56 results about "High serum" patented technology

The invention belongs to the technical field of biological medicine, and discloses a probiotic agent capable of improving the physiological activity function of vitamin D and maintaining bone health and application of the probiotic agent. The invention provides a probiotic agent composed of bifidobacterium adolescentis and bifidobacterium longum, the probiotic agent can significantly improve the bone mineral density, the bone trabecula thickness, the bone trabecula number, the bone trabecula connectivity and the bone volume fraction of an osteoporosis mouse, and meanwhile, the bone trabecula separation degree of the osteoporosis-removed mouse is significantly reduced; the level of vitamin D metabolites such as 25-hydroxy vitamin D and 1, 25-dihydroxy vitamin D in mouse serum is improved; the content of serum calcium and alkaline phosphatase in serum of mice is reduced, and the level of osteocalcin and type I procollagen amino terminal peptide in the serum is improved. The probiotic agent can relieve bone calcium loss, maintain bone health, repair bone injury, increase osteoblasts and reduce the osteoporosis degree, and can be used for preparing drugs for preventing and / or treating osteoporosis or preparing health care products or food beneficial to improving bone mineral density.

The invention provides a strain of lactobacillus plantarum YS-AG23 with high antioxidant activity, and a rhizoma polygonati and radix angelicae sinensis fermented product obtained by fermenting rhizoma polygonati and radix angelicae sinensis with the strain of lactobacillus plantarum YS-AG23. In a D-galactose induced premature ovarian failure mouse model, the fermentation product can regulate up the levels of antioxidant and stress protection genes SOD2 and HO-1 and an anti-aging gene SIRT1 by regulating down the expression of a key gene AGER of an inflammation and oxidative stress pathway, so that the oxidative stress and inflammatory response of model mouse ovarian tissues are remarkably reduced; meanwhile, the serum hormone level can be specifically adjusted, the serum estradiol (E2) level can be increased, the follicle stimulating hormone (FSH) and luteinizing hormone (LH) levels can be reduced to be close to the normal range, the expression of anti-mullerian hormone (AMH) and hormone regulatory gene LHR of ovarian reserve markers can be up-regulated, the proliferative activity and estrogen secretion function of follicular granulosa cells can be improved, and the effect of preventing ovarian reserve is achieved. The wet weight of atrophic uterus and ovary of the model mouse is remarkably increased, uterine and ovary atrophy is effectively reversed, and the ovarian reserve function of the D-galactose induced premature ovarian failure model mouse is recovered. Besides, in an H2O2-induced human dermal fibroblast aging model, the yeast can improve the activity of aging cells in a concentration-dependent manner and reduce the level of reactive oxygen species (ROS) in the cells; in addition, by up-regulating the expression of a collagen synthesis key gene COL1A1 and down-regulating the expression of a cell senescence marker gene p16, skin cell senescence caused by oxidative stress can be effectively improved. In conclusion, the polygonatum sibiricum and angelica sinensis leavening can synchronously improve premature ovarian failure and skin cell senescence caused by oxidative stress by accurately regulating and controlling oxidative stress, inflammatory response and tissue function related genes, and has wide application potential.

The invention discloses bifidobacterium longum subsp.infantis capable of promoting bone growth and a metagen thereof, and belongs to the technical field of biology. The bifidobacterium longum subsp. Infantis CCFM1445 provided by the invention can promote the increase of bone volume fraction, femoral bone trabecula thickness and far-end growth plate thickness of mammals in a growth period, reduce the levels of serum bone resorption markers I-type collagen amino-terminal peptide and tartrate-resistant acid phosphatase, improve the levels of serum bone alkaline phosphatase and parathyroid hormone, and improve the clinical application value of the bifidobacterium longum subsp. Infantis CCFM1445. And the relative abundance of the other bacteria in the intestinal flora and the levels of creatine and indole-3-lactic acid are increased. The thermally inactivated bifidobacterium longum subsp. Infantis CCFM1445 can promote the increase of the volume fraction of femoral bones and the number of bone trabecula of malnourished mice and improve the N-terminal propeptide level of serum I-type procollagen. Therefore, the medicine or health care product prepared from the bifidobacterium longum subsp. Infantis CCFM1445 can be used for assisting in regulating bone metabolism and bone mass, and has a wide market prospect.

