Patents
Literature
8 results about "EGF Receptors" patented technology
Efficacy Topic
Property
Owner
Technical Advancement
Application Domain
Technology Topic
Technology Field Word
Patent Country/Region
Patent Type
Patent Status
Application Year
Inventor
New egfrviii-binding peptides, conjugates and uses thereof
PendingUS20250368684A1Peptide/protein ingredientsReceptors for growth factors/regulatorsBinding peptideAmino acid composition
The present invention relates to a peptide of 12 to 30 amino acids, said peptide comprising the sequence SEQ ID NO: 1 represented by:(SEQ ID NO: 1)V-X1-X2-R-X3-E-W-X4-X5-X6-Y-W,wherein each of X1, X2, X3, X4, X5, and X6 independently corresponds to any amino acid, andwherein said peptide binds to the EGF receptor variant III (EGFRvIII), as well as products incorporating such peptide and uses thereof.
Owner:NANOTHERA BIOSCIENCES INC
Epidermal growth factor derivative and use of same
PCT designated stageWO2026132636A1Peptide/protein ingredientsAntineoplastic agentsDiseaseCancer research
The present invention relates to an epidermal growth factor derivative called mdEGF comprising or consisting of the amino acid sequence: NSDSECPLSHDGYCLHDGVCGYTEAGDKYACDCVVGYIGERCQYRDLKWWELR. The present invention also relates to the use of the epidermal growth factor derivative mdEGF in preventing and / or treating a disease related to increased activity of EGF receptor (EGFR), namely, cancer.
Owner:UNIV DE GIRONA +1
Triple combination for use in the treatmet of cancer
PCT designated stageWO2026027675A1Organic active ingredientsPharmaceutical non-active ingredientsPharmaceutical drugOncology
The present invention relates inter alia to pharmaceutical compositions and kits comprising (i) an inhibitor of the expression, activity and / or function of c-Raf, (ii) an inhibitor of the expression, activity and / or function of EGF Receptor (EGFR), or (iii) an inhibitor of the expression, activity and / or function of STAT3, for use in combination in the prevention and / or treatment of cancer.
Owner:GUERRA GONZÁLEZ CARMEN +1
Alkylamido compounds and uses thereof
Disclosed herein are compounds that may be specific to PPAR and / or EGF receptors, and methods of making and using same.
Owner:NOGRA PHARMA LTD
Combination of HB-EGF inhibitor and corticosteroid agent for treating nephropathy associated with activation of HB-EGF / EGFR pathway
The present invention relates to a combination of a corticosteroid agent and a heparin-binding epidermal growth factor-like growth factor (HB-EGF) inhibitor for use in the treatment of nephropathy associated with the activation of the HB-EGF / EGF receptor pathway.
Owner:COMMISSARIAT A LENERGIE ATOMIQUE ET AUX ENERGIES ALTERNATIVES +1
Triple therapy inhibiting EGFR, RAF1, and STAT3 for pancreatic ductal adenocarcinoma
PendingJP2026504743AOrganic active ingredientsGenetic material ingredientsAdenocarcinomaPharmaceutical drug
The present invention relates to pharmaceutical compositions comprising inhibitors of c-Raf expression, activity and / or function, inhibitors of EGF receptor (EGFR) expression, activity and / or function, and inhibitors of STAT3 expression, activity and / or function, and their use in the treatment of pancreatic cancer.
Owner:グエラ ゴンザレスマリア デル カルメン +1
Shb-EGF enhancement therapy for diabetes
PCT designated stageWO2025211357A1Organic active ingredientsMetabolism disorderHepatocyte growth factorReceptor-Mediated Signal Transduction
The present invention provides: a therapeutic agent for diabetes in mammals comprising a heparin-binding epidermal growth factor-like growth factor ectodomain (HB-EGF ECD) fragment or a nucleic acid encoding the same; the preparation combining hepatocyte growth factor (HGF) or a fragment thereof or a nucleic acid encoding the same; and a therapeutic agent for diabetes in mammals comprising a substance that potentiates signal transduction via the HB-EGF receptors.
Owner:KAGOSHIMA UNIV +1
Method for purifying cardiomyocytes
PendingJP2026004460ASkeletal/connective tissue cellsArtificial cell constructsTyrosineReceptor Inhibition
To provide a method for producing a cardiac muscle cell by using a receptor type tyrosine kinase inhibitor, and to provide a method for purifying the cardiac muscle cell.SOLUTION: A method for producing a cell population comprising cardiomyocytes, comprising the steps of: (1) culturing pluripotent stem cells in a medium for cardiomyocyte differentiation to obtain a cell population comprising cardiomyocytes or myocardial progenitor cells and other cells; and (2) culturing the cell population in the presence of a receptor tyrosine kinase inhibitor (excluding an EGF receptor inhibitor). And (2) a step of culturing the cell population.SELECTED DRAWING: None
Owner:ORIZURU THERAPEUTICS INC