76 results about "High serum" patented technology

The invention discloses a probiotic with the depression improving effect and a microecological preparation and application thereof, and is characterized in that the probiotic comprises lactobacillus mucus PC17 with the preservation number of CGMCC No.33866, the active ingredients of the lactobacillus microecological preparation comprise thalli of the lactobacillus mucus PC17, and a preparation method of the microecological preparation comprises the following steps: adding the lactobacillus mucus PC17 into the lactobacillus mucus PC17, uniformly mixing the lactobacillus mucus PC17, the lactobacillus mucus PC17, the lactobacillus mucus PC17, the lactobacillus mucus PC17, the lactobacillus mucus PC17, the lactobacillus mucus PC17 and the lactobacillus mucus PC17 The lactic acid bacteria are inoculated into a fermentation culture medium according to a volume ratio of 1-5% to prepare the lactic acid bacteria microecological preparation, can be used for preparing antidepressant drugs, and has the advantages of being capable of promoting RIN14B cells to secrete 5-hydroxytryptamine and 5-hydroxytryptophan, reducing the levels of interleukin-1beta, interleukin-6, tumor necrosis factor-alpha, corticosterone and corticotropin in serum, and improving the antidepressant activity of the antidepressant drugs. The levels of aminobutyric acid and brain-derived neurotrophic factors in serum are improved, and the depression-like behaviors of CUMS depression model mice are obviously improved.

The invention belongs to the technical field of biological medicine, and discloses a probiotic agent capable of improving the physiological activity function of vitamin D and maintaining bone health and application of the probiotic agent. The invention provides a probiotic agent composed of bifidobacterium adolescentis and bifidobacterium longum, the probiotic agent can significantly improve the bone mineral density, the bone trabecula thickness, the bone trabecula number, the bone trabecula connectivity and the bone volume fraction of an osteoporosis mouse, and meanwhile, the bone trabecula separation degree of the osteoporosis-removed mouse is significantly reduced; the level of vitamin D metabolites such as 25-hydroxy vitamin D and 1, 25-dihydroxy vitamin D in mouse serum is improved; the content of serum calcium and alkaline phosphatase in serum of mice is reduced, and the level of osteocalcin and type I procollagen amino terminal peptide in the serum is improved. The probiotic agent can relieve bone calcium loss, maintain bone health, repair bone injury, increase osteoblasts and reduce the osteoporosis degree, and can be used for preparing drugs for preventing and / or treating osteoporosis or preparing health care products or food beneficial to improving bone mineral density.

The invention provides a strain of lactobacillus plantarum YS-AG23 with high antioxidant activity, and a rhizoma polygonati and radix angelicae sinensis fermented product obtained by fermenting rhizoma polygonati and radix angelicae sinensis with the strain of lactobacillus plantarum YS-AG23. In a D-galactose induced premature ovarian failure mouse model, the fermentation product can regulate up the levels of antioxidant and stress protection genes SOD2 and HO-1 and an anti-aging gene SIRT1 by regulating down the expression of a key gene AGER of an inflammation and oxidative stress pathway, so that the oxidative stress and inflammatory response of model mouse ovarian tissues are remarkably reduced; meanwhile, the serum hormone level can be specifically adjusted, the serum estradiol (E2) level can be increased, the follicle stimulating hormone (FSH) and luteinizing hormone (LH) levels can be reduced to be close to the normal range, the expression of anti-mullerian hormone (AMH) and hormone regulatory gene LHR of ovarian reserve markers can be up-regulated, the proliferative activity and estrogen secretion function of follicular granulosa cells can be improved, and the effect of preventing ovarian reserve is achieved. The wet weight of atrophic uterus and ovary of the model mouse is remarkably increased, uterine and ovary atrophy is effectively reversed, and the ovarian reserve function of the D-galactose induced premature ovarian failure model mouse is recovered. Besides, in an H2O2-induced human dermal fibroblast aging model, the yeast can improve the activity of aging cells in a concentration-dependent manner and reduce the level of reactive oxygen species (ROS) in the cells; in addition, by up-regulating the expression of a collagen synthesis key gene COL1A1 and down-regulating the expression of a cell senescence marker gene p16, skin cell senescence caused by oxidative stress can be effectively improved. In conclusion, the polygonatum sibiricum and angelica sinensis leavening can synchronously improve premature ovarian failure and skin cell senescence caused by oxidative stress by accurately regulating and controlling oxidative stress, inflammatory response and tissue function related genes, and has wide application potential.

