Patents
Literature
Patsnap Eureka AI that helps you search prior art, draft patents, and assess FTO risks, powered by patent and scientific literature data.

63 results about "Ovarian reserve" patented technology

Ovarian reserve is a term that is used to determine the capacity of the ovary to provide egg cells that are capable of fertilization resulting in a healthy and successful pregnancy. With advanced maternal age the number of egg cell that can be successfully recruited for a possible pregnancy declines, constituting a major factor in the inverse correlation between age and female fertility.

System for assessing ovarian reserve functions in subjects

The present invention relates to a system for assessing ovarian reserve functions in subjects. The system for assessing the ovarian reserve functions of the subjects comprises a data acquisition module used for obtaining data of a subject's age, an anti-Mullerian hormone (AMH) level, a follicle stimulating hormone (FSH) level and antral follicle counting (AFC); and a module for calculating the ovarian reserve functions used for calculating information obtained in the data acquisition module to calculate a probability (p) of subject's ovarian hyporesponsiveness. Further, a relationship betweenthe predicted ovarian hyporesponsiveness probability and a medicine dose of an ovulation-promoting medicine is predicted to divide populations into four groups in order to group closes ovarian responsiveness into one group.
Owner:GUANGZHOU KANGRUN BIOTECHNOLOGY CO LTD

Female fertility test

The present invention is related to a diagnostic test kit that assesses ovarian reserve by measuring Follicle Stimulating Hormone (FSH) in a liquid sample. The sample can be deposited on a first portion of the device for transport to a second portion of the device. The device can include a release medium formed of a first material and including a detectable label thereon and a capture medium, including a test site, in fluid communication with the release medium and formed of a second, different material.
Owner:CHURCH & DWIGHT CO INC

Effect study method and application of melatonin in prediction of ovarian reserve and IVF-ET (in-vitro fertilization and embryo transfer) outcome

InactiveCN106168621AIncrease success rateFacilitates personalized treatment plansDiagnostic recording/measuringSensorsPhysiologyOvary
The invention discloses an effect study method of melatonin in prediction of ovarian reserve and IVF-ET (in-vitro fertilization and embryo transfer) outcome. The method includes: collecting basic clinical data of 61 females, and dividing the 61 females into three groups, namely a poor ovarian response group, a normal ovarian response group and a high ovarian response group mainly through age, retrieved oocyte number and anti-mullerian hormone value according to the stimulus response of the ovaries; collecting follicular fluid of the 61 females, adopting melatonin radioimmunoassay to determine melatonin concentration in the follicular fluid of the 61 females, and analyzing the levels of the melatonin concentration and other clinical data in the poor ovarian response group, the normal ovarian response group and the high ovarian response group; analyzing the levels of relevant data of in-vitro fertilization outcome in the poor ovarian response group, the normal ovarian response group and the high ovarian response group, and verifying relevance of the melatonin concentration and IVF-ET outcome; verifying relevance of the melatonin level and ovarian reserve. Through detection of melatonin concentration in the follicular fluid, ovarian reserve and IVF-ET outcome are predicted.
Owner:RENJI HOSPITAL AFFILIATED TO SHANGHAI JIAO TONG UNIV SCHOOL OF MEDICINE

Mullerian inhibiting substance levels and ovarian response

Methods and kits are provided for assessing the ovarian reserve and predicting the ovarian response to fertility treatments in a female subject. The serum levels of MIS are shown to be positively correlated with the production and retrieval of mature oocytes and serve as prognostic indicators for the female response to fertility treatment. The MIS levels can be monitored prior to and during fertility treatment and are useful to adjust the timing and dosage of treatments in order to produce optimal outcome in individual patients, to avoid ovarian hyperstimulation, or to indicate cancellation of an unsuccessful treatment. MIS can also be administered to women to stimulate follicle development and to prevent depletion of ovarian reserve.
Owner:RUTGERS THE STATE UNIV

Traditional Chinese medicine composition for treating decrease of ovarian reserve functions and application of traditional Chinese medicine composition

