2results about How to "Instant detection" patented technology

The invention discloses a probe for targeting staphylococcus aureus and an application of the probe. The amino acid sequence of a nano antibody is as follows: QLQLVESGGLVQAGGSMRLSCAASGRTFSTNTMGWFRQAPGKEREFVAGIRWISGSTQADSVKGRFTISRDNAKNTLFLQMNSLPEDAVYYCAAGPHNIPILRTSAYNYWGQGTQVTVSS, and the amino acid sequence of the nano antibody is as follows: QLQLVEGGGLVQAGGTQVTVSS. According to the invention, a high-performance probe is screened, and a high-sensitivity electrochemical sensor is constructed to realize rapid and accurate screening of staphylococcus aureus in different media; staphylococcus aureus can be qualitatively detected within one minute, and the method has high sensitivity and excellent specificity and accuracy. The method meets the urgent demand of accurately, reliably and quickly detecting the staphylococcus aureus in a complex environment.

This invention discloses a rapid rope adjustment system and method based on gear pitch pulsation, belonging to the field of hoist technology. The system includes a control box, a gear pitch detection device, and a hoist electrical drive. The method involves: after the rope adjustment clutch is engaged, the gear pitch detection device positions the initial position of the moving gear block; the control box calculates the pulsating speed curve based on the gear pitch of the internal gear ring, and uses a closed-loop position control mode to drive the hoist electrical drive to rotate the fixed drum in a pulsating manner according to the gear pitch. When the container reaches the target position, the system control device automatically and precisely stops at the current gear pitch position, then closes the clutch to engage the moving gear block with the internal gear ring, completing the rope adjustment. This invention automates the rope adjustment process, avoiding the manual observation and back-and-forth gear adjustment required in traditional methods, significantly improving the efficiency and accuracy of rope adjustment operations.