view of the three-dimensional structure of the present invention;

[0032] Figure 3 For the present invention Figure 1 Schematic diagram of the cross-section structure;

[0033] Figure 4 for Figure 3 Schematic diagram of the large structure of the middle A part;

[0034] Figure 5 This is a temperature regulating rod of the present invention; structural schematic diagram;

[0035] Figure 6 for Figure 5 The enlarged structural diagram of the middle B part;

[0036] Figure 7 for Figure 5 The enlarged structural diagram of the middle C part;

[0037] Figure 8 for Figure 5 Schematic diagram of the cross-section structure;

[0038] Fig. 9 for Figure 8 Schematic diagram of the enlarged structure of part D in the middle.

[0039] In the figure: 1. conical insulation barrel; 2. fixed bracket; 3. feeding port; 4. pH detector; 5. temperature balancing mechanism; 501. telescopic rod; 502. motor; 503. temperature regulating rod; 504. plug disc; 505. spiral cone; 506. spiral plate; 507. limiting strip; 508. sweeping plate; 509. spreading plate; 6. liquid regulating mechanism; 601. thick fixed tube; 602. thin fixed tube; 603. first inner magnet; 604. first outer magnet; 605. second inner magnet; 606. second outer magnet; 607. pushing rod; 608. pushing frame; 609. fixed rod; 610. pushing plate; 611. limiting plate. DETAILED DESCRIPTION

[0040] The technical solutions in the embodiments of the present invention will be described clearly and completely below in conjunction with the drawings in the embodiments of the present invention. Obviously, the described embodiments are only part of the embodiments of the present invention, rather than all the embodiments.

[0041] Examples of the embodiments are shown in the accompanying drawings, wherein the same or similar reference numerals throughout represent the same or similar elements or elements having the same or similar functions. The embodiments described below with reference to the accompanying drawings are exemplary and are intended to be used to explain the present invention, and should not be construed as limiting the present invention.

[0042] Example 1: Please refer to Figure 1-9 The present invention provides a technical solution: a production process of low molecular weight humanized type III collagen, comprising the following steps:

[0043] S1. 458 amino acids were extracted from the complete sequence of human type III collagen, and the repeated parts in the amino acid sequence were discarded. Through yeast expression, collagen with a molecular diameter of 1.4nm and a length of 280nm and a complete triple helical structure was obtained;

[0044] S2. Purify the expressed collagen using a molecular sieve purification device, and remove foreign protein molecules, single-chain structure molecules or molecules that have not been fully folded by a molecular sieve chromatography method;

[0045] S3, mixing collagen and acryloyl short peptide, maintaining pH 6.0 and temperature 4°C, stirring and reacting for 10 to 12 hours;

[0046] S4. Mix collagen with fatty acids activated by EDC and NHS, maintain pH 6.0 and temperature at 4°C, and stir for 12 to 24 hours.

[0047] S1. 458 amino acids were extracted from the complete sequence of human type III collagen, and the repeated parts in the amino acid sequence were discarded. Through yeast expression, collagen with a molecular diameter of 1.4nm and a length of 280nm and a complete triple helical structure was obtained;

[0048] S2. Further purifying the purified collagen, removing foreign protein molecules, single-chain structure molecules or molecules that have not been fully folded by molecular sieve chromatography;

[0049] S3, mixing collagen and acryloyl short peptide, maintaining pH 6.0 and temperature 4°C, stirring and reacting for 10 to 12 hours;

[0050] S4. Mix collagen with fatty acids activated by EDC and NHS, maintain pH 6.0 and temperature at 4°C, and stir to react for 12 to 24 hours.