The invention relates to a preparation method and application of a medicine-food homologous compound with weight-losing and lipid-lowering effects. According to the present invention, the weight of the obese mouse can be reduced by 23.23% at most, the serum total cholesterol is reduced, the leptin secretion is reduced, AST (aspartate transaminase) and ALT (alanine transaminase) have no significant difference compared to the model mouse, the volume of epididymal fat and inguinal fat cells is reduced, the number of cells in unit area is significantly increased, the fatty liver sample is relieved, the TMEM26 gene expression in the epididymal fat is significantly increased, and the weight of the obese mouse can be significantly reduced; the expression quantity of the UCP1 gene in brown fat is obviously increased. The traditional Chinese medicine composition adopts medicinal and edible substances as raw materials, is widely applicable to people, is more suitable for prevention and treatment of chronic diseases, is safe and effective, and causes little damage to liver and kidney after long-term use.

The invention relates to N-fluorenylmethoxycarbonyl-L-2-amino-5-phenylpentanoic acid or a pharmaceutical composition and application thereof, and relates to the technical field of biological medicines. According to the application disclosed by the invention, the N-fluorenylmethoxycarbonyl-L-2-amino-5-phenylpentanoic acid is found to have the effects of reducing total cholesterol, triglyceride and low-density lipoprotein cholesterol in serum and increasing high-density lipoprotein cholesterol in serum for the first time; the compound can be used for preparing a medicine for reducing total cholesterol in serum, a medicine for reducing triglyceride in serum, a medicine for reducing low-density lipoprotein cholesterol in serum and a medicine for increasing high-density lipoprotein cholesterol in serum, and can be used for preparing medicines for reducing total cholesterol in serum, triglyceride in serum, low-density lipoprotein cholesterol in serum and high-density lipoprotein cholesterol in serum. And an effective new means and a new way are provided for preparing the medicine for preventing or treating the hyperlipemia.

The invention relates to an MPL composite adjuvant and a preparation method thereof, and belongs to the technical field of vaccine adjuvants. The composite adjuvant comprises neutral phospholipid, anionic phospholipid, cholesterol, monophosphoryl lipid A, QS-21 and surface modified lipid. The preparation method comprises the following steps: dissolving a lipid component in an organic solvent to form a mixed solution, evaporating the solvent to form a lipid film, adding a buffer solution, hydrating to form a liposome suspension, performing ultrasonic treatment to obtain small single-layer liposome, and mixing the small single-layer liposome with a QS-21 micelle solution. By introducing the surface modified lipid, the stability of the adjuvant is remarkably improved, the adjuvant is small in particle size, uniform in distribution, high in Zeta potential negative value and good in stability in a serum environment, can induce high-level antibody immune response, and is suitable for vaccine development.

The invention discloses bifidobacterium adolescentis for relieving estrogen-related metabolic disorder and obesity and application thereof, and belongs to the technical field of microorganisms. The bifidobacterium adolescentis CCFM1506 screened by the invention can effectively improve ovariectomized individual estrogen disorder symptoms, obviously slow down the weight increase speed and weight increment of estrogen disorder individuals, increase the expression quantity of serum estradiol, CYP11A1 and ERalpha in adrenal gland and the high-density lipoprotein content in serum, reduce the total cholesterol and glucose level and improve the ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized ovariectomized abnormal glucose and lipid metabolism is adjusted; the invention has the advantages of simple preparation method and wide application prospect, can be used for preparing medicines for relieving or treating estrogen-related metabolic disorders and obesity, and can be used for preparing health-care products beneficial to controlling in-vivo fat and maintaining the health level of blood fat, and has obvious physiological effects and wide application prospects, and can be used for preparing the medicines for relieving or treating the estrogen-related metabolic disorders and obesity and preparing health-care products beneficial to controlling in-vivo fat and maintaining the health level of blood fat. A new thought and a new basis are provided for developing functional foods or medicines based on the probiotics.