The invention discloses a traditional Chinese medicine composition for treating decrease of ovarian reserve functions. The traditional Chinese medicine composition is prepared from effective components and medicine excipients. The effective components comprise, by weight, 5-30 parts of radix rehmanniae preparata, 6-30 parts of fructus lycii, 9-30 parts of caulis spatholobi, 9-35 parts of herba epimedii, 5-30 parts of semen cuscutae, 5-30 parts of herba cistanches, 3-30 parts of rhizoma cyperi and 3-15 parts of fructus crataegi. The traditional Chinese medicine composition has the advantages that menstrual amount decrease symptoms related to the decrease of the ovarian reserve functions can be obviously relieved by the traditional Chinese medicine composition, and effective up-regulation effects can be realized for related hormone AMH (anti-mullerian hormone) which can reflect the decrease of the ovarian reserve functions; MRS scores and traditional Chinese medicine symptom scores which can reflect the life quality of patients can be improved by the traditional Chinese medicine composition; effects of the traditional Chinese medicine composition for improving the decrease of the ovarian reserve functions are possibly relevant to improvement of ovarian blood supply and reduction of artery blood resistance indexes; the traditional Chinese medicine composition is free of obvious side effects when used within short time.
Owner:LONGHUA HOSPITAL SHANGHAI UNIV OF TRADITIONAL CHINESE MEDICINE

Traditional Chinese medicine paste preparation capable of tonifying kidney and kidney yin for women and preparation method of traditional Chinese medicine paste preparation

The invention discloses a traditional Chinese medicine paste preparation capable of tonifying kidney and kidney yin for women and a preparation method of the traditional Chinese medicine paste preparation. The traditional Chinese medicine paste preparation comprises semen cuscutae, ginseng, deer-horn glue, glossy privet fruit, prepared rehmannia roots, wolfberry fruit, rhizoma polygonati, herba epimedii, fried rhizoma atractylodis macrocephalae, angelica sinensis, rhizoma curculiginis, Chinese yam, fried eucommia ulmoides, fructus alpiniae oxyphyllae, cynomorium songaricum, asparagus cochinchinensis, bletilla striata, fried astragalus membranaceus, morinda officinalis, dipsacus roots, radix salviae miltiorrhizae and achyranthes roots; the prepared rehmannia roots, the herba epimedii, radix asparagi, eclipta alba, salted rhizoma anemarrhenae, the dipsacus roots, honey-fried licorice roots and longan aril as the main drugs, the ligusticum wallichii powder, dogwood, paenoiae alba, human placenta and poria cocos as the adjuvants, the traditional Chinese medicine paste preparation nourishes kidney essence, tonifies the spleen, regulating the liver, replenishes qi and enriches blood after being eaten by the women; the traditional Chinese medicine paste preparation helps to treat irregular menstruation, oligomenorrhea, amenorrhea and infertility, improves the low ovarian reserve function and premature ovarian failure, promotes the reproductive health of women, delays ageing, and improves the immunological function; the traditional Chinese medicine paste preparation leads to black hair, removes black spots, helps to grow and moisten the hair, leads to a contented look, and helps to improve the looks.
Owner:成都六然堂益生菌研究所

Composition for improving premature ovarian failure, preparation method therefor and application of composition

The invention belongs to the technical field of biomedicines and particularly relates to a composition for improving premature ovarian failure, a preparation method therefor and application of the composition. According to the composition for improving the premature ovarian failure, provided by the invention, an in-vitro-constructed human uterine endometrium stem-cell cell membrane and a mesenchymal stem cell exosome are used in a compounded manner, thus, the development of ovarian follicles can be promoted, ovaries can be promoted to secrete an anti-Mullerian hormone, an ovarian follicle generator promoting level can be regulated, the apoptosis of ovarian cells can be inhibited, the adverse reserve function disease of the ovaries can be improved, the effect of improving primary or secondary premature ovarian failure is good, and thus, a new way of think is provided for clinically treating ovarian insufficiency and polycystic ovarian syndrome.
Owner:陕西中鸿科瑞再生医学研究院有限公司