[0051] When used, the present invention intercepts 458 amino acid sequences from the full sequence gene of human type III collagen, discards the repeated parts in the amino acid sequence, and the amino acid sequence is as follows:

[0052] HDPVVLQRRDWENPGVTQLNRHLAHAHPPFASDHPMGAPGPAGAPGPPGAPGPAGPPGSAPA

[0053] GPAGAPGPPGAPGSAGPPGAPGAHGSAGPPGPAGAPGPPGAPGSAGPPGPAGAPGSAGPPGPAGAP

[0054] GPPGAPGAPGPLGPPGAPGSAGPPGPAGAPGPPGPAGAHGAPGPPGAPGSAGPPGPAGAHGPAGPL

[0055] GAHGPAGPLGAHGPAGPLGAHGPAGPLGAPGPAGPPGSAGAPGPPGAPGPAGPPGSAGAPGPPGAP

[0056] GPAGPPGSAGAPGPPGAPGPAGPPGSAGAPGPPGAPGPAGPPGSAGAPGPPGSAGAPGPPGAPGPA

[0057] GPPGSAGAPGPPGAPGPAGPPGSAGAPGPPGAPGPAGPPGSAGAPGPPGAPGPAGPPGSAGAPGPP

[0058] GAPGPAGPPGSAGAPGPPGAHGPAGPLGAHGPAGPLGAHGPAGPLGAMGAPGATGLSAGATHGLVT

[0059] CGL

[0060] The collagen is then further purified through a molecular sieve chromatography device to discard proteins with incomplete molecular structures. Collagen molecules with complete structures differ from single-chain molecules, molecules that are not fully folded, or other impurity molecules in terms of molecular weight, molecular space size, and molecular charge. These protein molecules that do not meet the requirements are removed through molecular sieve chromatography technology to obtain collagen with complete structure and good molecular activity.

[0061] Then, the collagen was mixed with the acryloyl short peptide, the pH was kept at 6.0, the temperature was kept at 4°C, and the reaction was stirred for 10 hours to 12 hours. Then, the collagen was mixed with fatty acids activated by EDC and NHS, the pH was kept at 6.0, the temperature was kept at 4°C, and the reaction was stirred for 12 hours to 24 hours.

[0062] Example 2: Please refer to Figure 1-6 Based on the first embodiment, the present invention provides a technical solution:

[0063] A low molecular weight humanized type III collagen production device comprises a conical heat preservation barrel 1, a fixed bracket 2 is fixedly connected to the outer wall of the conical heat preservation barrel 1, a pH detector 4 is fixedly connected to the top of the conical heat preservation barrel 1, a feeding port 3 is fixedly connected to the top of the conical heat preservation barrel 1, a temperature equalization mechanism 5 is fixedly connected to the top of the conical heat preservation barrel 1, and a liquid adjustment mechanism 6 is fixedly connected to the outer wall of the temperature equalization mechanism 5;

[0064] The temperature equalization mechanism 5 comprises:

[0065] A telescopic rod 501, which is fixedly connected to the top of the conical heat preservation barrel 1;

[0066] The motor 502 is arranged at the top of the conical heat preservation barrel 1, and the outer wall of the motor 502 is fixedly connected to the top of the telescopic rod 501;

[0067] The temperature regulating rod 503 is fixedly connected to the bottom of the motor 502 and can heat and cool the liquid to keep the liquid at a relatively balanced temperature.

[0068] The outer wall of the temperature regulating rod 503 is located inside the conical insulation barrel 1 and is fixedly connected to a plug disc 504. The telescopic rod 501 is extended to lift the motor 502 slightly upward, and at the same time, the plug disc 504 is lifted upward, so that there is a gap between the plug disc 504 and the inner wall of the conical insulation barrel 1. The mixture can be discharged from the bottom of the conical insulation barrel 1 through the gap between the plug disc 504 and the inner wall of the conical insulation barrel 1. A sweeping plate 508 is fixedly connected to the top of the plug disc 504.