The application discloses an immune function enhancing composition which is mixed by sambucus williamsii alcohols extract and lactobacillus rhamnosus agent. The application can effectively immunize the spleen, improve the spleen index and thymus index, has the function of immune regulation, and can also improve the IgM and IgG content in serum.

The application relates to the technical field of medicines, and discloses application of gymnemon and a medicine thereof.According to the application, the gymnemon can be used for preparing medicines related to cardiovascular diseases, including medicines for improving heart failure, inhibiting myocardial hypertrophy, improving vascular endothelial function and reducing blood pressure, and further used for preparing medicines for reducing expressions of vascular cell adhesion molecule 1 and intercellular adhesion molecule 1 and / or increasing serum NO level; the gymnemon can also be used for preparing medicines for regulating abnormal lipid metabolism, including medicines for reducing triglyceride and total cholesterol level; the gymnemon can also be used for preparing medicines for relieving liver injury, including medicines for reducing glutamic-pyruvic transaminase and glutamic-oxalacetic transaminase level; and the gymnemon can also be used for preparing medicines for improving systemic inflammation and / or platelet and thrombin dysfunction.

The application provides application of a Baoji oral liquid composition in preparation of a functional dyspepsia medicine, and relates to the technical field of medicines. The application is based on the Baoji oral liquid, and it is found that the Baoji oral liquid has a remarkable effect on treating functional dyspepsia, especially cisplatin-induced functional dyspepsia. Specifically, the Baoji oral liquid can rapidly restore body weight, significantly improve body weight gain, steadily promote food intake, significantly improve gastric emptying rate and intestinal propulsion rate, protect the gastric mucosa layer, reduce inflammatory cell infiltration, repair the mucosa layer and muscle layer, improve the expression of serum gastrin and motilin, and improve the expression level of IL-4 in the gastric tissue and reduce the expression level of IL-1beta. The Baoji oral liquid has remarkable efficacy when applied in preparation of a functional dyspepsia medicine.

The present disclosure relates to antibodies that bind the extracellular domain of human TREM2 and the use of anti-TREM2 antibodies in therapy, prophylaxis, diagnosis, screening, and monitoring, including for increasing levels of soluble TREM2 (sTREM2) in serum and brain, increasing phagocytosis by microglia and / or macrophages, and developing treatments to address TREM2-mediated conditions that may benefit from enhanced phagocytosis by microglia and / or macrophages.

The invention relates to the technical field of serum filtration, in particular to a digital quality monitoring system for a bovine serum filtration process based on intelligent control, which comprises a serum evaluation module for calculating a bubble risk evaluation value according to transmembrane pressure difference, actual serum flow and actual serum viscosity of serum at different moments, determining the risk state of bubbles generated by serum according to the bubble risk evaluation value, and limiting the upper limit of flow regulation or reducing the initial filtering pump speed; the lipid analysis module is used for determining the turbidity change according to the actual serum turbidity and the initial background turbidity, determining whether the serum is in the initial stage of lipid aggregation or not according to the turbidity change and the particle size distribution peak value, correspondingly regulating and controlling the serum temperature and determining the adjusted initial filtering pump speed according to the correction results of the control regulation module and the detection correction module. According to the invention, the accuracy of serum filtration and quality monitoring is improved by performing bubble risk assessment and viscosity feedback control on the bovine serum filtration process.

The invention belongs to the technical field of microbial fermentation, and particularly relates to saccharomycetes SY and application thereof in preparation of a codonopsis pilosula fermentation product which is high in in-vivo and in-vitro bioavailability and capable of improving gastrointestinal motility. The codonopsis pilosula fermented product is prepared by fermenting codonopsis pilosula with saccharomycetes SY. The content of lobetyolin in the pilose asiabell root leavening prepared by fermenting pilose asiabell root through the saccharomycetes SY is high, in-vitro digestion experiments prove that the removal rate of lobetyolin, total flavonoids and superoxide anion free radicals and the bioaccessibility of the total reducing capacity are remarkably improved, and rat experiments find that the pilose asiabell root leavening can promote gastrointestinal motility and improve the bioavailability of the pilose asiabell root. Intestinal mucosa regeneration and barrier repair are promoted; the content of effective components such as luteolin 7-glucosid-3 '-xyloside capable of enhancing immune cell activity, regulating inflammatory factor balance, protecting cells from oxidative stress injury and improving gastrointestinal digestion and absorption functions and energy metabolism in serum is increased, and absorption of the effective components in blood is promoted.

