Unlock instant, AI-driven research and patent intelligence for your innovation.

Specific targeted polypeptide for adult T-cell leukemia and application of specific targeted polypeptide

A peptide-targeting, specific technology, applied in the field of biomedicine, to achieve the effect of small cytotoxicity and side effects

Active Publication Date: 2017-09-29
ZHEJIANG NORMAL UNIVERSITY
View PDF5 Cites 1 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] Since so far, there is no effective means of prevention and treatment of ATL, scientists began to explore new treatment methods that directly target the HTLV-1 viral protein

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Specific targeted polypeptide for adult T-cell leukemia and application of specific targeted polypeptide
  • Specific targeted polypeptide for adult T-cell leukemia and application of specific targeted polypeptide
  • Specific targeted polypeptide for adult T-cell leukemia and application of specific targeted polypeptide

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0026] In the general sequence formula of the specific targeting polypeptide of Example 1, X represents the sequence shown in SEQ ID No.4, Y represents the sequence shown in SEQ ID No.1, and Z represents the sequence shown in SEQ ID No.5 In the sequence shown, Acp represents the sequence shown in SEQ ID No.2, and R8 represents the sequence shown in SEQ ID No.3; that is, the sequence of the specific targeting polypeptide of Example 1 is as follows:

[0027] RKRKLERIARLEEKVKTLKAQNSELASTANMLREQVAQLKVQAAIDYINGRRRRRRRR (sequence shown in SEQ ID No. 6).

Embodiment 2

[0029] In the general sequence formula of the specific targeting polypeptide of Example 2, X represents the sequence shown in SEQ ID No.4, Y represents the sequence shown in SEQ ID No.1, Z represents empty, and Acp represents is the sequence shown in SEQ ID No.2, and R8 represents the sequence shown in SEQ ID No.3; that is, the sequence of the specific targeting polypeptide is as follows:

[0030] RKRKLERIARLEEKVKTLKAQNSELASTANVQAAIDYINGRRRRRRRR (sequence shown in SEQ ID No. 7).

Embodiment 3

[0032] In the general sequence formula of the specific targeting polypeptide of Example 3, X represents empty, Y represents the sequence shown in SEQ ID No.1, Z represents empty, and Acp represents the sequence shown in SEQ ID No. 2, R8 represents the sequence shown in SEQ ID No.3; that is, the sequence of the specific targeting polypeptide is as follows:

[0033] LERIARLEEKVKTLKAQNSELASTANVQAAIDYINGRRRRRRRR (sequence shown in SEQ ID No. 8).

[0034] The specific targeting polypeptides of the above-mentioned examples 1, 2 and 3 can all be prepared by artificial synthesis (for example, the inventor commissioned Baiqi Biotechnology (Suzhou) Co., Ltd. to synthesize the specific targeting polypeptides of the above-mentioned examples 1, 2 and 3 targeting peptides).

[0035] In a specific embodiment of the present invention, a gene encoding the above-mentioned specific targeting polypeptide is provided. After knowing the amino acid sequence of the above-mentioned specific targeting ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention relates to a specific targeted polypeptide for adult T-cell leukemia and application of the specific targeted polypeptide. The specific targeted polypeptide for treating the adult T-cell leukemia is screened by taking a key viral protein HBZ encoded by infective pathogen human T-cell leukemia virus type 1 of the adult T-cell leukemia (ATL) as a target and can be used for preparing a targeted drug for treating the adult T-cell leukemia. Compared with traditional treatment measures of anti-tumor drugs, the targeted drug and the targeted treatment measure based on the specific targeted polypeptide have the advantages that the toxic and side effects of cells are relatively low, and a brand-new thought and strategy are provided for researching drugs resisting HTLV-1 and ATL in future.

Description

technical field [0001] The invention relates to a specific targeting polypeptide for adult T cell leukemia and its application, belonging to the technical field of biomedicine. Background technique [0002] Adult T-cell leukemia (ATL, adult T-cell leukemia) is a malignant proliferative disease of the lymphatic system. [0003] Studies in the past three decades have shown that ATL is closely related to the infection of human T-cell leukemia virus type 1 (HTLV-1, human T-cell leukemia virus type 1), specifically, the viral protein encoded by HTLV-1 is promoting Virus infection and replication play an extremely important role in the process of inducing adult T-cell leukemia. [0004] Since so far, there is no effective means of prevention and treatment of ATL, scientists began to explore new treatment methods that directly target the HTLV-1 virus protein. [0005] In the HTLV-1 virus genome, in addition to forward coding structural genes gag, pol, env, and regulatory proteins...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/00C12N15/11A61K38/16A61P35/02
CPCA61K38/00C07K14/00
Inventor 赵铁军徐玲玲宋早文张裕丰姚佳
Owner ZHEJIANG NORMAL UNIVERSITY