[0069] The top of the plug disc 504 is fixedly connected to a sweeping plate 508, the bottom of the plug disc 504 is fixedly connected to a spiral cone 505, the outer wall of the temperature regulating rod 503 is located at the top of the sweeping plate 508 and is movably connected to a spiral plate 506, the outer wall of the temperature regulating rod 503 is located at a corresponding position of the spiral plate 506 and is fixedly connected to a limiting strip 507, a notch is provided in the spiral plate 506 that matches the limiting strip 507, and the outer wall of the temperature regulating rod 503 is located at the top of the limiting strip 507 and is fixedly connected to a spreading plate 509

[0070] When in use, the collagen with complete structure and good molecular activity and acryloyl are added into the conical insulation barrel 1 through the feeding port 3, and the pH detector 4 is observed to adjust the pH value inside the conical insulation barrel 1 to keep the pH value at 6.0, and the temperature regulating rod 503 is used to adjust the temperature inside the conical insulation barrel 1 to keep the temperature inside the conical insulation barrel 1 at 4°C, and the motor 502 is started to slowly rotate the temperature regulating rod 503. The temperature regulating rod 503 is rotated by the limiting bar 507 and the spiral plate 506 is rotated. The spiral plate 506 pushes the mixture near the edge of the conical insulation barrel 1 to the bottom. Since the conical insulation barrel 1 is conical, the mixture will be pushed to the middle of the bottom. At the same time, the temperature regulating rod 503 will rotate with the dispersion plate 509. The rotation of the dispersion plate 509 will push the mixture near the temperature regulating rod 503 upward and push it around at the same time, so that the temperature regulating rod 503 can control the flow temperature of the mixture, so as to better balance the temperature inside the conical insulation barrel 1.

[0071] After stirring for 10 to 12 hours, the fatty acids activated by EDC and NHS are mixed, and stirring is continued for 12 to 24 hours while maintaining pH 6.0 and temperature at 4°C.

[0072] Example 3: Please refer to Figure 1-9Based on the first and second embodiments, the present invention provides a technical solution:

[0073] The liquid regulating mechanism 6 comprises a thick fixed tube 601 , which is fixedly connected to the outer wall of the temperature regulating rod 503 . Two thick fixed tubes 601 are provided, and a thin fixed tube 602 is fixedly connected to the bottom of the two thick fixed tubes 601 .

[0074] The thick fixed tube 601 is movably connected with a first inner magnet 603 inside, and the outer wall of the thin fixed tube 602 is movably connected with a first outer magnet 604 at a position corresponding to the first inner magnet 603. The first outer magnet 604 allows the first inner magnet 603 to move with the first outer magnet 604 through magnetic attraction. The thin fixed tube 602 is movably connected with a second inner magnet 605 inside, and the outer wall of the thin fixed tube 602 is movably connected with a second outer magnet 606 at a position corresponding to the second inner magnet 605. The second inner magnet 605 moves upward and the second outer magnet 606 moves upward through magnetic attraction. When the first inner magnet 603 moves, the air pressure inside the first inner magnet 603 will change, and the change in air pressure will cause the second inner magnet 605 to move due to the air pressure.

[0075] A push rod 607 is fixedly connected to the top of the first external magnet 604 , and a push frame 608 is fixedly connected to the top of the conical heat preservation barrel 1 at a position corresponding to the push rod 607 .

[0076] A fixing rod 609 is fixedly connected to one side of the second outer magnet 606 away from the first inner magnet 603, and a push plate 610 is movably connected to one end of the fixing rod 609 away from the second inner magnet 605. Limiting plates 611 are fixedly connected to the top and bottom of the fixing rod 609 at positions corresponding to the push plate 610. When the fixing rod 609 moves up and down, the push plate 610 will be limited in its range of movement by the limiting plate 611, thereby bypassing the push plate 610 and moving in a tilted state.