System for assessing ovarian reserve function in subject

The invention relates to a system for optimized assessment of an ovarian reserve function in a subject. The system comprises: a data acquisition module, which is used for acquiring data of the age, the anti-mullerian hormone (AMH) level, the follicle-stimulating hormone (FSH) level of the subject; and a module for calculating the ovarian reserve function, wherein the module is used for calculatinginformation acquired in the data acquisition module so as to calculate the probability (p) of the low ovarian response of the subject.
Owner:GUANGZHOU KANGRUN BIOTECHNOLOGY CO LTD

Anti-Mullerian hormone quantitative measurement reagent and method based on nanometer up-converting phosphor method

The invention relates to an anti-Mullerian hormone quantitative measurement reagent and method based on a rare earth nanometer up-converting phosphor method. UCP particles in which the up-converting phosphor method is adopted are used as a biomarker, and an anti-AMH antibody is specifically marked. Through the adoption of the anti-Mullerian hormone quantitative measurement reagent and method based on the up-converting phosphor method, the content of AMH in a measured sample can be quickly, simply, quantitatively and accurately measured, and a detection basis is provided for evaluation of the female ovarian reserve function.
Owner:BEIJING HOTGEN BIOTECH CO LTD +1

System and method for calculating age limit of new change of ovarian reserve of subject

The invention relates to a system for calculating the age limit of new change of ovarian reserve of a subject, and the system comprises a data acquisition module which is used for obtaining the age, anti-mullerian hormone level, follicle-stimulating hormone level and sinus follicle counting data of the subject; a module for calculating an ovarian reserve function which uses a subject working characteristic curve for detecting the demarcation points of the age, the anti-mullerian hormone level, the follicle-stimulating hormone level and the sinus follicle counting of the subject acquired in thedata acquisition module, converts the age, the anti-mullerian hormone level, the follicle-stimulating hormone level and the sinus follicle count into dichotomy variables according to the tangent point value of the demarcation point and calculates the current low ovarian response probability (p0) of the subject by using the dichotomy variables as prediction variables; and a module for calculatingthe age limit of the subject when the ovarian reserve of the subject is reduced to a certain degree, which is used for calculating the age limit of the subject when the ovarian reserve of the subjectis newly changed by utilizing the current ovarian reserve, namely the ovarian low-response probability (p0).
Owner:GUANGZHOU KANGRUN BIOTECHNOLOGY CO LTD

Oocyte quality evaluation method

The invention relates to an oocyte quality evaluation method. The method comprises the step of comparing the composition of follicular fluid metabolites of a subject with low ovarian reserve functionwith that of a healthy subject. The characteristic biomarker is screened through metabonomics analysis, the relationship between the follicular fluid metabolism marker group and the quality of the oocytes is determined, and a more objective and noninvasive oocyte quality evaluation method is established.
Owner:BEIJING OBSTETRICS & GYNECOLOGY HOSPITAL CAPITAL MEDICAL UNIV

Method for analyzing relation between follicular fluid metabolite and oocyte quality

The invention relates to a method for analyzing the relation between a follicular fluid metabolite and oocyte quality. The method is characterized by comprising a step of comparing the composition ofthe follicular fluid metabolite of a subject with low ovarian reserve with that of the follicular fluid metabolite of a healthy subject. According to the method in the invention, a characteristic biomarker is screened through metabonomics analysis, the relationship between the follicular fluid metabolism marker group and the oocyte quality is determined, and a more objective and non-invasive oocyte quality evaluation method is established.
Owner:BEIJING OBSTETRICS & GYNECOLOGY HOSPITAL CAPITAL MEDICAL UNIV

Application of sea-buckthorn fruit pulp in treatment of PCOS (polycystic ovary syndrome)