The invention provides a fructus cannabis protein peptide capable of reducing blood sugar and regulating glycometabolism and a preparation method and application thereof, and belongs to the technical field of functional active peptides, and the preparation method comprises the following steps: performing low-temperature supersonic fluid crushing on fructus cannabis, performing enzymolysis pretreatment on the crushed fructus cannabis, adding compound protease for enzymolysis, adding PNGaseF enzyme for further enzymolysis, and performing freeze drying to obtain the fructus cannabis protein peptide capable of reducing blood sugar and regulating glycometabolism. And carrying out membrane ultrafiltration interception and enrichment on the enzymolysis supernatant, carrying out tangential flow filtration, concentrating, drying and sterilizing to obtain the fructus cannabis protein peptide. Tests prove that the novel fructus cannabis protein peptide has the following remarkable effects that the fasting blood glucose level can be remarkably reduced, and uncomfortable symptoms such as thirst, polydipsia, diuresis and weakness caused by hyperglycemia are relieved; the symptoms of glucose intolerance and insulin resistance caused by hyperglycemia can be obviously relieved, and the onset risk of type 2 diabetes mellitus is reduced; the level of fasting serum insulin and glycosylated hemoglobin can be obviously reduced, and the level of serum GLP-1 can be improved.

The invention discloses bifidobacterium longum subsp.infantis capable of promoting bone growth and a metagen thereof, and belongs to the technical field of biology. The bifidobacterium longum subsp. Infantis CCFM1445 provided by the invention can promote the increase of bone volume fraction, femoral bone trabecula thickness and far-end growth plate thickness of mammals in a growth period, reduce the levels of serum bone resorption markers I-type collagen amino-terminal peptide and tartrate-resistant acid phosphatase, improve the levels of serum bone alkaline phosphatase and parathyroid hormone, and improve the clinical application value of the bifidobacterium longum subsp. Infantis CCFM1445. And the relative abundance of the other bacteria in the intestinal flora and the levels of creatine and indole-3-lactic acid are increased. The thermally inactivated bifidobacterium longum subsp. Infantis CCFM1445 can promote the increase of the volume fraction of femoral bones and the number of bone trabecula of malnourished mice and improve the N-terminal propeptide level of serum I-type procollagen. Therefore, the medicine or health care product prepared from the bifidobacterium longum subsp. Infantis CCFM1445 can be used for assisting in regulating bone metabolism and bone mass, and has a wide market prospect.

The invention provides application of combination of antrodia camphorata polysaccharide and forsythin in preparation of drugs for treating metabolic diseases related to insulin resistance, and belongs to the technical field of biological medicines. The metabolic diseases related to insulin resistance include polycystic ovarian syndrome. Animal experiments find that the combination of the antrodia camphorata polysaccharide and forsythin can significantly reduce serum testosterone and luteinizing hormone levels of a rat with the polycystic ovarian syndrome, improve serum follicular hormone and estradiol levels, and achieve the effect of improving the polycystic ovarian syndrome.

