4results about How to "Good membrane permeability" patented technology

The application discloses a kind of fulvic acid hydrogen peptide biological stimulant hormone fertilizer and preparation method thereof, belong to fertilizer technical field.Fertilizer is by 15~30 parts of fulvic acid, 5~12 parts of peony seed meal small molecule peptide, 20~35 parts of potassium dihydrogen phosphate and other components compound, water is made up to 100 parts, and auxiliary agent is emulsifier and chelating agent compound.Preparation first by dissolving fulvic acid, potassium phosphate in water and obtaining mixed solution, then adding small molecule peptide and auxiliary agent and stirring until the system is stable;Small molecule peptide is prepared by peony seed meal defatted powder crushing and enzymolysis, solves the problem of traditional fertilizer nutrient antagonism, unstable system, and the utilization of peony seed meal also improves resource utilization.Tomato, cucumber seedling test shows that it can significantly improve the growth index of crop root system and aboveground part, and the root-promoting and seedling-strengthening effect is better than that of similar fertilizer on the market, and the preparation process is simple, easy to industrialization, and has good agricultural application prospect.

The invention belongs to the technical field of fluorescent probes, and particularly relates to a single-molecule fluorescent probe based on a phenothiazine structure as well as a preparation method and application of the single-molecule fluorescent probe. The preparation method comprises the following steps: firstly introducing an alkyl chain to a nitrogen atom of a raw material to obtain the phenothiazine structure-based single-molecule fluorescent probe, then carrying out regioselective formylation on the raw material to obtain the phenothiazine structure-based single-molecule fluorescent probe, then treating the raw material by adopting aluminum trichloride to realize O-demethylation, and finally carrying out intramolecular cyclization reaction on the raw material and 1H-benzimidazole-2-acetonitrile to obtain the phenothiazine structure-based single-molecule fluorescent probe. The single-molecule fluorescent probe based on the phenothiazine structure prepared by the invention is compatible with orthogonal chemical reaction activity and maintains controllable electron transfer, so that different chemical events are converted into specific optical signals, and selective and mechanism specific fluorescent response to phosgene, copper ions and hypochlorite is realized.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention discloses a culture medium containing a microbial growth promoter and a novel carbon source and a preparation method, and belongs to the technical field of microbial fermentation engineering. The culture medium is prepared from the following raw material components in parts by mass: 15-30 parts of a novel carbon source, 5-10 parts of a nitrogen source, 2-5 parts of an inorganic salt mixture, 0.1-2 parts of a microbial growth accelerant, 1-3 parts of a buffering agent, 0.1-3 parts of a multifunctional compound factor and purified water. Wherein the microbial growth promoter is an amide compound with a specific structure as shown in a formula 1. Through the synergistic effect of the growth promoter with a specific structure and the novel carbon source (such as trehalose, soluble starch and the like), the permeability of a microbial cell membrane is improved, the activity of a carbon source clastic enzyme is activated, and the problems that the utilization rate is low when the novel carbon source is independently used and the pH is suddenly reduced and the product is inhibited due to too fast metabolism of the traditional carbon source are effectively solved.