ActiveCN110025642AReturn to normal reserveCorrection of estrous cycle disordersNatural extract food ingredientsSexual disorderTherapeutic effectBlood sugar
The invention discloses a new application of sea-buckthorn fruit pulp, namely, an application of the sea-buckthorn fruit pulp in the preparation of drugs for treating PCOS (polycystic ovary syndrome)and an application of the sea-buckthorn fruit pulp in the preparation of health-care food for treating PCOS. The result of an experiment shows the sea-buckthorn fruit pulp has a comprehensive therapeutic effect on PCOS. The sea-buckthorn fruit pulp can not only improve polycystic ovarian lesions in mice with PCOS, but also correct the estrous cycle disturbance of PCOS, maintain AMH level, and restore normal ovarian reserve. In endocrine metabolism, the sea-buckthorn fruit pulp can effectively lower blood sugar, reduce obesity and the like. The application provides scientific evidence for sea-buckthorn fruit pulp directly used in the treatment of PCOS.
Owner:NINGXIA MEDICAL UNIV

System and method for predicting new change age limit of ovarian reserve of subject

ActiveCN111772682AThe best time to give birthSurgeryVaccination/ovulation diagnosticsObstetricsHormones levels
The invention relates to a system for predicting new change age limit of ovarian reserve of a subject. The system comprises a data collection module which is used for obtaining the data of the age, anti-mullerian hormone level and follicle stimulating hormone level of the subject, a module for calculating an ovarian reserve function, wherein the module calculates a current ovarian hyporesponse probability (p0) of the subject using a multi-taxonomic variable that is obtained by conversion of the data of subject age, subject anti-mullerian hormone (AMH) level, subject follicle stimulating hormone (FSH) level, and a module for calculating the age limit of the ovarian reserve decline of the subject to a certain extent, wherein the module is used for calculating the age limit of the new changeof the ovarian reserve of the subject by using the current ovarian reserve of the subject, namely the ovarian hyporesponse probability (p0).
Owner:GUANGZHOU KANGRUN BIOTECHNOLOGY CO LTD

Device for treating infertility, system thereof and method for performing body fluid regulation and neural channel and collateral regulation

The invention relates to the field of medical technology, and particularly to a device for treating infertility, a system thereof and a method for performing body fluid regulation and neural channel and collateral regulation. The system performs body fluid regulation and neural channel and collateral regulation and settles an infertility problem caused by thin endometrium, low uterine receptivity,premature ovarian failure and low ovarian reserve function. Compared with prior art, The device, the system and the method according to the invention have advantages of realizing no physical invasion, no side effect and simple operation, improving human body fluid circulation, improving blood supply to reproductive organs such as pelvic cavity, uterus and ovary, improving nutrition supply and promoting generation of new blood vessels. The device, the system and the method according to the invention further have advantages of improving a human body reproduction endocrine system, improving hormone level, balancing an inner environment, and effectively treating infertility caused by thin endometrium, low uterine receptivity, premature ovarian failure and, ovarian reserve function, and furthermore can be used for auxiliary treatment before IVF-ET surgery.
Owner:NANJING MEDLANDER MEDICAL TECH CO LTD

Composition with function of nourishing ovarium and preparation method of composition

The invention discloses a composition with a function of nourishing the ovarium and a preparation method of the composition. The composition is prepared from 30-50 parts of soy protein, 15-25 parts ofpea protein, 15-25 parts of black soya beans, 3-6 parts of radix puerariae, 1-5 parts of folium perillae, 1-5 parts of fructus lycii, 3-6 parts of radix polygonati officinalis, 0.1-0.8 part of lycopene, 0.1-0.5 part of folic acid, 0.1-0.5 part of vitamin D and 0.01-0.05 part of mogroside. The composition can delay aging of the ovarium, control the follicle-stimulating hormone within a normal range, improve the ovarian reserve function, inhibit or delay reduction of the ovarian reserve function in the early stage especially in the prevention aspect, and exert the good effect of nourishing theovarium.
Owner:GUANGZHOU ZHENGGUANG BIOTECH CO LTD

Traditional Chinese medicine composition for treating premature ovarian failure as well as preparation method and application of traditional Chinese medicine composition

