The present invention relates to an
epidermal growth factor derivative called mdEGF comprising or consisting of the
amino acid sequence: NSDSECPLSHDGYCLHDGVCGYTEAGDKYACDCVVGYIGERCQYRDLKWWELR. The present invention also relates to the use of the
epidermal growth factor derivative mdEGF in preventing and / or treating a
disease related to increased activity of EGF
receptor (EGFR), namely,
cancer.