Tobacco transcription repressor protein ofp1 and its application
A technology for suppressing proteins and tobacco, which is applied in the field of tobacco genetic engineering and can solve the problems of producing harmful substances, affecting the grade and quality of tobacco, and poor appearance and quality.
- Summary
- Abstract
- Description
- Claims
- Application Information
AI Technical Summary
Problems solved by technology
Method used
Image
Examples
Embodiment 1
[0037] The PCR amplification program is: 95°C pre-denaturation for 3 min; 95°C denaturation for 15s, 55°C annealing for 15s, 72°C extension for 30s, 34°C
[0038] The PCR amplification product was detected by agarose gel electrophoresis, and the electrophoresis product was recovered for subsequent use.
[0047] MVQRQRNRVSFSANLPKDVHGAFADSTICAVKYSMDPLSDIRESIREMVNNVGIQDWKEMEELIYCYI
Embodiment 2
~
1.5 or so, then centrifuge at 4000g for 5 min, collect the bacteria, and then use MMA (1 mL (1 M) MgCl
2
; 1 mL
(1 M, pH 5.6) MES; 75 μL (200 mM) As), resuspend, adjust OD
600
= about 1.0;
[0056] After the final room temperature was placed for about 3 h, it was used as a bacterial solution for transfection.
(3) instantaneous conversion
With 3
[0059] The tobacco phenotype changes after injection for 3 weeks are shown in Figure 1. It can be seen that Agrobacterium infection with TRV2-PDS
The leaves of N. benthamiana at 4 w seedling age were used as the experimental material. Using a 1 mL syringe, the
The bacterial solution for transfection was prepared and injected into tobacco leaves, and the injected tobacco was continued to be cultivated in an artificial incubator to observe the phenotypic changes.
change.
[0063].
The new leaves of the plant had bleaching phenomenon, indicating that the infection was successful; while there was no significant chan...
PUM
Login to View More Abstract
Description
Claims
Application Information
Login to View More 