[0077] When in use, when the motor 502 rotates with the temperature regulating rod 503, the motor 502 will rotate with the thick fixed tube 601. When the thick fixed tube 601 is driven to rotate, the push rod 607 will push the first outer magnet 604 to move through the outer wall, but it will move on the surface of the thick fixed tube 601 under the restriction of the push frame 608. The first outer magnet 604 allows the first inner magnet 603 to move with the first outer magnet 604 through magnetic attraction. When the first inner magnet 603 moves, the air pressure inside the first inner magnet 603 will change. The first inner magnet 603 is moved outward, which will reduce the air pressure inside the first inner magnet 603, and make the second inner magnet 605 move upward. The second outer magnet 606 moves upward through magnetic attraction, and moves upward with the fixed rod 609, which will make the push plate 610 move upward. The push plate 610 will be restricted by the limiting plate 61 1 is limited to keep moving in an inclined state, and can push the mixture outward. The second inner magnet 605 moves upward to suck the mixture into the thin fixed tube 602, and then the thick fixed tube 601 is continuously driven, so that the pushing frame 608 is no longer against the pushing rod 607. At this time, the second outer magnet 606 is supported by the fixed rod 609 and the second outer magnet 606 moves downward, and the second inner magnet 605 moves downward through the magnetic force to discharge the sucked mixture, and the first inner magnet 603 is sucked inward through the action of air pressure to allow the first inner magnet 603 to suck the mixture into the thick fixed tube 601, and then discharge the mixture to another place, thereby realizing the discharge of part of the mixture inside the conical insulation bucket 1 from one place to another. In this way, the pH detector 4 will detect the flowing area, and can more accurately detect the pH value of the material inside the conical insulation bucket 1.

[0078] When the fixing rod 609 moves up and down, the pushing plate 610 will be limited in its range of movement by the limiting plate 611, thereby bypassing the pushing plate 610 and moving in an inclined state, which will push the mixture outward. The temperature regulating rod 503 rotates with the dispersion plate 509 to push the mixture close to the temperature regulating rod 503 outward, and then is pushed downward by the spiral plate 506, further promoting the circulation of the mixture inside the conical insulation barrel 1, and promoting the uniform temperature transfer and mixing of the substances inside the conical insulation barrel 1.

[0079] After the mixing is completed, the telescopic rod 501 is extended to lift the motor 502 slightly upward, and at the same time, the plug disc 504 is lifted upward, so that there is a gap between the plug disc 504 and the inner wall of the conical insulation barrel 1, and the spiral plate 506 slides with the outer wall of the temperature adjustment rod 503 under the action of gravity, and the limiting bar 507 continues to rotate with the spiral plate 506, and the mixture is discharged from the bottom of the conical insulation barrel 1 through the gap between the plug disc 504 and the inner wall of the conical insulation barrel 1, and the spiral plate 506 pushes the material on the inner wall of the conical insulation barrel 1 downward to prevent the inner wall of the conical insulation barrel 1 from remaining, and the plug disc 504 pushes the material to flow out of the plug disc 504 under the action of centrifugal force, and then the telescopic rod 501 contracts, which makes the spiral cone 505 fit the inner wall of the conical insulation barrel 1 at the bottom of the plug disc 504, and scrapes the inner wall of the conical insulation barrel 1 by the external spiral to discharge the material on the inner wall of the conical insulation barrel 1.

[0080] The above description is only a preferred specific implementation manner of the present invention, but the protection scope of the present invention is not limited thereto. Any technician familiar with the technical field can make equivalent replacements or changes according to the technical scheme and inventive concept of the present invention within the technical scope disclosed by the present invention, which should be covered by the protection scope of the present invention.

Claims

1. A process for producing low molecular weight humanized type III collagen, characterized in that: The following steps are involved: S1. 458 amino acids were extracted from the complete sequence of human type III collagen, and the repeated parts in the amino acid sequence were discarded. Through yeast expression, collagen with a molecular diameter of 1.4nm and a length of 280nm and a complete triple helical structure was obtained; S2. Purify the expressed collagen using a molecular sieve purification device, and remove foreign protein molecules, single-chain structure molecules or molecules that have not been fully folded by a molecular sieve chromatography method; S3, mixing collagen and acryloyl short peptide, maintaining pH 6.0 and temperature 4°C, stirring and reacting for 10 to 12 hours; S4. Mix collagen with fatty acids activated by EDC and NHS, maintain pH 6.0 and temperature at 4°C, and stir to react for 12 to 24 hours.

