Anti-CD3 and anti-CD19 bispecific antibody

A bispecific antibody and specific technology, which is applied in the field of anti-CD3 and anti-CD19 bispecific antibodies, can solve problems such as instability, short half-life of pharmacological molecules, mismatching of light and heavy chains, etc., to increase concentration and enhance killing ability , to avoid the effect of mismatch

Active Publication Date: 2019-12-17
BEIJING DONGFANG BIOTECH
View PDF6 Cites 3 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0006] At present, Blincyto is the only bispecific antibody on the market against CD3 and CD19 antigens. Blincyto uses a linker to directly connect the anti-CD19 light chain variable region, anti-CD19 heavy chain variable region, anti-CD3 heavy chain variable region, and anti-CD3 light chain variable region. The variable region does not contain the Fc fragment, so the half-life of the pharmacological molecule in the drug is relatively short. In addition, in other existing double-antibody drug molecules, even if the Fc fragment is retained in order to prolong the half-life of the drug, the modification of the Fc region makes the bismuth There is no natural monoclonal antibody stability in the body, and it is easy to produce mismatches between light and heavy chains. Therefore, it is urgent to develop a method that can not only retain the Fc fragment, prolong the half-life of the drug molecule, but also have a stable structure and avoid light and heavy chains. Anti-CD3 and anti-CD19 bispecific antibodies with mismatch between molecules

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Anti-CD3 and anti-CD19 bispecific antibody
  • Anti-CD3 and anti-CD19 bispecific antibody
  • Anti-CD3 and anti-CD19 bispecific antibody

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0038] The present invention constructs an anti-CD3 and anti-CD19 bispecific antibody molecule (the antibody is named JY039), which comprises a single-chain unit capable of specifically binding to the CD3 antigen and a monovalent unit capable of specifically binding to the CD19 antigen. Both the unit and the monovalent unit include a complete light chain and a complete heavy chain. The monovalent unit contains the light chain and heavy chain of the anti-CD19 antibody. The C-terminal of the light chain of the anti-CD3 antibody in the single-chain unit is connected to the N-terminal of the heavy chain through a linker Connection; the heavy chain includes the heavy chain variable region and the heavy chain constant region, and the light chain includes the light chain variable region and the light chain constant region. The specific configuration diagram is as follows figure 1 shown.

Embodiment 2

[0040] On the basis of Example 1, the present invention further defines a linker, the amino acid sequence of which is (GGGGX)n, wherein X is Gly or Ser, and n is a natural number of 1-6;

[0041] Preferably, X is Ser;

[0042] Preferably, n is 6.

[0043] Further, the amino acid sequence of the heavy chain variable region of the single chain unit is SEQ ID NO:1; the amino acid sequence of the light chain variable region of the single chain unit is SEQ ID NO:2;

[0044] Wherein, SEQ ID NO: 1 (the amino acid sequence of the heavy chain variable region of the single chain unit);

[0045] DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLEWIGYINPSRGYTNYNQKFKDKATLTTDKSSSTAYMQLSLTSEDSAVYYCARYYDDHYCLDYWGQGTTLTVSS;

[0046] SEQ ID NO: 2 (amino acid sequence of the light chain variable region of the single chain unit);

[0047] DIQLTQSPAIMSASPGEKVTMTCRASSVSYMNWYQQKSGTSPKRWIYDTSKVASGVPYRFSGSGSGTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK.

[0048] Further, the amino acid sequence of the heavy...

Embodiment 3

[0056] The present invention also provides a polypeptide or protein, both of which contain anti-CD3 and anti-CD19 bispecific antibodies.

[0057] The present invention also provides a nucleotide sequence or a combination thereof, and the nucleotide sequence or a combination thereof encodes the anti-CD3 and anti-CD19 bispecific antibody contained therein.

[0058] The present invention also provides a recombinant DNA expression vector, the recombinant DNA expression vector comprises nucleotide sequence or a combination thereof.

[0059] The present invention also provides a host cell for the transfected recombinant DNA expression vector, which is characterized in that the host cell includes prokaryotic, yeast or mammalian cells.

[0060] The present invention further provides a medicament or a pharmaceutical composition, characterized in that the medicament or the pharmaceutical composition comprises anti-CD3 and anti-CD19 bispecific antibodies.

[0061] The present invention ...

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

PUM

No PUM Login to view more

Abstract

The invention relates to the field of biological medicines, and specifically provides an anti-CD3 and anti-CD19 bispecific antibody, which includes a single-chain unit capable of specifically bindingto a CD3 antigen and a monovalent unit capable of specifically binding to a CD19 antigen. The single-chain unit and the monovalent unit both include a complete light chain and a complete heavy chain,and the C terminal of the light chain of the single-chain unit is connected with the N terminal of the heavy chain through a linker. According to the invention, the biological activities of the anti-CD19 antibody and the anti-CD3 antibody are completely retained; tumor cells and effector cells can be better recognized; the effector cells are targeted to the tumor cells to achieve the specific lethal effect, and the lethal ability is higher; and since the light chain and the heavy chain of the single-chain unit are bonded through the linker, mismatch between the light chain and the heavy chainin the bispecific antibody is effectively avoided, the difficulty in purification is solved, and a solid foundation is provided for amplified production of the bispecific antibody.

Description

technical field [0001] The invention relates to the technical field of biomedicine, in particular to an anti-CD3 and anti-CD19 bispecific antibody. Background technique [0002] With the continuous development of biological drugs, therapeutic antibodies have become the main drug of choice for patients with cancer, autoimmunity, inflammation and various other diseases. However, monoclonal antibodies have their limitations. These antibodies are directed against a single target. Many patients do not respond adequately to a single therapy, and patients may develop resistance or non-response. Cancer is different from other diseases. It is a multifactorial disease, and multiple signaling pathways are involved in the occurrence of the disease. It seems that single-target immunotherapy is not enough to destroy cancer cells. is recognized. Bispecific antibody (bispecific antibody, BiAb) is an artificial antibody containing two specific antigen-binding sites, which can specifically ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to view more

Application Information

Patent Timeline
no application Login to view more
Patent Type & Authority Applications(China)
IPC IPC(8): C07K16/46C12N15/13C12N15/85C12N5/10A61K39/395A61P35/00
CPCC07K16/2809C07K16/2803C12N15/85A61P35/00C07K2317/31C07K2317/52A61K2039/505
Inventor 白义张稳李红英
Owner BEIJING DONGFANG BIOTECH
Who we serve
  • R&D Engineer
  • R&D Manager
  • IP Professional
Why Eureka
  • Industry Leading Data Capabilities
  • Powerful AI technology
  • Patent DNA Extraction
Social media
Try Eureka
PatSnap group products