The invention relates to a preparation method and application of a medicine-food homologous compound with weight-losing and lipid-lowering effects. According to the present invention, the weight of the obese mouse can be reduced by 23.23% at most, the serum total cholesterol is reduced, the leptin secretion is reduced, AST (aspartate transaminase) and ALT (alanine transaminase) have no significant difference compared to the model mouse, the volume of epididymal fat and inguinal fat cells is reduced, the number of cells in unit area is significantly increased, the fatty liver sample is relieved, the TMEM26 gene expression in the epididymal fat is significantly increased, and the weight of the obese mouse can be significantly reduced; the expression quantity of the UCP1 gene in brown fat is obviously increased. The traditional Chinese medicine composition adopts medicinal and edible substances as raw materials, is widely applicable to people, is more suitable for prevention and treatment of chronic diseases, is safe and effective, and causes little damage to liver and kidney after long-term use.

The invention relates to N-fluorenylmethoxycarbonyl-L-2-amino-5-phenylpentanoic acid or a pharmaceutical composition and application thereof, and relates to the technical field of biological medicines. According to the application disclosed by the invention, the N-fluorenylmethoxycarbonyl-L-2-amino-5-phenylpentanoic acid is found to have the effects of reducing total cholesterol, triglyceride and low-density lipoprotein cholesterol in serum and increasing high-density lipoprotein cholesterol in serum for the first time; the compound can be used for preparing a medicine for reducing total cholesterol in serum, a medicine for reducing triglyceride in serum, a medicine for reducing low-density lipoprotein cholesterol in serum and a medicine for increasing high-density lipoprotein cholesterol in serum, and can be used for preparing medicines for reducing total cholesterol in serum, triglyceride in serum, low-density lipoprotein cholesterol in serum and high-density lipoprotein cholesterol in serum. And an effective new means and a new way are provided for preparing the medicine for preventing or treating the hyperlipemia.

The invention relates to an MPL composite adjuvant and a preparation method thereof, and belongs to the technical field of vaccine adjuvants. The composite adjuvant comprises neutral phospholipid, anionic phospholipid, cholesterol, monophosphoryl lipid A, QS-21 and surface modified lipid. The preparation method comprises the following steps: dissolving a lipid component in an organic solvent to form a mixed solution, evaporating the solvent to form a lipid film, adding a buffer solution, hydrating to form a liposome suspension, performing ultrasonic treatment to obtain small single-layer liposome, and mixing the small single-layer liposome with a QS-21 micelle solution. By introducing the surface modified lipid, the stability of the adjuvant is remarkably improved, the adjuvant is small in particle size, uniform in distribution, high in Zeta potential negative value and good in stability in a serum environment, can induce high-level antibody immune response, and is suitable for vaccine development.

The invention relates to a serum quality detection device and a serum quality detection method. The device for detecting the serum quality comprises a sample base for placing a container filled with a blood sample; the rotating mechanism is used for rotating the sample base to drive a container placed in the sample base to rotate; the camera is used for shooting the blood sample in the container in the rotating process of the container so as to obtain a plurality of sample images of the blood sample; and a processor configured to acquire one or more indices of a chyle index, a hemolysis index, and a jaundice index of the blood sample based on the plurality of sample images. Therefore, the accuracy of serum quality detection can be improved.

The invention discloses bifidobacterium adolescentis for relieving estrogen-related metabolic disorder and obesity and application thereof, and belongs to the technical field of microorganisms. The bifidobacterium adolescentis CCFM1506 screened by the invention can effectively improve ovariectomized individual estrogen disorder symptoms, obviously slow down the weight increase speed and weight increment of estrogen disorder individuals, increase the expression quantity of serum estradiol, CYP11A1 and ERalpha in adrenal gland and the high-density lipoprotein content in serum, reduce the total cholesterol and glucose level and improve the ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized abnormal glucose and lipid metabolism is adjusted; the invention has the advantages of simple preparation method and wide application prospect, can be used for preparing medicines for relieving or treating estrogen-related metabolic disorders and obesity, and can be used for preparing health-care products beneficial to controlling in-vivo fat and maintaining the health level of blood fat, and has obvious physiological effects and wide application prospects, and can be used for preparing the medicines for relieving or treating the estrogen-related metabolic disorders and obesity and preparing health-care products beneficial to controlling in-vivo fat and maintaining the health level of blood fat. A new thought and a new basis are provided for developing functional foods or medicines based on the probiotics.