The application discloses a group of low-toxicity broad-spectrum antibacterial peptides containing a central PXXP hinge structure and application thereof. The low-toxicity broad-spectrum antibacterial peptides are obtained by using a head design method, using positively charged lysine (Lys, K) and hydrophobic tryptophan (Trp, W), symmetrically arranging the two kinds of amino acids alternately and repeatedly, and introducing a PXXP hinge structure containing proline into the symmetry center of the antibacterial peptide sequence. The structural general formula is (KW) n PXXP(WK) n wherein XX=KK, n=2-4 or XX=WK, n=2-3. In-vitro antibacterial experiments show that the antibacterial peptides have broad-spectrum antibacterial activity; the preferred antibacterial peptides have the advantages of low hemolytic toxicity and high serum stability. Induced drug resistance experiments show that the preferred antibacterial peptides have the characteristics of low drug resistance occurrence. In-vivo acute toxicity experiment results show that, compared with a control drug Polymyxin B, the preferred antibacterial peptides have higher in-vivo safety. Therefore, the antibacterial peptides have good application prospects in the preparation of clinical antibacterial drugs and are expected to become new antibiotic candidate drugs.

The present invention relates to: a novel anti-C5 antibody that completely inhibits the activity of complement C5 by significantly reducing free C5 (unbound C5); and use thereof. The anti-C5 antibody according to the present invention can significantly reduce the concentration of free C5 in serum and simultaneously inhibit the classical and alternative pathways of a complement system. In addition, the anti-C5 antibody according to the present invention stably inhibited complement activity of both pathways even when the serum ratio was increased in in vitro hemolytic assays, and exhibits an excellent inhibitory effect compared to previously known antibodies, and such an inhibitory effect was consistently observed even under clinical conditions with high serum concentrations. Therefore, the anti-C5 antibody of the present invention can be effectively used for the prevention or treatment of various autoimmune diseases, including myasthenia gravis, age-related macular degeneration, and paroxysmal nocturnal hemoglobinuria.

The invention provides an application of a BCMA-CD19 bispecific CAR (Chimeric Antigen Receptor)-immune cell in the treatment of membranous nephropathy. Specifically, the invention provides a BCMA-CD19 bispecific CAR or a coding nucleic acid thereof, or a carrier thereof, or an application of a CAR-immune cell thereof, and the BCMA-CD19 bispecific CAR or the coding nucleic acid thereof, or the carrier thereof, or the CAR-immune cell thereof is used for (i) preparing a medicine for preventing and / or treating membranous nephropathy (MN); (ii) preparing a medicine for reducing the urine protein level; (iii) preparing a medicine for reducing the PLA2R antibody titer; (iv) preparing a medicine for improving the serum albumin level; and / or (v) preparing a medicine for improving the renal function eGFR level. The invention also provides a method for reducing urine protein level, reducing PLA2R antibody titer, increasing serum albumin level and / or increasing renal function eGFR level and a method for preventing and / or treating membranous nephropathy (MN) by using the BCMA-CD19 bispecific CAR or a coding nucleic acid thereof, or a carrier thereof, or a CAR-immune cell thereof, or a pharmaceutical composition. The BCMA-CD19 bispecific CAR-immune cell provided by the invention has very good safety and effectiveness, and can achieve the purpose that patients with high-risk, recurrent or refractory membranous nephropathy can continuously obtain clinical deep relief treatment.

The invention belongs to the technical field of pharmaceutical preparations, and particularly relates to application of a qi-tonifying and blood-maintaining preparation in preparation of a medicine for treating thalassemia. Researches show that the preparation for tonifying qi and maintaining blood is used for treating thalassemia and can effectively improve the anemia state and iron metabolism disorder of patients. Specifically, the medicine can significantly improve the hemoglobin level, increase the red blood cell count and the red blood cell average volume, and improve the serum iron content, the ferritin content and the reticulocyte proportion. The results show that the qi-tonifying and blood-maintaining preparation has the effect of promoting the bone marrow hematopoiesis function and can regulate and optimize the iron metabolism process. The invention provides an economical, effective and convenient treatment scheme for the thalassemia patient.