The invention belongs to the technical field of traditional Chinese medicines, and particularly discloses a traditional Chinese medicine composition for treating premature ovarian failure. The traditional Chinese medicine composition is prepared from the following raw materials in parts by weight: 8-20 parts of radix rehmanniae preparata, 6-10 parts of fructus corni, 10-30 parts of Chinese yam, 10-15 parts of fructus lycii, 6-10 parts of tortoise-plastron glue, 6-10 parts of deer-horn glue, 10-25 parts of semen cuscutae, 6-10 parts of radix cyathulae, 10-15 parts of fructus psoraleae, 10-15 parts of herba taxilli, 10-15 parts of radix dipsaci, 6-10 parts of ginseng, 10-30 parts of radix astragali, 6-10 parts of rhizoma atractylodis macrocephalae, 10-15 parts of radix angelicae sinensis, 10-15 parts of radix paeoniae alba, 6-10 parts of pericarpium citri reticulatae and 6-10 parts of radix glycyrrhizae preparata. The traditional Chinese medicine composition for treating premature ovarian failure can effectively inhibit apoptosis of granulosa cells, promote follicular maturation and improve ovarian reserve capacity, and is high in safety.
Owner:SHAANXI UNIV OF CHINESE MEDICINE

Application of pyrroloquinoline quinine to improvement on internal environment of female reproductive system

Disclosed is application of pyrroloquinoline quinine to improvement on an internal environment of a female reproductive system. The pyrroloquinoline quinine is applied in a form of a compound which is prepared from, by weight, 1-9 parts of pyrroloquinoline quinine, 2-8 parts of artemisinin, 1-8 parts of mint and 3-9 parts of borneol. The application of the pyrroloquinoline quinine to improvement on the internal environment of the female reproductive system has the advantages that the compound consisting of the pyrroloquinoline quinine, the artemisinin, the mint and the borneol is capable of effectively inhibiting harmful bacteria hidden in wrinkles and recesses of a vagina or cervix muscles, guaranteeing reproductive health, delaying menopause, recovering menorrhea, delaying senescence, promoting secretion of hormones, improving ovarian functions, enhancing ovarian reserve capability, increasing body's hormone level, repairing striae gravidarum and rejuvenating, has good treatment effect on various skin inflammations and skin ulcerations and has the advantages of capabilities of repairing inner walls of female vaginae and endometria, no toxic or side effect, no dependency, safety, effectiveness and capability of treating both symptoms and root causes.
Owner:SHENZHEN TAISHENGYUAN HEALTH IND

A traditional Chinese medicine composition for treating ovarian reserve function decline disease and its pharmaceutical application

The invention discloses a traditional Chinese medicine composition for treating diseases with decreased ovarian reserve function. Turmeric etc. The traditional Chinese medicine composition has the effects of nourishing the kidney and nourishing the essence, nourishing the blood and soothing the liver, nourishing yin and promoting yang, and is mainly used for the treatment of insufficient kidney essence and liver stagnation and blood deficiency syndrome, and can be used for the treatment of diseases with decreased ovarian reserve, preferably decreased ovarian reserve, Premature ovarian insufficiency, premature ovarian failure, ovarian hyporesponse, infertility and perimenopausal syndrome caused by the above diseases. Long-term clinical application proves that the present invention has definite curative effect, is safe and has no side effect, and has broad clinical value.
Owner:北京厚成医药科技有限公司

Ointment for treating degrading of ovarian reserve function and preparation method thereof