The invention discloses a nanocomposite HA / PEI / Fe3O4 (at) siRNA and a preparation method and application thereof, and belongs to the technical field of antitumor drugs. The nano-composite HA / PEI / Fe3O4 coated siGPX4 is successfully prepared, the serum stability is high, the blood compatibility is good, siGPX4 can be efficiently released when the nano-composite reaches a tumor acidic microenvironment, then the anti-tumor effect is exerted, triple negative breast cancer cells can be specifically targeted, the internalization ability of MDA-MB-468 cells on the nano-composite is greatly improved, and the delivery efficiency of siGPX4 is remarkably improved; in the presence of H2O2, the nano-composite can down-regulate expression of GPX4, released ferrous ions and H2O2 are subjected to Fenton reaction, ROS in cells is remarkably increased, mitochondrial membrane potential is reduced, ferroptosis is triggered, MDA-MB-468 cell proliferation is remarkably inhibited, and the anti-tumor effect is achieved.

The present invention discloses applications and methods of Leuconostoc mesenteroides, relating to the field of microbial technology. Leuconostoc mesenteroides can be used to prepare phytic acid and improve non-alcoholic fatty liver disease, increased liver weight, elevated blood lipids, elevated blood sugar, elevated serum lipopolysaccharide levels, elevated serum insulin levels, inflammatory responses, and elevated triglyceride levels in the liver caused by a high-fat, high-sugar diet, and inhibit the release of the pro-inflammatory cytokine lipopolysaccharide.

The application discloses an immune function enhancing composition which is mixed by sambucus williamsii alcohols extract and lactobacillus rhamnosus agent. The application can effectively immunize the spleen, improve the spleen index and thymus index, has the function of immune regulation, and can also improve the IgM and IgG content in serum.

The application relates to the technical field of medicines, and discloses application of gymnemon and a medicine thereof.According to the application, the gymnemon can be used for preparing medicines related to cardiovascular diseases, including medicines for improving heart failure, inhibiting myocardial hypertrophy, improving vascular endothelial function and reducing blood pressure, and further used for preparing medicines for reducing expressions of vascular cell adhesion molecule 1 and intercellular adhesion molecule 1 and / or increasing serum NO level; the gymnemon can also be used for preparing medicines for regulating abnormal lipid metabolism, including medicines for reducing triglyceride and total cholesterol level; the gymnemon can also be used for preparing medicines for relieving liver injury, including medicines for reducing glutamic-pyruvic transaminase and glutamic-oxalacetic transaminase level; and the gymnemon can also be used for preparing medicines for improving systemic inflammation and / or platelet and thrombin dysfunction.

The application provides application of a Baoji oral liquid composition in preparation of a functional dyspepsia medicine, and relates to the technical field of medicines. The application is based on the Baoji oral liquid, and it is found that the Baoji oral liquid has a remarkable effect on treating functional dyspepsia, especially cisplatin-induced functional dyspepsia. Specifically, the Baoji oral liquid can rapidly restore body weight, significantly improve body weight gain, steadily promote food intake, significantly improve gastric emptying rate and intestinal propulsion rate, protect the gastric mucosa layer, reduce inflammatory cell infiltration, repair the mucosa layer and muscle layer, improve the expression of serum gastrin and motilin, and improve the expression level of IL-4 in the gastric tissue and reduce the expression level of IL-1beta. The Baoji oral liquid has remarkable efficacy when applied in preparation of a functional dyspepsia medicine.