A bioactive peptide PCT-1, a preparation method therefor, and a use thereof, relating to the technical field of biology. The amino acid sequence of the bioactive peptide PCT-1 is LNRTFE, as shown in SEQ ID NO: 1 in a sequence listing, and the bioactive peptide PCT-1 has antioxidant and intestinal flora regulation functions. The bioactive peptide PCT-1 is extracted from a spirulina protein peptide and can significantly improve the activity of SOD and GSH-Px in serum and significantly reduce the content of MDA in the serum. The in vivo antioxidant activity of the bioactive peptide is equivalent to that of a positive control Trolox. Moreover, compared with a blank control group, the bioactive peptide PCT-1 can also reduce the α diversity index of the intestinal flora, change the overall structure of the intestinal flora, regulate the abundance of intestinal flora at various taxonomic levels, and significantly increase the content of acetic acid and butyric acid, and can be applied to foods having antioxidant and intestinal flora regulation functions.

The application relates to the technical field of medicines, and discloses arginine glycosylation modified teriparatide and application thereof. First, a glycosylation donor is synthesized through a chemical synthesis method, then, according to a template PTH: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF-NH2 amino acid sequence, arginines at positions 20 and 25 are replaced by ornithine with a Dde protecting group, the arginine glycosylation modified teriparatide is obtained by using the glycosylation donor to modify the same through a solid-phase synthesis method. The method is simple and easy to implement, has high purity and high yield. Further experiments prove that the arginine glycosylation modified teriparatide can significantly promote osteoblast differentiation, has high serum stability, and has potential application value in the treatment of diseases such as osteoporosis.

The invention belongs to the field of biological medicines, and particularly relates to application of medicarpin in preparation of medicines for preventing and / or treating immunosuppressive diseases. According to the application disclosed by the invention, it is found that the mendalin can increase the content of IL-3 and M-CSF in serum, reduce the content of EPO and increase the content of IL-34 and IL-15 in bone marrow at the same time; and the red sandalwood can increase the number of leukocytes, platelets and basophilic granulocytes in peripheral blood and enhance the multiplication capacity of bone marrow cells, so that the red sandalwood can be used for preventing and / or treating the immunosuppressive diseases, and is further used for preparing the medicines for preventing and / or treating the immunosuppressive diseases.

This invention belongs to the field of functional food core efficacy ingredient production technology, and discloses a food-grade nano-curcumin microcapsule powder, its production method, and applications. This production method utilizes the dual characteristics of pH-mediated dissociation and reconstruction of casein nanomicelles and the solubility of curcumin in a strongly alkaline environment, achieving efficient and high-loading encapsulation of curcumin with sodium caseinate, and the industrial production of high-quality microcapsule powder. The food-grade nano-curcumin microcapsule powder produced by this invention is not only simple and safe in its formulation, with its main components being only sodium caseinate, curcumin, and spray drying aids, but also features a simple production process that is easy to industrialize. Animal experiments have verified that the food-grade nano-curcumin microcapsule powder produced by this invention can significantly improve the symptoms of alcohol intoxication in mice, increase the activity of serum alcohol-metabolizing enzymes while alleviating oxidative stress damage, and reduce the release of inflammatory factors, thus exhibiting superior hangover relief and liver protection effects.

The application discloses a strain of Bifidobacterium adolescentis for relieving estrogen-related metabolic disorders and obesity and an application thereof, and belongs to the technical field of microorganisms. The Bifidobacterium adolescentis CCFM1506 screened by the application can effectively improve the symptoms of estrogen disorders of ovariectomized individuals, significantly slow down the weight growth rate and weight increment of individuals with estrogen disorders, increase the expression amounts of serum estradiol, CYP11A1 and ERa in adrenal glands and the high-density lipoprotein content in serum, reduce the total cholesterol and glucose levels, adjust abnormal glucose and lipid metabolism, increase SCFA in colon contents, relieve menopausal syndrome caused by the decrease of estrogen, and can be used for preparing medicines for relieving or treating estrogen-related metabolic disorders and obesity, or health care products for helping to control fat in the body and maintain the healthy level of blood lipids. The significant physiological effect and wide application prospect provide a new thought and new basis for developing functional foods or medicines based on probiotics.

