Unlock instant, AI-driven research and patent intelligence for your innovation.

Polypeptide fragment D and application thereof

A technology of polypeptide fragments and amino acids, which is applied in the field of biomedicine, can solve problems such as not easy to become a drug, easy to produce immunogenicity, and reduce the histopathological score of the colon of IBD mice, etc., achieve small molecular weight, reduce the histopathological score of the colon, improve Effects of pathological morphology of the colon

Active Publication Date: 2021-04-20
SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
View PDF6 Cites 2 Cited by
  • Summary
  • Abstract
  • Description
  • Claims
  • Application Information

AI Technical Summary

Problems solved by technology

[0004] In order to solve the shortcomings of MIMP, which has an improving effect on inflammatory bowel disease in the prior art, which is prone to immunogenicity and difficult to become a drug, the purpose of the present invention is to provide a polypeptide fragment D (abbreviated as MP-D) and its application. The polypeptide fragment D of the present invention can significantly improve the colonic pathological morphology of IBD mice, reduce the colonic histopathological score and colonic interferon-γ expression level of IBD mice

Method used

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
View more

Image

Smart Image Click on the blue labels to locate them in the text.
Viewing Examples
Smart Image
  • Polypeptide fragment D and application thereof
  • Polypeptide fragment D and application thereof
  • Polypeptide fragment D and application thereof

Examples

Experimental program
Comparison scheme
Effect test

Embodiment 1

[0029] Example 1: Experiment of the effect of MP-D intervention on DSS-induced inflammatory bowel disease in mice

[0030] The sequence of the polypeptide fragment D (MP-D) used in this embodiment is that the 9th amino acid Xaa of the amino acid sequence shown in SEQ ID No.1 is Gln, the 20th amino acid Xaa is Arg, and the 25th amino acid Xaa is Asn The sequence of THTVGSYFQVQNGYVGAFSRALGNNEYAMNS.

[0031] 1. Experimental method

[0032] 1.1 Establishment of mouse model of acute inflammatory bowel disease

[0033] When a certain concentration of DSS solution is administered to mice, an acute inflammatory bowel disease model characterized by diarrhea, blood in the stool, ulcers, and granulocyte infiltration can be induced. The experimental grouping followed the principle of randomness, and stratified random grouping was carried out according to the weight of the mice. Divide 40 healthy male C57BL6 mice into four groups of 10:

[0034] Blank control group: gavage with water e...

Embodiment 2

[0060] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment D (MP-D) used in this example is the amino acid shown in SEQ ID No.1 The sequence when the 9th amino acid Xaa is Tyr, the 20th amino acid Xaa is Glu, and the 25th amino acid Xaa is Thr, that is THTVGSYFYVQNGYVGAFSEALGNTEYAMNS.

Embodiment 3

[0062] The reagents, materials, equipment, and experimental methods used in this example are the same as in Example 1, the only difference being that the sequence of the polypeptide fragment D (MP-D) used in this example is the amino acid shown in SEQ ID No.1 The amino acid Xaa at the 9th position of the sequence is Gly, the amino acid at the 20th position Xaa is Ser, and the amino acid at the 25th position Xaa is Pro, namely THTVGSYFGVQNGYVGAFSSALGNPEYAMNS.

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

PUM

No PUM Login to View More

Abstract

The invention belongs to the technical field of biological medicine, and particularly relates to a polypeptide fragment D and application thereof. The polypeptide fragment D has an amino acid sequence shown as SEQ ID No.1, the ninth amino acid Xaa is Tyr, Val, Gly, Ser, Gln or absent, the twentieth amino acid Xaa is Ser, Gln, Glu, Tyr, Arg or absent, and the 25th amino acid Xaa isAsn, Thr, Ser, Pro, Leu or absent. The MP-D significantly improves the colon pathological form of an IBD mouse model, reduces the colon histopathology score and the colon interferon-gamma expression content, and has the ability to intervene in the occurrence of inflammatory bowel disease in mice.

Description

technical field [0001] The invention belongs to the technical field of biomedicine, and in particular relates to a polypeptide fragment D and its application. Background technique [0002] Inflammatory bowel disease (IBD) is an idiopathic chronic intestinal inflammatory disease. Its lesions are mainly located in the colorectal segment and involve the mucosa and muscularis mucosa. In severe cases, there are liver and gallbladder, muscle skin and blood coagulation. In terms of complications, 20-30% of patients with recurrent disease may transform into colorectal cancer, which is a very serious intestinal inflammatory disease and can be divided into ulcerative colitis (ulcerative colitis, UC) and Crohn's disease (Crohn's disease, CD) two categories. At present, IBD is considered to be an intestinal inflammatory reaction caused by the abnormality of intestinal mucosal innate immunity and acquired immunity under the interaction of multiple factors such as environment, genetics, ...

Claims

the structure of the environmentally friendly knitted fabric provided by the present invention; figure 2 Flow chart of the yarn wrapping machine for environmentally friendly knitted fabrics and storage devices; image 3 Is the parameter map of the yarn covering machine
Login to View More

Application Information

Patent Timeline
no application Login to View More
Patent Type & Authority Applications(China)
IPC IPC(8): C07K14/335A61K38/16A61P1/00A61P1/04A61P29/00A23L33/18
CPCA61K38/16A61P1/00A61P1/04A61P29/00C07K14/335A61K38/00A23L33/18C07K14/4702
Inventor 张彩华常英
Owner SHANGHAI LONGXIN BIOMEDICAL TECH CO LTD
Features
  • R&D
  • Intellectual Property
  • Life Sciences
  • Materials
  • Tech Scout
Why Patsnap Eureka
  • Unparalleled Data Quality
  • Higher Quality Content
  • 60% Fewer Hallucinations
Social media
Patsnap Eureka Blog
Learn More