The invention discloses an ointment for treating degrading of ovarian reserve function and a preparation method thereof. The ointment is prepared from the following Chinese herbal medicines in parts by weight: 100 to 500g of radix rehmanniae, 100 to 500g of radix rehmanniae preparata, 100 to 500g of rhizoma dioscoreae, 100 to 500g of fructus corni, 100 to 500g of poria cocos, 100 to 500g of root of dipsacus asperoides, 100 to 500g of taxilli herba, 100 to 500g of semen cuscutae, 100 to 500g of eucommiae cortex, 50 to 200g of dried tangerine peel, 100 to 500g of fried bighead atractylodes rhizome, 50 to 200g of citri sarcodactylis fructus and the like. The pharmaceutical composition has the advantages that solid support by a typical theory of Chinese medicine gynecology is adopted, and the proportional ratio of components is reasonable; the clinical therapy effect is obvious, the toxic or side effect is little, the administration is safe, and the ointment can be used for preparing a traditional Chinese medicine composition for treating the degrading of ovarian reserve function after multiple times of external fertilization and embryo transplantation; the medicine taste is little, the quality is easily controlled, and the cost is low.
Owner:付曙光

Traditional Chinese medicine for treating infertility of women

The invention discloses a traditional Chinese medicine for treating infertility of women. The traditional Chinese medicine is prepared through the following raw medicines: 15 to 20g of angelica sinensis, 20 to 25g of radix paeoniae alba, 8 to 10g of ligusticum wallichii, 6 to 8g of flowers carthami, 12 to 15g of peach kernel, 12 to 15g of herba lycop, 50 to 60g of fructus Lycii, 12 to 15g of pangolin, 20 to 25g of radix rehmanniae, and 12 to 15g of rhizoma cyperi. The traditional Chinese medicines have the effects of treating vital channel and front middle channel asthenic disease, irregular menstruation, perinavel region pain, metrorrhagia and metrostaxis, block and hard blood conglomeration, dolor intermitente, inappropriate gestation regulation, threatened abortion, abdominal pain and blood stasis, postpartum lochiostasis, incrustation and onglomerations and gatherings, lateral lower abdomen pain, intermittent chills and fever, traumatic injury, extravasated blood in enterocoelia, promoting blood circulation to restore menstrual flow, consolidating basis, and strengthening body resistance and eliminating evil, and particularly shows outstanding effect on treating treating infertility of women caused by endocrine dyscrasia, decreased ovarian reserve and other causes based on thousands of clinical trial, and the effective rate reaches more than 95%.
Owner:张保金

Traditional Chinese medicine composition and medicament for treating ovarian reserve function reduction and preparation method thereof

The invention provides a traditional Chinese medicine composition and medicament for treating ovarian reserve function reduction and a preparation method thereof, and relates to the technical field of traditional Chinese medicines. The traditional Chinese medicine composition is mainly composed of fructus rubi, semen cuscutae, herba cistanches, radix puerariae, radix asparagi, radix angelicae sinensis, fried white paeony root and semen platycladi. The traditional Chinese medicine composition and the prepared medicament thereof have the functions of tonifying kidney and nourishing liver, warming yang and benefiting qi, nourishing blood and regulating menstruation, nourishing Yin and moistening dryness, and nourishing the blood and tranquilization, can be used for treating the symptoms of scant menstrual flow, oligomenorrhea, amenorrhea, infertility and the like caused by deficiency of kidney-essence and deficiency of the kidney yin of ovarian reserve function reduction patients, and relieving different degrees of perimenopausal symptoms of the patients at the same time. The traditional Chinese medicine composition and the prepared medicament thereof can be widely applied to the treatment of the ovarian reserve function reduction patients.
Owner:HANGHZOU HOSPITAL OF TRADITIONAL CHINESE MEDICINE

Traditional Chinese medicine composition for treating ovarian reserve function decline disease

The invention discloses a traditional Chinese medicine composition for treating an ovarian reserve function decline disease. The traditional Chinese medicine composition is prepared from the following raw materials: rehmannia, rhizoma polygonati, loranthus parasiticus, teasel root, glossy privet fruit, wolfberry fruit, salvia miltiorrhiza, radix curcumae and the like. The traditional Chinese medicine composition has the effects of nourishing kidney and replenishing essence, nourishing blood and soothing liver, and nourishing yin and raising yang, is mainly used for treating kidney essence deficiency and liver depression and blood deficiency, can be used for treating the ovarian reserve function decline disease, and preferably is used for treating ovarian reserve function decline, premature ovarian insufficiency, premature ovarian failure, ovarian hyporeaction, infertility and perimenopausal syndrome caused by the diseases, and the like. Long-term clinical application proves that the traditional Chinese medicine composition is accurate in curative effect, safe and free of a side effect, and has a wide clinical value.
Owner:BEIJING HOUCHENG PHARM TECH CO LTD