The invention belongs to the technical field of natural medicines, and particularly relates to application of ligustrazine in preparation of medicines for promoting lymphatic neogenesis and in-vitro activation of a VEGFC / VEGFR3 signal channel. It is found for the first time that ligustrazine can remarkably enhance the proliferation and migration capacity of HLECs, the number of lymphatic vessels in an infarct marginal area can be increased after MI, inflammatory cell infiltration can be relieved, the content of VEGFC in serum can be increased, expression of lymphatic vessel neogenesis related protein and genes can be promoted, the heart function can be improved, and myocardial cell damage can be relieved. The invention also finds that ligustrazine can activate a VEGFC / VEGFR3 signal channel. The invention provides a new active ingredient for developing a lymphatic vessel regulator for promoting lymphatic vessel neogenesis, provides a new thought and method for cardiac tissue repair and function improvement after MI, and also provides a new modeling drug for constructing a lymphatic metastasis model by activating a VEGFC / VEGFR3 signal channel in vitro and evaluating the curative effect of the anti-lymphatic metastasis drug.

The invention discloses a composition helpful for controlling in-vivo fat and application thereof, and relates to the technical field of biology. The hesperidin composition is prepared from hesperidin and lactobacillus johnsonii (Lactobacillus johnsonii), and the hesperidin composition is prepared from the hesperidin and the lactobacillus johnsonii. Research finds that the composition can achieve synergistic up-regulation of gene and protein expression of adipose tissue PGC1alpha and UCP1 and increase the body surface temperature; the composition can also significantly improve the bioavailability of hesperidin and improve the concentration of hesperetin and other metabolites in serum; the composition can also optimize the intestinal microecology, improve the intestinal flora structure, increase the lactobacillus colonization rate, enrich the abundance of beneficial bacteria and promote the generation of short-chain fatty acids; the composition can also significantly improve lipid metabolism disorder of an organism, reduce fat accumulation, regulate adiponectin and leptin levels, control fat in the body and realize effective weight loss management.

The invention relates to the field of traditional Chinese medicine, and discloses a traditional Chinese medicine composition for treating spleen and kidney deficiency type male infertility and a preparation method and application thereof. The composition consists of a pharmaceutically acceptable carrier and active ingredients, the active component is prepared from the following components in parts by weight: 10 to 15 parts of fructus cnidii, 10 to 15 parts of rhizoma curculiginis, 10 to 15 parts of fructus psoraleae, 10 to 15 parts of herba epimedii, 10 to 15 parts of semen cuscutae, 10 to 15 parts of fructus lycii, 10 to 15 parts of fructus rosae laevigatae, 10 to 15 parts of fructus rubi, 10 to 15 parts of fructus ligustri lucidi, 10 to 15 parts of tortoise shell, 15 to 20 parts of herba taxilli, 10 to 15 parts of fructus schisandrae chinensis, 10 to 15 parts of rhizoma polygonati, 15 to 20 parts of semen plantaginis and 10 to 15 parts of semen citri reticulatae. The application can obviously improve the sperm quality of a patient, improve the testosterone level of serum and increase the natural pregnancy rate, and is good in safety.

The invention discloses application of bifidobacterium longum in preparation of a product for relieving cognitive impairment caused by methylmalonemia, and belongs to the technical field of microorganisms. The Bifidobacterium longum CCFM752 is preserved in the Guangdong Province Microbial Culture Collection Center, the preservation number is GDMCC (China General Microbiological Culture Collection Center) No.61157, and the preservation date is August 21, 2020. The Bifidobacterium longum CCFM752 disclosed by the invention has the advantages that the Bifidobacterium longum CCFM752 can be used for preparing the biological feed additive; the effect of the bifidobacterium longum CCFM752 for relieving the cognitive impairment of the MMA disease is comprehensively evaluated through an MMA model rat, and the effect is specifically reflected as follows: (a) the cognitive and memory impairment is relieved; (b) relieving activation of small glial cells in the hippocampus; (c) reducing the malondialdehyde level in serum and / or tissue to a certain extent; and (d) improving the level of glutathione peroxidase in serum and / or tissues to a certain extent.

