Targeting tumor neovasculature with modified chimeric antigen receptors

A chimeric antigen receptor and targeting moiety technology, which can be used in anti-tumor drugs, anti-receptor/cell surface antigen/cell surface determinant immunoglobulin, microorganisms, etc.

Inactive Publication Date: 2016-03-23
UNIV HOUSTON SYST
View PDF3 Cites 0 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

However, the ability of EPR to facilitate nanoparticle delivery to solid tumors remains controversial

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Targeting tumor neovasculature with modified chimeric antigen receptors
  • Targeting tumor neovasculature with modified chimeric antigen receptors
  • Targeting tumor neovasculature with modified chimeric antigen receptors

Examples

Experimental program
Comparison scheme
Effect test

Embodiment

[0055] cell line. Human umbilical vein endothelial cells (HUVEC) and the murine melanoma cell line B16-F0 were obtained from ATCC (Manassas, VA). HUVEC were cultured in Dulbecco's Modified Eagle's Medium (DMEM; Cat. No. 30-2002) formulated by ATCC containing 20% ​​fetal bovine serum (FBS), and B16-F0 cells were grown in a medium containing 100 μg / ml Streptomycin and 100U / ml penicillin in 10% FBSDMEM. B16-GFPluc cells were established in the inventor's laboratory by co-transfecting pIR-eGFP-luc and pCMV-piggyBac plasmids into B16-F0, followed by flow cytometry sorting and single cell cloning as described previously (FuX, et al., Asimple and sensitive method for measuring tumor-specific T cell cytotoxicity. PLoS One 2010; 5: e11867 (2010)).

[0056] Retroviral vector construction and preparation. The construction of the retroviral vector is schematically shown in Figure 1Amiddle. The coding sequence for Leu-28-serastatin (MECESGPCCRCKFLKEGTICKRARGDDLDDYCNGKTCDCPRNPHKGPAT; G...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

A T cell transduced with a chimeric antigen receptor can be administered to a host to kill cancer cells. The chimeric antigen receptor can include a targeting moiety with a strong binding affinity to Alpha v Beta 3 integrin, including but not limited to an echistatin polypeptide. The targeting moiety can also be modified to have a reduced binding affinity to Alpha 5 Beta 1 integrin.

Description

[0001] Cross References to Related Applications [0002] This application claims priority to US Provisional Application No. 61 / 835,147, filed June 14, 2013, which is hereby incorporated by reference in its entirety. [0003] Government funding: [0004] NIH reference number R01CA132792. Background of the invention [0005] Several promising immunotherapies are currently being developed to fight cancer. For example, one type of immunotherapy exploits the predominance of antigen-specific T cells in cell-mediated immunity. T cells recognize their targets through the T cell receptor (TCR), which binds to antigenic peptides presented by the major histocompatibility complex (MHC) on the surface of cancer cells. In the presence of co-stimulatory molecules, this binding results in T cell activation and subsequent lysis of the bound target cells (VanderMerwePA, et al., Molecular interactions mediating Tcellantigenrecognition, Annu. Rev. Immunol. 21:659-84 (2003)). However, most tum...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & AuthorityApplications(China)
IPC IPC(8): C07K16/30
CPCA61K38/195C12N2740/13043A61K45/06A61P35/00A61K2239/26A61K2239/31A61K39/4611A61K39/4631A61K39/464406A61K39/461A61K2300/00A61K35/17
Inventor张小柳付新平
OwnerUNIV HOUSTON SYST