The invention relates to the technical field of biology, in particular to recombinant lactic acid bacteria capable of improving the serum melatonin level and a construction method of the recombinant lactic acid bacteria. According to the recombinant lactic acid bacteria, melatonin synthetase AANAT and HIOMT genes are introduced through a genetic engineering technology and are stably expressed in genomes of the recombinant lactic acid bacteria, so that the recombinant lactic acid bacteria have the capability of secreting melatonin synthetase. The lactic acid bacteria are food-grade strains without resistance selection markers, have good biological safety and can enter intestinal tracts through oral administration. After oral administration, the recombinant lactic acid bacteria secrete melatonin synthetase in intestinal tracts, promote intestinal cells to synthesize melatonin, and improve the level of melatonin in serum through an intestinal-blood barrier. Serum detection shows that the recombinant lactic acid bacteria can significantly improve the concentration of serum melatonin. Compared with the prior art, the invention provides a safe and effective food-grade recombinant lactic acid bacteria preparation which is suitable for promoting the improvement of the endogenous melatonin level of a human body and has a wide application prospect.

The present disclosure relates to antibodies that bind the extracellular domain of human TREM2 and the use of anti-TREM2 antibodies in therapy, prophylaxis, diagnosis, screening, and monitoring, including for increasing levels of soluble TREM2 (sTREM2) in serum and brain, increasing phagocytosis by microglia and / or macrophages, and developing treatments to address TREM2-mediated conditions that may benefit from enhanced phagocytosis by microglia and / or macrophages.

The invention relates to the technical field of serum filtration, in particular to a digital quality monitoring system for a bovine serum filtration process based on intelligent control, which comprises a serum evaluation module for calculating a bubble risk evaluation value according to transmembrane pressure difference, actual serum flow and actual serum viscosity of serum at different moments, determining the risk state of bubbles generated by serum according to the bubble risk evaluation value, and limiting the upper limit of flow regulation or reducing the initial filtering pump speed; the lipid analysis module is used for determining the turbidity change according to the actual serum turbidity and the initial background turbidity, determining whether the serum is in the initial stage of lipid aggregation or not according to the turbidity change and the particle size distribution peak value, correspondingly regulating and controlling the serum temperature and determining the adjusted initial filtering pump speed according to the correction results of the control regulation module and the detection correction module. According to the invention, the accuracy of serum filtration and quality monitoring is improved by performing bubble risk assessment and viscosity feedback control on the bovine serum filtration process.

The invention relates to a preparation method of alkaline health-preserving white spirit. The pH value of the alkaline health-preserving white spirit is close to that of human body fluid, so that the alkaline health-preserving white spirit can improve human body constitution, activate and regenerate cells and enhance immunity after being drunk for a long time, and is good in drinking taste and relatively light in liver and kidney burden after being drunk. Wherein the selected Chinese wolfberry fruits have the effects of promoting immunity, resisting aging, scavenging free radicals and resisting fatigue, and the Chinese dates can promote the generation of leukocytes, reduce serum cholesterol, improve serum albumin and protect the liver. Ganoderma lucidum is sweet and bitter in taste and slightly cold in nature and has the effects of clearing heat and moistening the lung. The herba artemisiae scopariae can promote liver cell membranes, prevent liver cell necrosis and promote liver cell regeneration and liver microcirculation, and the medicinal functions and taste of the baijiu are enriched in cooperation with various traditional Chinese medicinal materials and fruits. The preparation method is simple, ensures that the raw stock base liquor fully absorbs various nutritional ingredients, can shorten the production cycle, and is suitable for large-scale production.

