4results about How to "Good cell permeability" patented technology

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The present application belongs to the technical field of natural product chemical modification, and particularly relates to a chemically modified rare ginsenoside derivative, a preparation method and application thereof. The present application takes rare ginsenoside as raw material, introduces a sulfate group by sulfating modification on the rare ginsenoside to obtain a chemically modified rare ginsenoside derivative; the modifier used in the sulfating modification is a sulfonating agent. The rare ginsenoside is synthesized by conversion with ginsenoside Rb1 as raw material and AlCl3 as catalyst in an ethanol system. The modification method of the present application is simple in operation steps, does not require special equipment, is suitable for large-scale production, and has a broad application prospect in the field of drug preparation development and the like.

The invention discloses an application of an RAR alpha specific antagonist in prevention and treatment of porcine reproductive and respiratory syndrome. According to the application, the fact that the RAR alpha specific antagonist ER 50891 has the anti-PRRSV effect is found for the first time, it is shown that the ER 50891 can remarkably inhibit replication and proliferation of the PRRSV, inhibit PRRSV N protein expression and reduce the PRRSV titer and has the remarkable antiviral effect, and the effect of the ER 50891 is dose-dependent. Meanwhile, the ER 50891 has a broad-spectrum antiviral effect on the PRRSV, and still has a relatively good antiviral effect on different strains and the high-pathogenicity PRRSV (HP-PRRSV). The invention discloses the new application of the ER 50891 in the anti-PRRSV aspect for the first time, a new candidate compound is provided for research and development of anti-PRRSV drugs, and a new strategy and means are also provided for clinical prevention and treatment of porcine reproductive and respiratory syndrome.