The invention belongs to the technical field of traditional Chinese medicines, and particularly relates to application of a honeysuckle arthralgia clearing preparation in preparation of a medicine for preventing or treating functional dyspepsia. The honeysuckle arthralgia clearing preparation is prepared from 11 raw medicinal materials including honeysuckle, caulis sinomenii, oldenlandia diffusa, radix scrophulariae, radix paeoniae alba, radix rehmanniae recen, pseudobulbus cremastrae seu pleiones, herba pyrolae, angelica sinensis, liquorice and centipede. Pharmacodynamic experiments prove that the honeysuckle arthralgia clearing granules have the effects of remarkably improving the gastric emptying function and the small intestine propelling function of rats, regulating and controlling the oxidative stress level, improving the serum MTL and GAS levels and reducing the serum VIP content, can be used for preventing or treating functional dyspepsia, and can be used for preventing or treating chronic pharyngitis. Especially, the traditional Chinese medicine composition has a remarkable effect on functional dyspepsia caused by stomach cold, spleen deficiency or liver depression. Meanwhile, the honeysuckle arthralgia clearing preparation is high in safety and small in toxic and side effects, and the clinical medication selection of patients is enriched.

The invention belongs to the technical field of biological medicines, and particularly relates to a lactobacillus rhamnosus MF26 and application thereof in prevention and treatment of heart failure. The preservation number of the mouse combined lactobacillus MF26 is CCTCC (China Center for Type Culture Collection) NO: M 20251548, and the preservation institution of the mouse combined lactobacillus MF26 is China Center for Type Culture Collection (CCTCC). The mouse combined lactobacillus MF26 disclosed by the invention can be used for remarkably improving the heart left ventricular diastolic dysfunction of an HFpEF mouse, reducing myocardial fibrosis, relieving blood pressure rise, remarkably improving the intestinal barrier permeability, reducing the body inflammation level and remarkably improving the level of GLP-1 in serum, so that the fasting blood glucose level and the glucose tolerance of the HFpEF mouse are effectively improved. Therefore, the lactobacillus rhamnosus MF26 can be used for preparing medicines or functional foods for preventing, relieving or / and treating ejection fraction retention type heart failure.

This invention discloses the application of Dendrobium huoshanense protocorms in anti-fatigue and kidney-tonifying and aphrodisiac effects. Combining Dendrobium huoshanense protocorms with Cistanche deserticola, American ginseng, Rubus idaeus, Cornus officinalis, and Lycium barbarum significantly enhances the anti-fatigue and kidney-tonifying and aphrodisiac effects of the formula. Compared with Cistanche deserticola alone, adding Dendrobium huoshanense protocorms significantly prolongs the exhaustive swimming time in mice, reduces serum urea nitrogen and lactic acid levels, increases liver glycogen content, and increases muscle glycogen content. Compared with Cistanche deserticola alone, adding Dendrobium huoshanense protocorms significantly increases serum superoxide dismutase activity, reduces serum malondialdehyde content, increases serum testosterone content, increases penile nitric oxide synthase activity, and increases penile nitric oxide and cyclic guanosine monophosphate content in penile tissue.

This invention provides the application of human protocadherin 18 (PCDH18) as a biomarker in the preparation of products for the diagnosis, auxiliary diagnosis, or progression prediction of antiphospholipid syndrome (APS), belonging to the field of in vitro diagnostic technology. In this invention, detecting serum PCDH18 levels in patients is helpful in diagnosing APS and is specific to this disease, and can be used to differentiate APS from other connective tissue diseases. Furthermore, APS patients have higher serum PCDH18 levels compared to asymptomatic aPL-positive patients. Therefore, PCDH18 testing in aPL-positive individuals is helpful for the early diagnosis and intervention of APS. Additionally, serum PCDH18 levels in OAPS patients are significantly higher than in TAPS patients, suggesting that PCDH18 can serve as a biomarker for differentiating or assisting in the differentiation of TAPS and OAPS.