Pharmaceutical composition for warming kidney and tonifying yang

The invention discloses a pharmaceutical composition for warming kidney and tonifying yang. The pharmaceutical composition is prepared from the following raw material medicines in parts by mass of 7-13 parts of herba epimedii, 7-13 parts of rhizoma drynariae and 7-13 parts of herba cistanche. The kidney warming and yang tonifying compound can improve the uterus microenvironment from the aspects of serum sex hormone, endometrial thickness and gland function, female progestational hormone receptor expression, uterus microvessel density, uterus local area factors and the like, can also improve the ovum function, enhance ovarian reserve, promote oocyte maturation and inhibit cell excessive apoptosis, the occurrence of abnormal ova and atresia follicles is reduced, the positive improvement effect on Chong and Ren deficiency reproductive disorder is achieved, and the pregnancy outcome is changed.
Owner:陆华

Granular traditional Chinese medicine for improving ovarian reserve function and preparation method thereof

The invention belongs to the technical field of medicines, and particularly relates to a granular traditional Chinese medicine for improving the ovarian reserve function and a preparation method thereof. The traditional Chinese medicine is prepared from the following medicinal materials in parts by weight of 10-15 g of fructus ligustri lucidi, 10-15 g of fructus lycii, 10-15 g of semen astragali complanati, 9-15 g of fructus rubi, 15-20 g of semen cuscutae, 6-9 g of tortoise shell and plastron glue, 3-6 g of deer-horn glue, 6-9 g of lysimachia foenum-graecum hance, 10-15 g of massa medicata fermentata, 15-30 g of fructus nelumbinis, 15-25 g of fried cortex eucommiae and 1.5-5 g of original silkworm moth. The traditional Chinese medicine has the effects of tonifying the kidney and spleen, soothing liver-qi stagnation, dissolving turbidity and soothing nerves; and research results show that the medicine can obviously improve the IVF egg obtaining rate of patients with low ovarian reserve function and effectively improve the ovarian reserve function, is definite in curative effect and is worthy of clinical popularization and application.
Owner:SHANXI YELLOW RIVER TRADITIONAL CHINESE MEDICINE +1

Mullerian inhibiting substance levels and ovarian response

Methods and kits are provided for assessing the ovarian reserve and predicting the ovarian response to fertility treatments in a female subject. The serum levels of MIS are shown to be positively correlated with the production and retrieval of mature oocytes and serve as prognostic indicators for the female response to fertility treatment. The MIS levels can be monitored prior to and during fertility treatment and are useful to adjust the timing and dosage of treatments in order to produce optimal outcome in individual patients, to avoid ovarian hyperstimulation, or to indicate cancellation of an unsuccessful treatment. MIS can also be administered to women to stimulate follicle development and to prevent depletion of ovarian reserve.
Owner:RUTGERS THE STATE UNIV

Polypeptide BPP capable of protecting and prolonging ovarian function and application of polypeptide BPP

The invention relates to polypeptide BPP capable of protecting and prolonging the ovarian function and application of the polypeptide BPP. The complete sequence of the polypeptide BPP is KETWWETWWTEWSQPKKKRKVQSKRAASIQRTSA. The self-innovated sequence has a cell membrane penetrating function and can specifically inhibit the activity of endogenous PROM, and accordingly the polypeptide BPP can protect and prolong the ovarian function through various administration approaches (intramuscular injection, oral taking, skin absorption by adding the polypeptide BPP into cosmetics and the like), can prevent premature ovarian failure and reproductive ability lowering even loss, caused by the fact that chemotherapeutic drugs excessively activate the follicles, of adolescent female (20-34 years old) during chemotherapy, and has effects of original follicle activation delaying, reproductive ability increasing and menopause delaying on female (35-37 years old) whose ovarian reserve and reproductive ability starts lowering evidently.
Owner:NANJING MEDICAL UNIV