The present invention discloses the preparation of Sipunculus nudus hypoglycemic peptide and its application in the preparation of drugs for regulating blood glucose and blood lipids in type 2 diabetes, belonging to the field of biomedical technology. The Sipunculus nudus polypeptide provided by the present invention can significantly reduce the blood glucose concentration of T2DM, regulate the level of insulin resistance, inhibit the levels of triglyceride and low-density lipoprotein cholesterol in the serum of T2DM, increase the level of high-density lipoprotein cholesterol, and at the same time has a protective effect on the pathological changes of pancreatic tissue. In addition, administration of Sipunculus nudus polypeptide can increase the activity of SOD in the serum and inhibit the expression of malondialdehyde, a lipid peroxidation marker. The Sipunculus nudus polypeptide can significantly improve the abnormal blood glucose and blood lipids in type 2 diabetes, and has no toxicity or side effects on animals and will not accumulate in animals. Therefore, the Sipunculus nudus polypeptide can be used to prepare drugs or foods for regulating blood glucose and blood lipids in type 2 diabetes.

The invention belongs to the technical field of microbial fermentation, and particularly relates to saccharomycetes SY and application thereof in preparation of a codonopsis pilosula fermentation product which is high in in-vivo and in-vitro bioavailability and capable of improving gastrointestinal motility. The codonopsis pilosula fermented product is prepared by fermenting codonopsis pilosula with saccharomycetes SY. The content of lobetyolin in the pilose asiabell root leavening prepared by fermenting pilose asiabell root through the saccharomycetes SY is high, in-vitro digestion experiments prove that the removal rate of lobetyolin, total flavonoids and superoxide anion free radicals and the bioaccessibility of the total reducing capacity are remarkably improved, and rat experiments find that the pilose asiabell root leavening can promote gastrointestinal motility and improve the bioavailability of the pilose asiabell root. Intestinal mucosa regeneration and barrier repair are promoted; the content of effective components such as luteolin 7-glucosid-3 '-xyloside capable of enhancing immune cell activity, regulating inflammatory factor balance, protecting cells from oxidative stress injury and improving gastrointestinal digestion and absorption functions and energy metabolism in serum is increased, and absorption of the effective components in blood is promoted.

The application discloses a group of low-toxicity broad-spectrum antibacterial peptides containing a central PXXP hinge structure and application thereof. The low-toxicity broad-spectrum antibacterial peptides are obtained by using a head design method, using positively charged lysine (Lys, K) and hydrophobic tryptophan (Trp, W), symmetrically arranging the two kinds of amino acids alternately and repeatedly, and introducing a PXXP hinge structure containing proline into the symmetry center of the antibacterial peptide sequence. The structural general formula is (KW) n PXXP(WK) n wherein XX=KK, n=2-4 or XX=WK, n=2-3. In-vitro antibacterial experiments show that the antibacterial peptides have broad-spectrum antibacterial activity; the preferred antibacterial peptides have the advantages of low hemolytic toxicity and high serum stability. Induced drug resistance experiments show that the preferred antibacterial peptides have the characteristics of low drug resistance occurrence. In-vivo acute toxicity experiment results show that, compared with a control drug Polymyxin B, the preferred antibacterial peptides have higher in-vivo safety. Therefore, the antibacterial peptides have good application prospects in the preparation of clinical antibacterial drugs and are expected to become new antibiotic candidate drugs.

The present invention relates to: a novel anti-C5 antibody that completely inhibits the activity of complement C5 by significantly reducing free C5 (unbound C5); and use thereof. The anti-C5 antibody according to the present invention can significantly reduce the concentration of free C5 in serum and simultaneously inhibit the classical and alternative pathways of a complement system. In addition, the anti-C5 antibody according to the present invention stably inhibited complement activity of both pathways even when the serum ratio was increased in in vitro hemolytic assays, and exhibits an excellent inhibitory effect compared to previously known antibodies, and such an inhibitory effect was consistently observed even under clinical conditions with high serum concentrations. Therefore, the anti-C5 antibody of the present invention can be effectively used for the prevention or treatment of various autoimmune diseases, including myasthenia gravis, age-related macular degeneration, and paroxysmal nocturnal hemoglobinuria.

The present invention provides compositions and methods for treating a hypophosphatemic disorder, such as X-linked hypophosphatemia (XLH). The method entails administering to a subject a pharmaceutical composition containing an anti-FGF23 ligand, wherein the dosing regimen of the pharmaceutical is designed to reach effective and efficient control of FGF23 activity.

