9 results about "EGF Receptors" patented technology

The present invention relates to a peptide of 12 to 30 amino acids, said peptide comprising the sequence SEQ ID NO: 1 represented by:(SEQ ID NO: 1)V-X1-X2-R-X3-E-W-X4-X5-X6-Y-W,wherein each of X1, X2, X3, X4, X5, and X6 independently corresponds to any amino acid, andwherein said peptide binds to the EGF receptor variant III (EGFRvIII), as well as products incorporating such peptide and uses thereof.

The present invention relates to an epidermal growth factor derivative called mdEGF comprising or consisting of the amino acid sequence: NSDSECPLSHDGYCLHDGVCGYTEAGDKYACDCVVGYIGERCQYRDLKWWELR. The present invention also relates to the use of the epidermal growth factor derivative mdEGF in preventing and / or treating a disease related to increased activity of EGF receptor (EGFR), namely, cancer.

The present invention discloses an epidermal growth factor - linker polypeptide - collagen, and the linker polypeptide has an amino acid sequence as shown in SEQ ID No.1. In the present invention, a linker polypeptide capable of connecting EGF and collagen is designed and synthesized. The N - terminal of the linker polypeptide mimics the EGF receptor structure and can bind to EGF, and the connection between the linker polypeptide and EGF is through non - covalent van der Waals forces, which will not destroy the structure of EGF; the C - terminal of the linker polypeptide is rich in lysine residues and can be covalently cross - linked to collagen through transglutaminase to form EGF - linker polypeptide - collagen. The protein solution with the above - mentioned EGF - linker polypeptide - collagen as the active ingredient not only has low cytotoxicity and high biological safety, but also can significantly prolong the action time of epidermal growth factor. In addition, it can form a stable repair microenvironment on the surface of the endometrium and significantly improve the repair effect of endometrial injury.

The present invention relates inter alia to pharmaceutical compositions and kits comprising (i) an inhibitor of the expression, activity and / or function of c-Raf, (ii) an inhibitor of the expression, activity and / or function of EGF Receptor (EGFR), or (iii) an inhibitor of the expression, activity and / or function of STAT3, for use in combination in the prevention and / or treatment of cancer.

Disclosed herein are compounds that may be specific to PPAR and / or EGF receptors, and methods of making and using same.

The present invention relates to a combination of a corticosteroid agent and a heparin-binding epidermal growth factor-like growth factor (HB-EGF) inhibitor for use in the treatment of nephropathy associated with the activation of the HB-EGF / EGF receptor pathway.

The present invention relates to pharmaceutical compositions comprising inhibitors of c-Raf expression, activity and / or function, inhibitors of EGF receptor (EGFR) expression, activity and / or function, and inhibitors of STAT3 expression, activity and / or function, and their use in the treatment of pancreatic cancer.

The present invention provides: a therapeutic agent for diabetes in mammals comprising a heparin-binding epidermal growth factor-like growth factor ectodomain (HB-EGF ECD) fragment or a nucleic acid encoding the same; the preparation combining hepatocyte growth factor (HGF) or a fragment thereof or a nucleic acid encoding the same; and a therapeutic agent for diabetes in mammals comprising a substance that potentiates signal transduction via the HB-EGF receptors.

To provide a method for producing a cardiac muscle cell by using a receptor type tyrosine kinase inhibitor, and to provide a method for purifying the cardiac muscle cell.SOLUTION: A method for producing a cell population comprising cardiomyocytes, comprising the steps of: (1) culturing pluripotent stem cells in a medium for cardiomyocyte differentiation to obtain a cell population comprising cardiomyocytes or myocardial progenitor cells and other cells; and (2) culturing the cell population in the presence of a receptor tyrosine kinase inhibitor (excluding an EGF receptor inhibitor). And (2) a step of culturing the cell population.SELECTED DRAWING: None