2. The low molecular weight humanized type III collagen production device according to claim 1 comprises a conical heat preservation barrel (1), characterized in that: The outer wall of the conical heat-insulating barrel (1) is fixedly connected to a fixed bracket (2), the top of the conical heat-insulating barrel (1) is fixedly connected to a pH detector (4), the top of the conical heat-insulating barrel (1) is fixedly connected to a feeding port (3), the top of the conical heat-insulating barrel (1) is fixedly connected to a temperature balancing mechanism (5), and the outer wall of the temperature balancing mechanism (5) is fixedly connected to a liquid regulating mechanism (6); The temperature equalization mechanism (5) comprises: A telescopic rod (501), wherein the telescopic rod (501) is fixedly connected to the top of the conical heat preservation barrel (1); An electric motor (502), wherein the electric motor (502) is arranged at the top of the conical heat preservation barrel (1), and the outer wall of the electric motor (502) is fixedly connected to the top of the telescopic rod (501); A temperature regulating rod (503), wherein the temperature regulating rod (503) is fixedly connected to the bottom of the motor (502).

3. The low molecular weight humanized type III collagen production device according to claim 2, characterized in that: The outer wall of the temperature regulating rod (503) is located inside the conical heat-insulating barrel (1) and is fixedly connected to a plug disc (504), and the top of the plug disc (504) is fixedly connected to a sweeping plate (508).

4. A device for producing low molecular weight humanized type III collagen according to the conical heat-insulating barrel (1), characterized in that: The top of the plug disc (504) is fixedly connected to a sweep-out plate (508), the bottom of the plug disc (504) is fixedly connected to a spiral cone (505), the outer wall of the temperature regulating rod (503) is located at the top of the sweep-out plate (508) and is movably connected to a spiral plate (506), the outer wall of the temperature regulating rod (503) is located at a corresponding position of the spiral plate (506) and is fixedly connected to a limiting strip (507), a notch matching the limiting strip (507) is provided in the spiral plate (506), and the outer wall of the temperature regulating rod (503) is located at the top of the limiting strip (507) and is fixedly connected to a dispersion plate (509).

5. The low molecular weight humanized type III collagen production device according to claim 4, characterized in that: The liquid regulating mechanism (6) comprises a thick fixed tube (601), wherein the thick fixed tube (601) is fixedly connected to the outer wall of the temperature regulating rod (503), and two thick fixed tubes (601) are provided, and the bottoms of the two thick fixed tubes (601) are fixedly connected to thin fixed tubes (602).

6. The device for producing low molecular weight humanized type III collagen according to claim 5, characterized in that: The thick fixed tube (601) is movably connected to a first inner magnet (603) inside, the thin fixed tube (602) is movably connected to a first outer magnet (604) at a position corresponding to the first inner magnet (603) on the outer wall, the thin fixed tube (602) is movably connected to a second inner magnet (605) inside, and the thin fixed tube (602) is movably connected to a second outer magnet (606) at a position corresponding to the second inner magnet (605) on the outer wall.

7. The device for producing low molecular weight humanized type III collagen according to claim 6, characterized in that: The top of the first external magnet (604) is fixedly connected to a push rod (607), and the top of the conical heat preservation barrel (1) is fixedly connected to a push frame (608) at a position corresponding to the push rod (607).

8. The device for producing low molecular weight humanized type III collagen according to claim 7, characterized in that: A fixing rod (609) is fixedly connected to one side of the second outer magnet (606) away from the first inner magnet (603), and an end of the fixing rod (609) away from the second inner magnet (605) is movably connected to a pushing plate (610), and a limiting plate (611) is fixedly connected to the top and bottom of the fixing rod (609) at positions corresponding to the pushing plate (610).

Images