Traditional Chinese medicine Li medicine composition for reducing ovarian reserve function, preparation method and application thereof

The invention provides a traditional Chinese medicine Li medicine composition for reducing an ovarian reserve function. The traditional Chinese medicine Li medicine composition is prepared from 18-22 parts of radix rehmanniae preparata, 13-17 parts of entada phaseoloides, 13-17 parts of radix angelicae sinensis, 13-17 parts of radix paeoniae alba, 18-22 parts of rhizoma polygonati, 10-14 parts of fructus corni, 18-22 parts of radix puerariae, 18-22 parts of caulis spatholobi, 18-22 parts of semen cuscutae, 8-12 parts of Jianqu, 4-6 parts of agilawood and 2-4 parts of radix glycyrrhizae. The invention further provides a corresponding traditional Chinese medicine Li medicine preparation and application thereof. According to the invention, the traditional Chinese medicine Li medicine composition can effectively increase the blood supply of ovary, improve the local microenvironment of the ovary and the uterus, and further increase the number of sinus follicles by adjusting the hypothalamus-pituitary-ovary reproductive axis, increasing the reaction of the ovary to gonadotropin and adjusting internal secretion, so that the clinical treatment effect is improved, the clinical symptoms of patients are improved, and the outcome of DOR and infertility is improved; and the traditional Chinese medicine Li medicine composition has low toxic and side effects, low price, local characteristics and wide market prospect and development value.
Owner:HAINAN MEDICAL COLLEGE

Traditional Chinese medicine composition for treating irregular menstruation, preparation method of composition and application of composition

The invention provides a traditional Chinese medicine composition for treating irregular menstruation. The traditional Chinese medicine composition is a preparation which is prepared from, by weight,10-20 parts of sweet potato pulp, 10-20 parts of Indian bread, 5-10 parts of Chinese angelica roots, 5-15 parts of fried largehead atractylodes rhizomes, 5-15 parts of fried common peony roots, 5-15 parts of prepared rehmannia roots, 5-15 parts of wine-processed glossy privet fruits, 10-20 parts of yerbadetajo herbs, 15-30 parts of Chinese dodder seeds, 10-20 parts of Himalayan teasel roots, 5-15parts of medicinal cyathula roots, 15-30 parts of common yam rhizomes stir-baked with bran, 10-20 parts of common trumeric roots, 5-15 parts of sliced antlers, 10-20 parts of salt-processed malaytea scurfpea fruits and 5-10 parts of ural licorice roots. The traditional Chinese medicine composition can safely and effectively treat the irregular menstruation and can effectively treat limb tiredness,lumbosacral pain, cold intolerance and limb cold and irregular menstrual period caused by the irregular menstruation. According to the traditional Chinese medicine composition, female ovary functionscan be improved, the accumulating capacity of ovaries is improved, follicular development and ovulation are facilitated, endometria are thickened, follicles are enlarged, female hormone and progestational hormone are balanced, and female infertility caused by the irregular menstruation is effectively treated.
Owner:ZHENJIANG NO 1 PEOPLES HOSPITAL

Application of plant fruit pulp in preparation of medicines and health-care foods for preventing ovarian injury caused by chemoradiotherapy

The invention discloses application of plant fruit pulp in preparation of medicines and health-care food for preventing ovarian injury caused by chemoradiotherapy. The plant fruit pulp is sea buckthorn fruit pulp. The application finds that the sea buckthorn fruit pulp has a very good prevention effect on ovarian injury caused by chemoradiotherapy. The sea buckthorn fruit pulp not only can preventmouse ovarian injury and estrus cycle disorder caused by chemoradiotherapy, but also can effectively improve the ovarian reserve function and the like. The invention provides a basis for preventing ovarian injury caused by chemoradiotherapy by directly utilizing the sea buckthorn fruit pulp.
Owner:NINGXIA MEDICAL UNIV
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More