The invention provides an application of a BCMA-CD19 bispecific CAR (Chimeric Antigen Receptor)-immune cell in the treatment of membranous nephropathy. Specifically, the invention provides a BCMA-CD19 bispecific CAR or a coding nucleic acid thereof, or a carrier thereof, or an application of a CAR-immune cell thereof, and the BCMA-CD19 bispecific CAR or the coding nucleic acid thereof, or the carrier thereof, or the CAR-immune cell thereof is used for (i) preparing a medicine for preventing and / or treating membranous nephropathy (MN); (ii) preparing a medicine for reducing the urine protein level; (iii) preparing a medicine for reducing the PLA2R antibody titer; (iv) preparing a medicine for improving the serum albumin level; and / or (v) preparing a medicine for improving the renal function eGFR level. The invention also provides a method for reducing urine protein level, reducing PLA2R antibody titer, increasing serum albumin level and / or increasing renal function eGFR level and a method for preventing and / or treating membranous nephropathy (MN) by using the BCMA-CD19 bispecific CAR or a coding nucleic acid thereof, or a carrier thereof, or a CAR-immune cell thereof, or a pharmaceutical composition. The BCMA-CD19 bispecific CAR-immune cell provided by the invention has very good safety and effectiveness, and can achieve the purpose that patients with high-risk, recurrent or refractory membranous nephropathy can continuously obtain clinical deep relief treatment.

The invention belongs to the technical field of pharmaceutical preparations, and particularly relates to application of a qi-tonifying and blood-maintaining preparation in preparation of a medicine for treating thalassemia. Researches show that the preparation for tonifying qi and maintaining blood is used for treating thalassemia and can effectively improve the anemia state and iron metabolism disorder of patients. Specifically, the medicine can significantly improve the hemoglobin level, increase the red blood cell count and the red blood cell average volume, and improve the serum iron content, the ferritin content and the reticulocyte proportion. The results show that the qi-tonifying and blood-maintaining preparation has the effect of promoting the bone marrow hematopoiesis function and can regulate and optimize the iron metabolism process. The invention provides an economical, effective and convenient treatment scheme for the thalassemia patient.

A bioactive peptide PCT-1, a preparation method therefor, and a use thereof, relating to the technical field of biology. The amino acid sequence of the bioactive peptide PCT-1 is LNRTFE, as shown in SEQ ID NO: 1 in a sequence listing, and the bioactive peptide PCT-1 has antioxidant and intestinal flora regulation functions. The bioactive peptide PCT-1 is extracted from a spirulina protein peptide and can significantly improve the activity of SOD and GSH-Px in serum and significantly reduce the content of MDA in the serum. The in vivo antioxidant activity of the bioactive peptide is equivalent to that of a positive control Trolox. Moreover, compared with a blank control group, the bioactive peptide PCT-1 can also reduce the α diversity index of the intestinal flora, change the overall structure of the intestinal flora, regulate the abundance of intestinal flora at various taxonomic levels, and significantly increase the content of acetic acid and butyric acid, and can be applied to foods having antioxidant and intestinal flora regulation functions.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention belongs to the field of biological medicines, and particularly relates to application of medicarpin in preparation of medicines for preventing and / or treating immunosuppressive diseases. According to the application disclosed by the invention, it is found that the mendalin can increase the content of IL-3 and M-CSF in serum, reduce the content of EPO and increase the content of IL-34 and IL-15 in bone marrow at the same time; and the red sandalwood can increase the number of leukocytes, platelets and basophilic granulocytes in peripheral blood and enhance the multiplication capacity of bone marrow cells, so that the red sandalwood can be used for preventing and / or treating the immunosuppressive diseases, and is further used for preparing the medicines for preventing and / or treating the immunosuppressive diseases.